F378596

General Info

Members Datasets Scaffolds Average Seq Length
272 171 544 250

Family's Representative Sequence

Representative Sequence 3300046528|Ga0495642_0017372|Ga0495642_0017372_914_1630
Length 238
Sequence VLAGEIPLAERRSGYEFMGRETRAMQDDDSTNPALFALADGEALWNRKHGAAGLACAGCHGDAAASMKGVAARYPAVRKGLVNLEQQINACRAERQKAPPLPYESKDLLALTAYVARQSRGMPIAIEWDEARRPSLEAGRALFRRRQGQLNLSCAQCHDEHWDRQLAGSPITQAHPTGYPIYRLEWQGLGSLERRLRSCIFGLRAEPYAYGSPELVQLELYLMWRARAMKLETPAVRP

Samples

Sample ID Description Type Environment
1 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
66 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
141 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
142 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
146 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
159 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
160 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
161 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
164 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
165 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
166 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
167 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
168 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
169 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
170 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
171 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.06
Metatranscriptomes 0
Isolates 2.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.47
Nodule 2.57
Rhizoplane 0
Rhizosphere 91.54
Stem 0
Stem Tuber 0
Unclassified 1.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495642_0017372 3300046528 Bacteria 2811
2 JGI25404J52841_10008582 3300003659 Bacteria 2178
3 Ga0070676_10087411 3300005328 Bacteria 1903
4 Ga0068869_100000392 3300005334 Bacteria 23853
5 Ga0070680_100055201 3300005336 Bacteria 3246
6 Ga0068868_100000656 3300005338 Bacteria 23322
7 Ga0070687_100000175 3300005343 Bacteria 22196
8 Ga0070692_10001132 3300005345 Bacteria 9346
9 Ga0070675_100076173 3300005354 Bacteria 2790
10 Ga0070671_100380506 3300005355 Bacteria 1206
11 Ga0070673_100076069 3300005364 Bacteria 2710
12 Ga0070688_100148463 3300005365 Bacteria 1600
13 Ga0070667_100265722 3300005367 Unclassified 1537
14 Ga0070667_100577978 3300005367 Bacteria 1034
15 Ga0070703_10016169 3300005406 Bacteria 2140
16 Ga0070701_10000676 3300005438 Bacteria 12013
17 Ga0070700_100000587 3300005441 Bacteria 18243
18 Ga0068867_100001154 3300005459 Bacteria 18064
19 Ga0070707_100106248 3300005468 Bacteria 2723
20 Ga0070679_100004998 3300005530 Bacteria 12236
21 Ga0070672_100064981 3300005543 Bacteria 2885
22 Ga0070686_100000285 3300005544 Bacteria 34108
23 Ga0070695_100000705 3300005545 Bacteria 17853
24 Ga0070693_100000278 3300005547 Bacteria 24050
25 Ga0070704_100000103 3300005549 Bacteria 29844
26 Ga0068855_100285562 3300005563 Bacteria 1831
27 Ga0068855_100480772 3300005563 Bacteria 1352
28 Ga0068854_100001266 3300005578 Bacteria 15179
29 Ga0068854_100089815 3300005578 Bacteria 2284
30 Ga0068856_100025824 3300005614 Bacteria 5728
31 Ga0070702_100000039 3300005615 Bacteria 35203
32 Ga0068859_100000420 3300005617 Bacteria 42401
33 Ga0068859_100181226 3300005617 Bacteria 2189
34 Ga0068864_100106000 3300005618 Bacteria 2499
35 Ga0068866_10001352 3300005718 Bacteria 10601
36 Ga0068861_100000399 3300005719 Bacteria 25138
37 Ga0068870_10036599 3300005840 Bacteria 2526
38 Ga0068863_100332656 3300005841 Bacteria 1477
39 Ga0068863_100634394 3300005841 Bacteria 1059
40 Ga0068858_100005769 3300005842 Bacteria 12097
41 Ga0068858_100112559 3300005842 Bacteria 2542
42 Ga0068860_100002528 3300005843 Bacteria 19155
43 Ga0068860_100025523 3300005843 Bacteria 5701
44 Ga0068860_100099481 3300005843 Bacteria 2774
45 Ga0068862_100005981 3300005844 Bacteria 10130
46 Ga0068862_100233966 3300005844 Bacteria 1668
47 Ga0081540_1003418 3300005983 Bacteria 12554
48 Ga0081540_1012000 3300005983 Bacteria 5740
49 Ga0081540_1021006 3300005983 Bacteria 3906
50 Ga0081539_10000169 3300005985 Bacteria 153327
51 Ga0097621_100000754 3300006237 Bacteria 22721
52 Ga0068871_100009731 3300006358 Bacteria 6978
53 Ga0075428_100003814 3300006844 Bacteria 16541
54 Ga0075428_100016740 3300006844 Bacteria 8096
55 Ga0075428_100277743 3300006844 Bacteria 1802
56 Ga0075430_100012744 3300006846 Bacteria 7164
57 Ga0075430_100359197 3300006846 Bacteria 1203
58 Ga0075431_100010924 3300006847 Bacteria 9135
59 Ga0075431_100145224 3300006847 Bacteria 2445
60 Ga0075431_100232444 3300006847 Bacteria 1878
61 Ga0075433_10011246 3300006852 Bacteria 7205
62 Ga0075433_10060852 3300006852 Bacteria 3307
63 Ga0075433_10089545 3300006852 Bacteria 2720
64 Ga0075433_10154480 3300006852 Bacteria 2042
65 Ga0075434_100001946 3300006871 Bacteria 17909
66 Ga0075434_100006963 3300006871 Bacteria 10421
67 Ga0075434_100009167 3300006871 Bacteria 9219
68 Ga0075434_100043103 3300006871 Bacteria 4474
69 Ga0075434_100178123 3300006871 Bacteria 2146
70 Ga0075429_100001365 3300006880 Bacteria 19968
71 Ga0075429_100003786 3300006880 Bacteria 12905
72 Ga0075429_100012545 3300006880 Bacteria 7352
73 Ga0075429_100184447 3300006880 Bacteria 1828
74 Ga0068865_100001524 3300006881 Bacteria 13518
75 Ga0075436_100007888 3300006914 Bacteria 7286
76 Ga0075436_100065557 3300006914 Bacteria 2510
77 Ga0075436_100066553 3300006914 Bacteria 2490
78 Ga0097620_100000420 3300006931 Bacteria 42401
79 Ga0097620_100181248 3300006931 Bacteria 2189
80 Ga0075435_100003572 3300007076 Bacteria 10567
81 Ga0075435_100007468 3300007076 Bacteria 7793
82 Ga0075435_100011949 3300007076 Bacteria 6415
83 Ga0075435_100200586 3300007076 Bacteria 1690
84 Ga0075435_100324174 3300007076 Bacteria 1318
85 Ga0111539_10000852 3300009094 Bacteria 39772
86 Ga0111539_10006184 3300009094 Bacteria 15445
87 Ga0111539_10026623 3300009094 Bacteria 7069
88 Ga0105245_10012764 3300009098 Bacteria 7317
89 Ga0114129_10001487 3300009147 Bacteria 31741
90 Ga0114129_10002987 3300009147 Bacteria 23703
91 Ga0114129_10007257 3300009147 Bacteria 15778
92 Ga0114129_10026214 3300009147 Bacteria 8254
93 Ga0114129_10067680 3300009147 Bacteria 4981
94 Ga0114129_10073085 3300009147 Bacteria 4778
95 Ga0105243_10002912 3300009148 Bacteria 14169
96 Ga0105241_10044445 3300009174 Bacteria 3366
97 Ga0105242_10000248 3300009176 Bacteria 42523
98 Ga0105242_10195946 3300009176 Bacteria 1792
99 Ga0105248_10243032 3300009177 Bacteria 2026
100 Ga0105249_10054817 3300009553 Bacteria 3646
101 Ga0105249_10287100 3300009553 Bacteria 1645
102 Ga0105239_10199942 3300010375 Bacteria 2239
103 Ga0157378_10000387 3300013297 Bacteria 43542
104 Ga0157378_10056442 3300013297 Bacteria 3499
105 Ga0157380_10025684 3300014326 Bacteria 4469
106 Ga0157379_10157461 3300014968 Bacteria 2049
107 Ga0157376_10012006 3300014969 Bacteria 6410
108 Ga0157376_10269325 3300014969 Unclassified 1599
109 Ga0213873_10002595 3300021358 Bacteria 3148
110 Ga0213874_10119127 3300021377 Bacteria 895
111 Ga0213876_10003579 3300021384 Bacteria 8838
112 Ga0207642_10005011 3300025899 Bacteria 4300
113 Ga0207688_10057485 3300025901 Bacteria 2187
114 Ga0207680_10055662 3300025903 Bacteria 2385
115 Ga0207645_10002792 3300025907 Bacteria 13590
116 Ga0207643_10064864 3300025908 Bacteria 2091
117 Ga0207684_10326949 3300025910 Bacteria 1321
118 Ga0207660_10043670 3300025917 Bacteria 3150
119 Ga0207662_10000095 3300025918 Bacteria 41923
120 Ga0207652_10167007 3300025921 Bacteria 1973
121 Ga0207652_10208761 3300025921 Bacteria 1758
122 Ga0207646_10078172 3300025922 Bacteria 2957
123 Ga0207659_10159000 3300025926 Bacteria 1772
124 Ga0207687_10003242 3300025927 Bacteria 11024
125 Ga0207686_10001874 3300025934 Bacteria 11669
126 Ga0207686_10299503 3300025934 Bacteria 1194
127 Ga0207709_10001439 3300025935 Bacteria 16614
128 Ga0207670_10002023 3300025936 Bacteria 10646
129 Ga0207704_10000623 3300025938 Bacteria 15673
130 Ga0207704_10043462 3300025938 Bacteria 2654
131 Ga0207691_10020088 3300025940 Bacteria 6318
132 Ga0207689_10000977 3300025942 Bacteria 27402
133 Ga0207689_10003498 3300025942 Bacteria 14353
134 Ga0207667_10054429 3300025949 Bacteria 4209
135 Ga0207712_10013536 3300025961 Bacteria 5231
136 Ga0207640_10019295 3300025981 Bacteria 4026
137 Ga0207658_10548481 3300025986 Bacteria 1034
138 Ga0207677_10017944 3300026023 Bacteria 4236
139 Ga0207703_10012439 3300026035 Bacteria 6635
140 Ga0207703_10018478 3300026035 Bacteria 5444
141 Ga0207708_10000551 3300026075 Bacteria 28958
142 Ga0207702_10064024 3300026078 Bacteria 3146
143 Ga0207641_10348352 3300026088 Bacteria 1411
144 Ga0207641_10678780 3300026088 Bacteria 1013
145 Ga0207648_10000513 3300026089 Bacteria 43298
146 Ga0207648_10005766 3300026089 Bacteria 12405
147 Ga0207648_10282546 3300026089 Bacteria 1484
148 Ga0207675_100001063 3300026118 Bacteria 27254
149 Ga0207698_10218928 3300026142 Bacteria 1719
150 Ga0207428_10005470 3300027907 Bacteria 11844
151 Ga0207428_10011126 3300027907 Bacteria 7987
152 Ga0268265_10009410 3300028380 Bacteria 6598
153 Ga0268265_10139162 3300028380 Bacteria 2030
154 Ga0268264_10005879 3300028381 Bacteria 10384
155 Ga0268264_10502742 3300028381 Bacteria 1182
156 Ga0307515_10031041 3300028794 Bacteria 8934
157 Ga0265339_10023730 3300031249 Bacteria 3543
158 Ga0307509_10249437 3300031507 Bacteria 1560
159 Ga0307516_10001972 3300031730 Bacteria 28094
160 Ga0307516_10259372 3300031730 Bacteria 1429
161 Ga0307406_10029029 3300031901 Bacteria 3346
162 Ga0307406_10612991 3300031901 Bacteria 899
163 Ga0307412_10649529 3300031911 Bacteria 900
164 Ga0373926_0002148 3300035083 Bacteria 6207
165 Ga0373943_0068348 3300035170 Bacteria 1793
166 Ga0373924_0016098 3300035410 Bacteria 2852
167 Ga0373931_0002342 3300035691 Bacteria 8366
168 Ga0373927_0008733 3300035695 Bacteria 6806
169 Ga0373925_0012851 3300037068 Bacteria 6065
170 Ga0436364_0239299 3300037853 Bacteria 850
171 Ga0436365_1236739 3300039437 Bacteria 30341
172 Ga0436360_1260577 3300039438 Bacteria 4751
173 Ga0436363_0334453 3300039450 Bacteria 1204
174 Ga0436363_1408033 3300039450 Bacteria 2835
175 Ga0436362_0081963 3300039453 Bacteria 1337
176 Ga0436362_0652931 3300039453 Bacteria 7115
177 Ga0466959_0033466 3300045049 Bacteria 3801
178 Ga0451576_0018030 3300045051 Bacteria 7745
179 Ga0495603_0036255 3300046455 Bacteria 2961
180 Ga0495580_0002475 3300046472 Bacteria 16114
181 Ga0495580_0190977 3300046472 Bacteria 1412
182 Ga0495582_0036167 3300046473 Bacteria 2716
183 Ga0495594_0005474 3300046499 Bacteria 6528
184 Ga0495594_0092336 3300046499 Bacteria 1697
185 Ga0495630_0066008 3300046517 Bacteria 2720
186 Ga0495642_0016357 3300046528 Bacteria 2891
187 Ga0495665_0062602 3300046531 Bacteria 1964
188 Ga0495586_0009170 3300046535 Bacteria 5265
189 Ga0495647_0001740 3300046681 Bacteria 6749
190 Ga0495658_0013614 3300046683 Bacteria 4143
191 Ga0495669_0050743 3300046684 Bacteria 1861
192 Ga0496121_0017920 3300048924 Bacteria 7184
193 Ga0501033_0027203 3300049570 Bacteria 4301
194 Ga0501037_0169985 3300049573 Bacteria 1550
195 Ga0501038_0590527 3300049574 Bacteria 841
196 Ga0501039_0189993 3300049575 Bacteria 1615
197 Ga0501041_0304857 3300049577 Bacteria 1004
198 Ga0501042_0190033 3300049578 Bacteria 1481
199 Ga0501042_0253641 3300049578 Bacteria 1269
200 Ga0501043_0295316 3300049579 Bacteria 1239
201 Ga0501043_0339607 3300049579 Bacteria 1143
202 Ga0501046_0030631 3300049580 Bacteria 4366
203 Ga0501048_0013379 3300049582 Bacteria 6089
204 Ga0501048_0027950 3300049582 Bacteria 4097
205 Ga0501068_0002216 3300049584 Bacteria 10336
206 Ga0501068_0170575 3300049584 Bacteria 1373
207 Ga0501068_0270222 3300049584 Bacteria 1085
208 Ga0501068_0576853 3300049584 Bacteria 732
209 Ga0501069_0001752 3300049585 Bacteria 10825
210 Ga0501071_0078746 3300049587 Bacteria 2409
211 Ga0501071_0346060 3300049587 Bacteria 1131
212 Ga0501073_0041344 3300049589 Bacteria 3257
213 Ga0501076_0010510 3300049592 Bacteria 6869
214 Ga0501077_0026200 3300049593 Bacteria 3700
215 Ga0501077_0061585 3300049593 Bacteria 2381
216 Ga0501238_008872 3300049671 Bacteria 1327
217 Ga0501079_0023005 3300049741 Bacteria 4786
218 Ga0501079_0085969 3300049741 Bacteria 2434
219 Ga0501079_0111044 3300049741 Bacteria 2130
220 Ga0501079_0202221 3300049741 Bacteria 1552
221 Ga0501081_0007636 3300049743 Bacteria 7015
222 Ga0501081_0457194 3300049743 Bacteria 949
223 Ga0501045_0035677 3300049824 Bacteria 3611
224 Ga0501045_0047545 3300049824 Bacteria 3126
225 Ga0501045_0121209 3300049824 Bacteria 1942
226 Ga0501045_0228628 3300049824 Unclassified 1385
227 nmdc:mga05p37_1935_c1 3300050507 Bacteria 24113
228 nmdc:mga05p37_213_c1 3300050507 Bacteria 58791
229 nmdc:mga05p37_24531_c1 3300050507 Bacteria 7331
230 nmdc:mga05p37_49620_c1 3300050507 Bacteria 5163
231 nmdc:mga09592_1171_c1 3300050508 Bacteria 12926
232 nmdc:mga09592_142665_c1 3300050508 Bacteria 2065
233 nmdc:mga09592_17481_c1 3300050508 Bacteria 5875
234 nmdc:mga09592_1903_c1 3300050508 Bacteria 16783
235 nmdc:mga06r32_1219_c1 3300050510 Bacteria 23164
236 nmdc:mga06r32_191085_c1 3300050510 Bacteria 2035
237 nmdc:mga08y16_10187_c1 3300050511 Bacteria 9872
238 nmdc:mga08y16_275_c1 3300050511 Bacteria 46750
239 nmdc:mga0n895_13013_c1 3300050512 Bacteria 7485
240 nmdc:mga0n895_132534_c1 3300050512 Bacteria 2518
241 nmdc:mga0n895_21177_c1 3300050512 Bacteria 6076
242 nmdc:mga0n895_23787_c1 3300050512 Bacteria 5764
243 nmdc:mga0rr50_12121_c1 3300050513 Bacteria 5556
244 nmdc:mga0rr50_225554_c1 3300050513 Bacteria 1549
245 nmdc:mga0rr50_308225_c1 3300050513 Bacteria 1326
246 nmdc:mga0rr50_3348_c1 3300050513 Bacteria 9209
247 nmdc:mga0rr50_772387_c1 3300050513 Bacteria 820
248 nmdc:mga0rr50_78197_c1 3300050513 Bacteria 2545
249 nmdc:mga08x19_4462_c1 3300050514 Bacteria 8292
250 nmdc:mga08x19_45393_c1 3300050514 Bacteria 2808
251 nmdc:mga08x19_49476_c1 3300050514 Bacteria 2695
252 nmdc:mga0a205_14700_c1 3300050515 Bacteria 7303
253 nmdc:mga0a205_155193_c1 3300050515 Bacteria 2188
254 nmdc:mga0a205_5452_c1 3300050515 Bacteria 11461
255 nmdc:mga0a205_71714_c1 3300050515 Bacteria 3346
256 Ga0500595_000496 3300053119 Bacteria 24015
257 Ga0500642_0042964 3300053130 Bacteria 1962
258 Ga0500622_0074084 3300053156 Bacteria 1716
259 Ga0500637_0056548 3300053178 Bacteria 2241
260 Ga0501082_0016215 3300060353 Bacteria 6414
261 Ga0501082_0116078 3300060353 Bacteria 2319
262 Ga0501082_0563526 3300060353 Bacteria 997
263 Ga0530510_0016035 3300061734 Bacteria 5295
264 Ga0530510_0150947 3300061734 Bacteria 1716
265 2509140458 2508501127 Bacteria 7037543
266 2513892567 2513237141 Bacteria 8496279
267 2842339058 2842333319 Bacteria 8899485
268 2844534778 2844533157 Bacteria 7517899
269 2878789945 2878788777 Bacteria 6567085
270 2885315498 2885312484 Bacteria 6415165
271 2958077700 2958071322 Bacteria 6815895
272 8004637165 8004633249 Bacteria 6723080
273 Ga0495642_0017372
274 JGI25404J52841_10008582
275 Ga0070676_10087411
276 Ga0068869_100000392
277 Ga0070680_100055201
278 Ga0068868_100000656
279 Ga0070687_100000175
280 Ga0070692_10001132
281 Ga0070675_100076173
282 Ga0070671_100380506
283 Ga0070673_100076069
284 Ga0070688_100148463
285 Ga0070667_100265722
286 Ga0070667_100577978
287 Ga0070703_10016169
288 Ga0070701_10000676
289 Ga0070700_100000587
290 Ga0068867_100001154
291 Ga0070707_100106248
292 Ga0070679_100004998
293 Ga0070672_100064981
294 Ga0070686_100000285
295 Ga0070695_100000705
296 Ga0070693_100000278
297 Ga0070704_100000103
298 Ga0068855_100285562
299 Ga0068855_100480772
300 Ga0068854_100001266
301 Ga0068854_100089815
302 Ga0068856_100025824
303 Ga0070702_100000039
304 Ga0068859_100000420
305 Ga0068859_100181226
306 Ga0068864_100106000
307 Ga0068866_10001352
308 Ga0068861_100000399
309 Ga0068870_10036599
310 Ga0068863_100332656
311 Ga0068863_100634394
312 Ga0068858_100005769
313 Ga0068858_100112559
314 Ga0068860_100002528
315 Ga0068860_100025523
316 Ga0068860_100099481
317 Ga0068862_100005981
318 Ga0068862_100233966
319 Ga0081540_1003418
320 Ga0081540_1012000
321 Ga0081540_1021006
322 Ga0081539_10000169
323 Ga0097621_100000754
324 Ga0068871_100009731
325 Ga0075428_100003814
326 Ga0075428_100016740
327 Ga0075428_100277743
328 Ga0075430_100012744
329 Ga0075430_100359197
330 Ga0075431_100010924
331 Ga0075431_100145224
332 Ga0075431_100232444
333 Ga0075433_10011246
334 Ga0075433_10060852
335 Ga0075433_10089545
336 Ga0075433_10154480
337 Ga0075434_100001946
338 Ga0075434_100006963
339 Ga0075434_100009167
340 Ga0075434_100043103
341 Ga0075434_100178123
342 Ga0075429_100001365
343 Ga0075429_100003786
344 Ga0075429_100012545
345 Ga0075429_100184447
346 Ga0068865_100001524
347 Ga0075436_100007888
348 Ga0075436_100065557
349 Ga0075436_100066553
350 Ga0097620_100000420
351 Ga0097620_100181248
352 Ga0075435_100003572
353 Ga0075435_100007468
354 Ga0075435_100011949
355 Ga0075435_100200586
356 Ga0075435_100324174
357 Ga0111539_10000852
358 Ga0111539_10006184
359 Ga0111539_10026623
360 Ga0105245_10012764
361 Ga0114129_10001487
362 Ga0114129_10002987
363 Ga0114129_10007257
364 Ga0114129_10026214
365 Ga0114129_10067680
366 Ga0114129_10073085
367 Ga0105243_10002912
368 Ga0105241_10044445
369 Ga0105242_10000248
370 Ga0105242_10195946
371 Ga0105248_10243032
372 Ga0105249_10054817
373 Ga0105249_10287100
374 Ga0105239_10199942
375 Ga0157378_10000387
376 Ga0157378_10056442
377 Ga0157380_10025684
378 Ga0157379_10157461
379 Ga0157376_10012006
380 Ga0157376_10269325
381 Ga0213873_10002595
382 Ga0213874_10119127
383 Ga0213876_10003579
384 Ga0207642_10005011
385 Ga0207688_10057485
386 Ga0207680_10055662
387 Ga0207645_10002792
388 Ga0207643_10064864
389 Ga0207684_10326949
390 Ga0207660_10043670
391 Ga0207662_10000095
392 Ga0207652_10167007
393 Ga0207652_10208761
394 Ga0207646_10078172
395 Ga0207659_10159000
396 Ga0207687_10003242
397 Ga0207686_10001874
398 Ga0207686_10299503
399 Ga0207709_10001439
400 Ga0207670_10002023
401 Ga0207704_10000623
402 Ga0207704_10043462
403 Ga0207691_10020088
404 Ga0207689_10000977
405 Ga0207689_10003498
406 Ga0207667_10054429
407 Ga0207712_10013536
408 Ga0207640_10019295
409 Ga0207658_10548481
410 Ga0207677_10017944
411 Ga0207703_10012439
412 Ga0207703_10018478
413 Ga0207708_10000551
414 Ga0207702_10064024
415 Ga0207641_10348352
416 Ga0207641_10678780
417 Ga0207648_10000513
418 Ga0207648_10005766
419 Ga0207648_10282546
420 Ga0207675_100001063
421 Ga0207698_10218928
422 Ga0207428_10005470
423 Ga0207428_10011126
424 Ga0268265_10009410
425 Ga0268265_10139162
426 Ga0268264_10005879
427 Ga0268264_10502742
428 Ga0307515_10031041
429 Ga0265339_10023730
430 Ga0307509_10249437
431 Ga0307516_10001972
432 Ga0307516_10259372
433 Ga0307406_10029029
434 Ga0307406_10612991
435 Ga0307412_10649529
436 Ga0373926_0002148
437 Ga0373943_0068348
438 Ga0373924_0016098
439 Ga0373931_0002342
440 Ga0373927_0008733
441 Ga0373925_0012851
442 Ga0436364_0239299
443 Ga0436365_1236739
444 Ga0436360_1260577
445 Ga0436363_0334453
446 Ga0436363_1408033
447 Ga0436362_0081963
448 Ga0436362_0652931
449 Ga0466959_0033466
450 Ga0451576_0018030
451 Ga0495603_0036255
452 Ga0495580_0002475
453 Ga0495580_0190977
454 Ga0495582_0036167
455 Ga0495594_0005474
456 Ga0495594_0092336
457 Ga0495630_0066008
458 Ga0495642_0016357
459 Ga0495665_0062602
460 Ga0495586_0009170
461 Ga0495647_0001740
462 Ga0495658_0013614
463 Ga0495669_0050743
464 Ga0496121_0017920
465 Ga0501033_0027203
466 Ga0501037_0169985
467 Ga0501038_0590527
468 Ga0501039_0189993
469 Ga0501041_0304857
470 Ga0501042_0190033
471 Ga0501042_0253641
472 Ga0501043_0295316
473 Ga0501043_0339607
474 Ga0501046_0030631
475 Ga0501048_0013379
476 Ga0501048_0027950
477 Ga0501068_0002216
478 Ga0501068_0170575
479 Ga0501068_0270222
480 Ga0501068_0576853
481 Ga0501069_0001752
482 Ga0501071_0078746
483 Ga0501071_0346060
484 Ga0501073_0041344
485 Ga0501076_0010510
486 Ga0501077_0026200
487 Ga0501077_0061585
488 Ga0501238_008872
489 Ga0501079_0023005
490 Ga0501079_0085969
491 Ga0501079_0111044
492 Ga0501079_0202221
493 Ga0501081_0007636
494 Ga0501081_0457194
495 Ga0501045_0035677
496 Ga0501045_0047545
497 Ga0501045_0121209
498 Ga0501045_0228628
499 nmdc:mga05p37_1935_c1
500 nmdc:mga05p37_213_c1
501 nmdc:mga05p37_24531_c1
502 nmdc:mga05p37_49620_c1
503 nmdc:mga09592_1171_c1
504 nmdc:mga09592_142665_c1
505 nmdc:mga09592_17481_c1
506 nmdc:mga09592_1903_c1
507 nmdc:mga06r32_1219_c1
508 nmdc:mga06r32_191085_c1
509 nmdc:mga08y16_10187_c1
510 nmdc:mga08y16_275_c1
511 nmdc:mga0n895_13013_c1
512 nmdc:mga0n895_132534_c1
513 nmdc:mga0n895_21177_c1
514 nmdc:mga0n895_23787_c1
515 nmdc:mga0rr50_12121_c1
516 nmdc:mga0rr50_225554_c1
517 nmdc:mga0rr50_308225_c1
518 nmdc:mga0rr50_3348_c1
519 nmdc:mga0rr50_772387_c1
520 nmdc:mga0rr50_78197_c1
521 nmdc:mga08x19_4462_c1
522 nmdc:mga08x19_45393_c1
523 nmdc:mga08x19_49476_c1
524 nmdc:mga0a205_14700_c1
525 nmdc:mga0a205_155193_c1
526 nmdc:mga0a205_5452_c1
527 nmdc:mga0a205_71714_c1
528 Ga0500595_000496
529 Ga0500642_0042964
530 Ga0500622_0074084
531 Ga0500637_0056548
532 Ga0501082_0016215
533 Ga0501082_0116078
534 Ga0501082_0563526
535 Ga0530510_0016035
536 Ga0530510_0150947
537 2509140458
538 2513892567
539 2842339058
540 2844534778
541 2878789945
542 2885315498
543 2958077700
544 8004637165

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21342

SoxA-TsdA_cyt-c

SoxA/TsdA, cytochrome c domain

40

124

0.98

PF21342

SoxA-TsdA_cyt-c

SoxA/TsdA, cytochrome c domain

138

231

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1h31-assembly3.cif.gz_E oxidised soxax complex from rhodovulum sulfidophilum 0.9479 28 258
2c1d-assembly4.cif.gz_G crystal structure of soxxa from p. pantotrophus 0.9214 28 253
3ocd-assembly2.cif.gz_C diheme soxax - c236m mutant 0.8473 49 255
1h31-assembly3.cif.gz_E oxidised soxax complex from rhodovulum sulfidophilum 0.8451 28 258
3oa8-assembly1.cif.gz_E diheme soxax 0.8341 49 255
ID Description Score Start End Superfamily
1h31A02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9574 52 139 1.10.760.10
1h31A02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.947 52 139 1.10.760.10
2c1dG02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9235 52 141 1.10.760.10
2c1dG02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9138 52 141 1.10.760.10
2oz1C01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8947 145 257 1.10.760.10
ID Description Score Start End GO Terms
AF-W9V998-F1-model_v4 Sulfur oxidation protein SoxA 0.972 58 139 GO:0009055
GO:0020037
GO:0046872
AF-A0A845U3B8-F1-model_v4 Cytochrome c domain-containing protein 0.9702 83 145 GO:0009055
GO:0020037
GO:0046872
AF-A0A7W4VQ28-F1-model_v4 L-cysteine S-thiosulfotransferase subunit SoxA (EC 2.8.5.2) (Protein SoxA) (SoxAX cytochrome complex subunit A) (Sulfur oxidizing protein A) (Thiosulfate-oxidizing multienzyme system protein SoxA) 0.9662 52 258 GO:0009055
GO:0016669
GO:0016740
GO:0019417
GO:0020037
GO:0042597
GO:0046872
GO:0070069
AF-A0A7W4VQ28-F1-model_v4 L-cysteine S-thiosulfotransferase subunit SoxA (EC 2.8.5.2) (Protein SoxA) (SoxAX cytochrome complex subunit A) (Sulfur oxidizing protein A) (Thiosulfate-oxidizing multienzyme system protein SoxA) 0.9616 52 258 GO:0009055
GO:0016669
GO:0016740
GO:0019417
GO:0020037
GO:0042597
GO:0046872
GO:0070069
AF-A0A437QYX0-F1-model_v4 L-cysteine S-thiosulfotransferase subunit SoxA (EC 2.8.5.2) (Protein SoxA) (SoxAX cytochrome complex subunit A) (Sulfur oxidizing protein A) (Thiosulfate-oxidizing multienzyme system protein SoxA) 0.9609 28 255 GO:0009055
GO:0016669
GO:0016740
GO:0019417
GO:0020037
GO:0042597
GO:0046872
GO:0070069

Map