F378629

General Info

Members Datasets Scaffolds Average Seq Length
272 175 544 252

Family's Representative Sequence

Representative Sequence 3300048916|Ga0496113_0343071|Ga0496113_0343071_69_887
Length 272
Sequence MRQIVQPDARDFPVKHLMSKKRLDVLLVERGLAESRTQAQALVLAGLVPGHSKAGEQLDEDAELSVTETARYVSRGGEKLAHALDATGVDPMGLDCLDVGASTGGFTDVLLQRGAARVIALDVGYGQLHPRLRDDARVSVLERTNARELEELPFAPKLVVCDVSFISVRTALPPALRLAAEGWQALVLVKPQFEAGRDEVGKGGVVKSNETRARVLREVAEAALEWGAETVAVVDSGLPGPKGNREFFLHLVNAPGATLPAELDRWIDAAVG

Samples

Sample ID Description Type Environment
1 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
86 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
87 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
88 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
91 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
106 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
107 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
108 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
109 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
110 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
111 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
120 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
123 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
127 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
128 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
138 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 15.44
Rhizosphere 83.82
Stem 0
Stem Tuber 0
Unclassified 1.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496113_0343071 3300048916 Bacteria 1198
2 JGI24751J29686_10040150 3300002459 Unclassified 969
3 Ga0070683_100002163 3300005329 Bacteria 15544
4 Ga0070683_100068175 3300005329 Bacteria 3314
5 Ga0070670_100016766 3300005331 Bacteria 6287
6 Ga0068868_100228668 3300005338 Bacteria 1560
7 Ga0070668_100028591 3300005347 Bacteria 4232
8 Ga0070674_100206884 3300005356 Bacteria 1519
9 Ga0070673_100067066 3300005364 Bacteria 2868
10 Ga0070673_100275196 3300005364 Bacteria 1475
11 Ga0070688_100024519 3300005365 Bacteria 3560
12 Ga0070714_100002387 3300005435 Bacteria 13815
13 Ga0070705_100142754 3300005440 Bacteria 1578
14 Ga0070663_100143541 3300005455 Bacteria 1825
15 Ga0070662_100035095 3300005457 Bacteria 3540
16 Ga0068867_100099994 3300005459 Bacteria 2214
17 Ga0070685_10288982 3300005466 Bacteria 1100
18 Ga0070679_100108420 3300005530 Bacteria 2763
19 Ga0070684_100000304 3300005535 Bacteria 34144
20 Ga0070684_100027082 3300005535 Bacteria 4834
21 Ga0070684_100084700 3300005535 Bacteria 2810
22 Ga0070684_100567327 3300005535 Bacteria 1054
23 Ga0070693_100015998 3300005547 Bacteria 3875
24 Ga0070665_100221646 3300005548 Bacteria 1892
25 Ga0068855_100022026 3300005563 Bacteria 7640
26 Ga0068855_100050562 3300005563 Bacteria 4897
27 Ga0070664_100091271 3300005564 Bacteria 2637
28 Ga0068857_100251936 3300005577 Bacteria 1619
29 Ga0068856_100035622 3300005614 Bacteria 4878
30 Ga0070702_100141061 3300005615 Unclassified 1535
31 Ga0068859_100550707 3300005617 Bacteria 1248
32 Ga0068864_100063042 3300005618 Bacteria 3212
33 Ga0068864_100370481 3300005618 Bacteria 1355
34 Ga0068861_100005615 3300005719 Bacteria 8503
35 Ga0068861_100176235 3300005719 Bacteria 1776
36 Ga0068870_10109907 3300005840 Bacteria 1572
37 Ga0068858_100724611 3300005842 Bacteria 968
38 Ga0081455_10000621 3300005937 Bacteria 46024
39 Ga0081455_10020385 3300005937 Bacteria 6243
40 Ga0081455_10029571 3300005937 Bacteria 4994
41 Ga0081455_10034670 3300005937 Bacteria 4519
42 Ga0081455_10051796 3300005937 Bacteria 3519
43 Ga0081538_10012189 3300005981 Bacteria 6909
44 Ga0081538_10035948 3300005981 Bacteria 3243
45 Ga0070717_10297593 3300006028 Bacteria 1434
46 Ga0075364_10395998 3300006051 Bacteria 942
47 Ga0075428_100170124 3300006844 Bacteria 2362
48 Ga0097620_100550758 3300006931 Bacteria 1248
49 Ga0111539_10001928 3300009094 Bacteria 27646
50 Ga0111539_10245868 3300009094 Bacteria 2083
51 Ga0105245_10011616 3300009098 Bacteria 7669
52 Ga0105245_10080485 3300009098 Bacteria 2976
53 Ga0105245_10215654 3300009098 Bacteria 1849
54 Ga0105245_10234597 3300009098 Bacteria 1776
55 Ga0114129_10045779 3300009147 Bacteria 6149
56 Ga0114129_10092995 3300009147 Bacteria 4178
57 Ga0114129_11138411 3300009147 Bacteria 975
58 Ga0105243_10072359 3300009148 Bacteria 2791
59 Ga0105243_10085459 3300009148 Bacteria 2586
60 Ga0105243_10094173 3300009148 Bacteria 2473
61 Ga0105242_10051092 3300009176 Bacteria 3368
62 Ga0105242_10173906 3300009176 Bacteria 1894
63 Ga0105242_10193604 3300009176 Bacteria 1802
64 Ga0105242_10507266 3300009176 Bacteria 1148
65 Ga0105242_10782060 3300009176 Bacteria 943
66 Ga0105248_10076621 3300009177 Bacteria 3759
67 Ga0105249_10009763 3300009553 Bacteria 8408
68 Ga0105239_10138049 3300010375 Bacteria 2715
69 Ga0105239_10600876 3300010375 Bacteria 1255
70 Ga0105246_10080421 3300011119 Bacteria 2320
71 Ga0105246_10765562 3300011119 Bacteria 853
72 Ga0157342_1002181 3300012507 Bacteria 1558
73 Ga0157370_10040321 3300013104 Bacteria 4508
74 Ga0157374_10353261 3300013296 Bacteria 1461
75 Ga0157378_10668662 3300013297 Bacteria 1056
76 Ga0163162_10021256 3300013306 Bacteria 6387
77 Ga0157375_10111134 3300013308 Bacteria 2839
78 Ga0163163_10109434 3300014325 Bacteria 2790
79 Ga0157379_10586847 3300014968 Bacteria 1039
80 Ga0157376_10690884 3300014969 Unclassified 1024
81 Ga0163161_10016789 3300017792 Bacteria 5118
82 Ga0213871_10008891 3300021441 Bacteria 2231
83 Ga0207688_10008874 3300025901 Bacteria 5470
84 Ga0207688_10030001 3300025901 Bacteria 2997
85 Ga0207688_10172414 3300025901 Unclassified 1287
86 Ga0207645_10115956 3300025907 Bacteria 1737
87 Ga0207643_10025651 3300025908 Bacteria 3259
88 Ga0207654_10058049 3300025911 Bacteria 2251
89 Ga0207693_10132684 3300025915 Bacteria 1958
90 Ga0207657_10049692 3300025919 Bacteria 3652
91 Ga0207652_10033463 3300025921 Bacteria 4329
92 Ga0207646_10568459 3300025922 Bacteria 1019
93 Ga0207650_10102599 3300025925 Bacteria 2204
94 Ga0207659_10154608 3300025926 Bacteria 1794
95 Ga0207687_10050822 3300025927 Bacteria 2887
96 Ga0207687_10063817 3300025927 Bacteria 2609
97 Ga0207687_10127480 3300025927 Bacteria 1913
98 Ga0207687_10324644 3300025927 Bacteria 1247
99 Ga0207700_10409077 3300025928 Bacteria 1190
100 Ga0207664_10021630 3300025929 Bacteria 4787
101 Ga0207686_10019360 3300025934 Bacteria 3870
102 Ga0207686_10118557 3300025934 Bacteria 1798
103 Ga0207709_10052900 3300025935 Bacteria 2496
104 Ga0207709_10210453 3300025935 Bacteria 1395
105 Ga0207669_10092428 3300025937 Bacteria 1974
106 Ga0207704_10035096 3300025938 Bacteria 2869
107 Ga0207691_10381858 3300025940 Bacteria 1203
108 Ga0207679_10043747 3300025945 Bacteria 3227
109 Ga0207667_10062607 3300025949 Bacteria 3890
110 Ga0207668_10061565 3300025972 Bacteria 2640
111 Ga0207677_10229936 3300026023 Bacteria 1493
112 Ga0207708_10324060 3300026075 Bacteria 1258
113 Ga0207702_10007525 3300026078 Bacteria 9286
114 Ga0207702_10008080 3300026078 Bacteria 8900
115 Ga0207648_10064531 3300026089 Bacteria 3192
116 Ga0207648_10358124 3300026089 Bacteria 1316
117 Ga0207674_10022333 3300026116 Bacteria 6794
118 Ga0207675_100001474 3300026118 Bacteria 23625
119 Ga0207675_100383120 3300026118 Bacteria 1383
120 Ga0207675_100476732 3300026118 Bacteria 1240
121 Ga0207683_10024028 3300026121 Bacteria 5245
122 Ga0207698_10487005 3300026142 Bacteria 1197
123 Ga0265319_1000592 3300028563 Bacteria 24262
124 Ga0265334_10013003 3300028573 Bacteria 3491
125 Ga0265318_10053089 3300028577 Bacteria 1520
126 Ga0265336_10017744 3300028666 Bacteria 2315
127 Ga0265338_10007029 3300028800 Bacteria 14125
128 Ga0265338_10209194 3300028800 Bacteria 1465
129 Ga0265320_10049073 3300031240 Bacteria 2056
130 Ga0265320_10071284 3300031240 Bacteria 1637
131 Ga0265329_10045046 3300031242 Bacteria 1410
132 Ga0265327_10013419 3300031251 Bacteria 5440
133 Ga0265316_10012119 3300031344 Bacteria 7742
134 Ga0265314_10093526 3300031711 Bacteria 1951
135 Ga0265342_10015346 3300031712 Bacteria 5042
136 Ga0307416_100033647 3300032002 Bacteria 3889
137 Ga0307416_100135846 3300032002 Bacteria 2224
138 Ga0373935_0061571 3300035692 Bacteria 2403
139 Ga0373947_0011523 3300035725 Bacteria 5072
140 Ga0395899_0023135 3300037312 Bacteria 4710
141 Ga0395899_0279025 3300037312 Bacteria 1137
142 Ga0395900_0011460 3300037418 Bacteria 9075
143 Ga0395900_0104775 3300037418 Bacteria 2906
144 Ga0395900_0133397 3300037418 Bacteria 2544
145 Ga0395900_0151868 3300037418 Bacteria 2366
146 Ga0395900_0208551 3300037418 Bacteria 1974
147 Ga0395900_0326450 3300037418 Bacteria 1513
148 Ga0395898_0011934 3300037466 Bacteria 8999
149 Ga0395898_0086292 3300037466 Bacteria 3025
150 Ga0395905_0077051 3300037471 Bacteria 3124
151 Ga0395905_0319457 3300037471 Bacteria 1442
152 Ga0395901_0026003 3300038443 Bacteria 6010
153 Ga0395901_0142140 3300038443 Bacteria 2522
154 Ga0395901_0150629 3300038443 Bacteria 2444
155 Ga0395901_0236870 3300038443 Bacteria 1904
156 Ga0395901_0294162 3300038443 Bacteria 1684
157 Ga0395901_0686084 3300038443 Bacteria 1023
158 Ga0436360_0108219 3300039438 Bacteria 7062
159 Ga0439453_0020674 3300041408 Bacteria 1181
160 Ga0451853_3008991 3300041512 Bacteria 4317
161 Ga0439454_000789 3300042011 Bacteria 2742
162 Ga0439456_051044 3300042013 Bacteria 904
163 Ga0439459_0082406 3300042438 Bacteria 761
164 Ga0439440_0025796 3300042993 Bacteria 1356
165 Ga0466965_0043470 3300044683 Bacteria 2218
166 Ga0466966_0007617 3300044684 Bacteria 7174
167 Ga0466961_0006724 3300044693 Bacteria 7315
168 Ga0466961_0020460 3300044693 Bacteria 4258
169 Ga0466963_0015996 3300044694 Bacteria 4657
170 Ga0466963_0017731 3300044694 Bacteria 4440
171 Ga0466957_0019000 3300044842 Bacteria 4040
172 Ga0466959_0003002 3300045049 Bacteria 10898
173 Ga0466959_0026674 3300045049 Bacteria 4282
174 Ga0466958_0015037 3300045836 Bacteria 4427
175 Ga0466958_0060415 3300045836 Bacteria 2307
176 Ga0466967_0092335 3300045976 Bacteria 2752
177 Ga0495590_0065007 3300046457 Bacteria 1277
178 Ga0495591_063230 3300046458 Bacteria 978
179 Ga0495641_0026683 3300046461 Bacteria 2816
180 Ga0495641_0138145 3300046461 Bacteria 1088
181 Ga0495605_0063827 3300046474 Bacteria 1756
182 Ga0495639_0109691 3300046475 Bacteria 1309
183 Ga0495639_0135867 3300046475 Bacteria 1180
184 Ga0495662_0182853 3300046476 Bacteria 1033
185 Ga0495664_0233746 3300046477 Bacteria 1112
186 Ga0495584_0168908 3300046491 Bacteria 1112
187 Ga0495644_0153824 3300046523 Bacteria 881
188 Ga0495663_0054736 3300046525 Bacteria 1243
189 Ga0495587_0108365 3300046536 Bacteria 1597
190 Ga0495621_0055624 3300046539 Bacteria 1425
191 Ga0495656_0024318 3300046615 Bacteria 2391
192 Ga0495656_0050344 3300046615 Bacteria 1778
193 Ga0495656_0071401 3300046615 Bacteria 1543
194 Ga0495635_0115107 3300046663 Bacteria 1836
195 Ga0495659_0163454 3300046664 Bacteria 900
196 Ga0495658_0032831 3300046683 Bacteria 2837
197 Ga0495669_0076090 3300046684 Bacteria 1536
198 Ga0495613_0131089 3300046689 Bacteria 1795
199 Ga0495589_0021982 3300046794 Bacteria 3259
200 Ga0495660_0073563 3300046810 Bacteria 1807
201 Ga0495660_0146507 3300046810 Bacteria 1170
202 Ga0495581_0016379 3300047315 Bacteria 4310
203 Ga0495674_0485183 3300047319 Bacteria 990
204 Ga0495676_0143791 3300047321 Bacteria 1706
205 Ga0495676_0213870 3300047321 Bacteria 1332
206 Ga0495677_0090448 3300047445 Bacteria 1153
207 Ga0496100_0228379 3300048903 Bacteria 1368
208 Ga0496100_0508626 3300048903 Bacteria 929
209 Ga0496101_0015291 3300048904 Bacteria 5168
210 Ga0496101_0019694 3300048904 Bacteria 4612
211 Ga0496101_0121123 3300048904 Bacteria 1978
212 Ga0496101_0144597 3300048904 Bacteria 1815
213 Ga0496101_0200507 3300048904 Bacteria 1543
214 Ga0496102_0037120 3300048905 Bacteria 4394
215 Ga0496102_0120330 3300048905 Bacteria 2452
216 Ga0496103_0050965 3300048906 Bacteria 2561
217 Ga0496103_0311483 3300048906 Bacteria 1013
218 Ga0496104_0000699 3300048907 Bacteria 28859
219 Ga0496104_0024307 3300048907 Bacteria 5573
220 Ga0496104_0132284 3300048907 Bacteria 2396
221 Ga0496104_0439283 3300048907 Bacteria 1217
222 Ga0496105_0000148 3300048908 Bacteria 46239
223 Ga0496105_0113525 3300048908 Bacteria 2235
224 Ga0496106_0149809 3300048909 Bacteria 1840
225 Ga0496107_0129354 3300048910 Bacteria 1864
226 Ga0496108_0000473 3300048911 Bacteria 32225
227 Ga0496108_0004768 3300048911 Bacteria 10934
228 Ga0496108_0238882 3300048911 Bacteria 1580
229 Ga0496109_0010307 3300048912 Bacteria 7981
230 Ga0496109_0015028 3300048912 Bacteria 6737
231 Ga0496109_0069408 3300048912 Bacteria 3232
232 Ga0496110_0000707 3300048913 Bacteria 23061
233 Ga0496110_0001277 3300048913 Bacteria 18022
234 Ga0496110_0073443 3300048913 Bacteria 3035
235 Ga0496110_0234037 3300048913 Bacteria 1671
236 Ga0496110_0416591 3300048913 Bacteria 1225
237 Ga0496111_0000334 3300048914 Bacteria 23468
238 Ga0496111_0003548 3300048914 Bacteria 9659
239 Ga0496111_0208122 3300048914 Bacteria 1453
240 Ga0496112_0005149 3300048915 Bacteria 11244
241 Ga0496112_0314612 3300048915 Bacteria 1510
242 Ga0496112_0421947 3300048915 Bacteria 1273
243 Ga0496114_0002235 3300048917 Bacteria 14749
244 Ga0496114_0036532 3300048917 Bacteria 4061
245 Ga0496114_0166546 3300048917 Bacteria 1919
246 Ga0496114_0279970 3300048917 Bacteria 1470
247 Ga0496115_0161048 3300048918 Bacteria 1854
248 Ga0501036_0342175 3300049572 Bacteria 1249
249 Ga0501041_0022302 3300049577 Bacteria 3791
250 Ga0501046_0031630 3300049580 Bacteria 4288
251 Ga0501067_0238214 3300049583 Bacteria 1013
252 Ga0501072_0344344 3300049588 Bacteria 1184
253 Ga0501076_0372937 3300049592 Bacteria 1173
254 Ga0501076_0474063 3300049592 Bacteria 1031
255 Ga0501077_0088020 3300049593 Bacteria 1968
256 Ga0501079_0022845 3300049741 Bacteria 4801
257 Ga0501079_0153675 3300049741 Bacteria 1794
258 Ga0501081_0034631 3300049743 Bacteria 3436
259 nmdc:mga05p37_543301_c1 3300050507 Bacteria 1324
260 nmdc:mga05p37_66849_c1 3300050507 Bacteria 4421
261 nmdc:mga0qj67_404435_c1 3300050509 Bacteria 1102
262 nmdc:mga06r32_48721_c1 3300050510 Bacteria 4051
263 nmdc:mga0n895_432777_c1 3300050512 Bacteria 1329
264 nmdc:mga0n895_637895_c1 3300050512 Bacteria 1065
265 nmdc:mga0rr50_222384_c1 3300050513 Bacteria 1559
266 nmdc:mga0rr50_717933_c1 3300050513 Bacteria 853
267 nmdc:mga0a205_443323_c1 3300050515 Bacteria 1159
268 Ga0501084_0051934 3300054114 Bacteria 3431
269 Ga0501084_0071674 3300054114 Bacteria 2902
270 Ga0501082_0009118 3300060353 Bacteria 8554
271 Ga0501082_0427411 3300060353 Bacteria 1157
272 Ga0466962_0005550 3300061719 Bacteria 6055
273 Ga0496113_0343071
274 JGI24751J29686_10040150
275 Ga0070683_100002163
276 Ga0070683_100068175
277 Ga0070670_100016766
278 Ga0068868_100228668
279 Ga0070668_100028591
280 Ga0070674_100206884
281 Ga0070673_100067066
282 Ga0070673_100275196
283 Ga0070688_100024519
284 Ga0070714_100002387
285 Ga0070705_100142754
286 Ga0070663_100143541
287 Ga0070662_100035095
288 Ga0068867_100099994
289 Ga0070685_10288982
290 Ga0070679_100108420
291 Ga0070684_100000304
292 Ga0070684_100027082
293 Ga0070684_100084700
294 Ga0070684_100567327
295 Ga0070693_100015998
296 Ga0070665_100221646
297 Ga0068855_100022026
298 Ga0068855_100050562
299 Ga0070664_100091271
300 Ga0068857_100251936
301 Ga0068856_100035622
302 Ga0070702_100141061
303 Ga0068859_100550707
304 Ga0068864_100063042
305 Ga0068864_100370481
306 Ga0068861_100005615
307 Ga0068861_100176235
308 Ga0068870_10109907
309 Ga0068858_100724611
310 Ga0081455_10000621
311 Ga0081455_10020385
312 Ga0081455_10029571
313 Ga0081455_10034670
314 Ga0081455_10051796
315 Ga0081538_10012189
316 Ga0081538_10035948
317 Ga0070717_10297593
318 Ga0075364_10395998
319 Ga0075428_100170124
320 Ga0097620_100550758
321 Ga0111539_10001928
322 Ga0111539_10245868
323 Ga0105245_10011616
324 Ga0105245_10080485
325 Ga0105245_10215654
326 Ga0105245_10234597
327 Ga0114129_10045779
328 Ga0114129_10092995
329 Ga0114129_11138411
330 Ga0105243_10072359
331 Ga0105243_10085459
332 Ga0105243_10094173
333 Ga0105242_10051092
334 Ga0105242_10173906
335 Ga0105242_10193604
336 Ga0105242_10507266
337 Ga0105242_10782060
338 Ga0105248_10076621
339 Ga0105249_10009763
340 Ga0105239_10138049
341 Ga0105239_10600876
342 Ga0105246_10080421
343 Ga0105246_10765562
344 Ga0157342_1002181
345 Ga0157370_10040321
346 Ga0157374_10353261
347 Ga0157378_10668662
348 Ga0163162_10021256
349 Ga0157375_10111134
350 Ga0163163_10109434
351 Ga0157379_10586847
352 Ga0157376_10690884
353 Ga0163161_10016789
354 Ga0213871_10008891
355 Ga0207688_10008874
356 Ga0207688_10030001
357 Ga0207688_10172414
358 Ga0207645_10115956
359 Ga0207643_10025651
360 Ga0207654_10058049
361 Ga0207693_10132684
362 Ga0207657_10049692
363 Ga0207652_10033463
364 Ga0207646_10568459
365 Ga0207650_10102599
366 Ga0207659_10154608
367 Ga0207687_10050822
368 Ga0207687_10063817
369 Ga0207687_10127480
370 Ga0207687_10324644
371 Ga0207700_10409077
372 Ga0207664_10021630
373 Ga0207686_10019360
374 Ga0207686_10118557
375 Ga0207709_10052900
376 Ga0207709_10210453
377 Ga0207669_10092428
378 Ga0207704_10035096
379 Ga0207691_10381858
380 Ga0207679_10043747
381 Ga0207667_10062607
382 Ga0207668_10061565
383 Ga0207677_10229936
384 Ga0207708_10324060
385 Ga0207702_10007525
386 Ga0207702_10008080
387 Ga0207648_10064531
388 Ga0207648_10358124
389 Ga0207674_10022333
390 Ga0207675_100001474
391 Ga0207675_100383120
392 Ga0207675_100476732
393 Ga0207683_10024028
394 Ga0207698_10487005
395 Ga0265319_1000592
396 Ga0265334_10013003
397 Ga0265318_10053089
398 Ga0265336_10017744
399 Ga0265338_10007029
400 Ga0265338_10209194
401 Ga0265320_10049073
402 Ga0265320_10071284
403 Ga0265329_10045046
404 Ga0265327_10013419
405 Ga0265316_10012119
406 Ga0265314_10093526
407 Ga0265342_10015346
408 Ga0307416_100033647
409 Ga0307416_100135846
410 Ga0373935_0061571
411 Ga0373947_0011523
412 Ga0395899_0023135
413 Ga0395899_0279025
414 Ga0395900_0011460
415 Ga0395900_0104775
416 Ga0395900_0133397
417 Ga0395900_0151868
418 Ga0395900_0208551
419 Ga0395900_0326450
420 Ga0395898_0011934
421 Ga0395898_0086292
422 Ga0395905_0077051
423 Ga0395905_0319457
424 Ga0395901_0026003
425 Ga0395901_0142140
426 Ga0395901_0150629
427 Ga0395901_0236870
428 Ga0395901_0294162
429 Ga0395901_0686084
430 Ga0436360_0108219
431 Ga0439453_0020674
432 Ga0451853_3008991
433 Ga0439454_000789
434 Ga0439456_051044
435 Ga0439459_0082406
436 Ga0439440_0025796
437 Ga0466965_0043470
438 Ga0466966_0007617
439 Ga0466961_0006724
440 Ga0466961_0020460
441 Ga0466963_0015996
442 Ga0466963_0017731
443 Ga0466957_0019000
444 Ga0466959_0003002
445 Ga0466959_0026674
446 Ga0466958_0015037
447 Ga0466958_0060415
448 Ga0466967_0092335
449 Ga0495590_0065007
450 Ga0495591_063230
451 Ga0495641_0026683
452 Ga0495641_0138145
453 Ga0495605_0063827
454 Ga0495639_0109691
455 Ga0495639_0135867
456 Ga0495662_0182853
457 Ga0495664_0233746
458 Ga0495584_0168908
459 Ga0495644_0153824
460 Ga0495663_0054736
461 Ga0495587_0108365
462 Ga0495621_0055624
463 Ga0495656_0024318
464 Ga0495656_0050344
465 Ga0495656_0071401
466 Ga0495635_0115107
467 Ga0495659_0163454
468 Ga0495658_0032831
469 Ga0495669_0076090
470 Ga0495613_0131089
471 Ga0495589_0021982
472 Ga0495660_0073563
473 Ga0495660_0146507
474 Ga0495581_0016379
475 Ga0495674_0485183
476 Ga0495676_0143791
477 Ga0495676_0213870
478 Ga0495677_0090448
479 Ga0496100_0228379
480 Ga0496100_0508626
481 Ga0496101_0015291
482 Ga0496101_0019694
483 Ga0496101_0121123
484 Ga0496101_0144597
485 Ga0496101_0200507
486 Ga0496102_0037120
487 Ga0496102_0120330
488 Ga0496103_0050965
489 Ga0496103_0311483
490 Ga0496104_0000699
491 Ga0496104_0024307
492 Ga0496104_0132284
493 Ga0496104_0439283
494 Ga0496105_0000148
495 Ga0496105_0113525
496 Ga0496106_0149809
497 Ga0496107_0129354
498 Ga0496108_0000473
499 Ga0496108_0004768
500 Ga0496108_0238882
501 Ga0496109_0010307
502 Ga0496109_0015028
503 Ga0496109_0069408
504 Ga0496110_0000707
505 Ga0496110_0001277
506 Ga0496110_0073443
507 Ga0496110_0234037
508 Ga0496110_0416591
509 Ga0496111_0000334
510 Ga0496111_0003548
511 Ga0496111_0208122
512 Ga0496112_0005149
513 Ga0496112_0314612
514 Ga0496112_0421947
515 Ga0496114_0002235
516 Ga0496114_0036532
517 Ga0496114_0166546
518 Ga0496114_0279970
519 Ga0496115_0161048
520 Ga0501036_0342175
521 Ga0501041_0022302
522 Ga0501046_0031630
523 Ga0501067_0238214
524 Ga0501072_0344344
525 Ga0501076_0372937
526 Ga0501076_0474063
527 Ga0501077_0088020
528 Ga0501079_0022845
529 Ga0501079_0153675
530 Ga0501081_0034631
531 nmdc:mga05p37_543301_c1
532 nmdc:mga05p37_66849_c1
533 nmdc:mga0qj67_404435_c1
534 nmdc:mga06r32_48721_c1
535 nmdc:mga0n895_432777_c1
536 nmdc:mga0n895_637895_c1
537 nmdc:mga0rr50_222384_c1
538 nmdc:mga0rr50_717933_c1
539 nmdc:mga0a205_443323_c1
540 Ga0501084_0051934
541 Ga0501084_0071674
542 Ga0501082_0009118
543 Ga0501082_0427411
544 Ga0466962_0005550

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

21

48

0.97

PF01728

FtsJ

FtsJ-like methyltransferase

72

253

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cqj-assembly1.cif.gz_A solution structure of the s4 domain of u3 small nucleolar ribonucleoprotein protein imp3 homolog 0.9526 1 41
5eov-assembly1.cif.gz_A c-terminal domain of the 16s/23s rrna (cytidine-2'-o)-methyltransferase tlya. 0.9346 56 247
3opn-assembly1.cif.gz_A the crystal structure of a putative hemolysin from lactococcus lactis 0.8958 51 244
5eov-assembly1.cif.gz_A c-terminal domain of the 16s/23s rrna (cytidine-2'-o)-methyltransferase tlya. 0.8733 56 247
3opn-assembly1.cif.gz_A the crystal structure of a putative hemolysin from lactococcus lactis 0.8339 51 244
ID Description Score Start End Superfamily
af_C0P590_106_292_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9698 62 229 3.40.50.150
af_P0AAS7_1_70_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9567 2 41 3.10.290.10
5eovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9346 56 247 3.40.50.150
3opnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8842 51 244 3.40.50.150
5eovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8733 56 247 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7W0ULN3-F1-model_v4 TlyA family RNA methyltransferase 0.9744 78 248 GO:0008168
GO:0032259
AF-A0A0W8G7W9-F1-model_v4 Rna binding methyltransferase ftsj like 0.9735 65 229 GO:0008168
GO:0032259
AF-A0A7V9P302-F1-model_v4 TlyA family RNA methyltransferase 0.9668 1 231 GO:0003723
GO:0008168
GO:0032259
AF-A0A7V1DJQ4-F1-model_v4 deleted 0.9645 51 232
AF-A0A3M0ZJ26-F1-model_v4 TlyA family RNA methyltransferase 0.9594 60 230 GO:0008168
GO:0032259

Map