F378693

General Info

Members Datasets Scaffolds Average Seq Length
272 193 544 249

Family's Representative Sequence

Representative Sequence 3300053094|Ga0500566_0163162|Ga0500566_0163162_261_1013
Length 250
Sequence MKVLVAVKRVVDANVKVRVKSDGTGVETQNVKMSMNPFCEIAVEEAVRLKEAGKVTEIIAVSLGGAQCAETIRTALAMGADRGIHVQTDVELQPLAVAKLLKAVVDKEQPGLAILGKQAIDDDANQTGQMLSALLGWPQATYASKLVLNGDNTANVTREVDGGLETIQVKTPFVMTTDLRLNEPRYASLPNIMKAKKKPIEALTPEALGVDPTPRLKTLKVVEPSKRSAGVKVKSAAELVEKLRNEAKVI

Samples

Sample ID Description Type Environment
1 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
44 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
80 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
82 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
83 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
84 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
100 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
101 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
102 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
103 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
104 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
105 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
106 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
113 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
121 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
124 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
135 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
139 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
140 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
148 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
157 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
158 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 2519103095 Burkholderia sp. KJ006 Isolate Nodule
185 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
186 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
187 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
188 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
189 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
190 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
191 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
192 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
193 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.01
Metatranscriptomes 3.31
Isolates 3.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.84
Nodule 1.84
Rhizoplane 1.47
Rhizosphere 86.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500566_0163162 3300053094 Bacteria 1159
2 Ga0058862_12740279 3300004803 Bacteria 1483
3 Ga0070676_10409812 3300005328 Bacteria 945
4 Ga0068868_100126958 3300005338 Bacteria 2085
5 Ga0070660_100147137 3300005339 Bacteria 1893
6 Ga0070661_100075004 3300005344 Bacteria 2492
7 Ga0070661_100082843 3300005344 Bacteria 2369
8 Ga0070674_100005259 3300005356 Bacteria 7453
9 Ga0070673_100046469 3300005364 Bacteria 3372
10 Ga0070659_100065339 3300005366 Bacteria 2881
11 Ga0070709_10007706 3300005434 Bacteria 5910
12 Ga0070714_100110509 3300005435 Bacteria 2433
13 Ga0070713_100006820 3300005436 Bacteria 7957
14 Ga0070711_100541508 3300005439 Bacteria 965
15 Ga0070684_100569570 3300005535 Bacteria 1052
16 Ga0068853_100001085 3300005539 Bacteria 19247
17 Ga0068853_100015377 3300005539 Bacteria 6287
18 Ga0068853_100345771 3300005539 Bacteria 1382
19 Ga0070696_100280189 3300005546 Bacteria 1271
20 Ga0070693_100190764 3300005547 Bacteria 1325
21 Ga0070665_100069728 3300005548 Bacteria 3524
22 Ga0070664_100151179 3300005564 Bacteria 2050
23 Ga0068857_100076221 3300005577 Bacteria 2991
24 Ga0068857_100566760 3300005577 Bacteria 1071
25 Ga0068854_100118790 3300005578 Bacteria 2004
26 Ga0068856_100530328 3300005614 Bacteria 1198
27 Ga0068852_100098218 3300005616 Bacteria 2636
28 Ga0068852_100424798 3300005616 Bacteria 1311
29 Ga0068861_100018265 3300005719 Bacteria 4994
30 Ga0081455_10161632 3300005937 Bacteria 1716
31 Ga0081538_10019739 3300005981 Bacteria 4991
32 Ga0081538_10109702 3300005981 Bacteria 1358
33 Ga0070717_10144995 3300006028 Bacteria 2050
34 Ga0070712_100170182 3300006175 Bacteria 1690
35 Ga0068865_100712114 3300006881 Bacteria 859
36 Ga0105244_10002538 3300009036 Bacteria 13711
37 Ga0105240_10305899 3300009093 Bacteria 1817
38 Ga0105240_10527994 3300009093 Bacteria 1309
39 Ga0105245_10328696 3300009098 Bacteria 1508
40 Ga0105245_10529800 3300009098 Bacteria 1198
41 Ga0105248_10412041 3300009177 Bacteria 1522
42 Ga0105238_10111059 3300009551 Bacteria 2722
43 Ga0105239_10005533 3300010375 Bacteria 14790
44 Ga0105239_10486843 3300010375 Bacteria 1402
45 Ga0157371_10001143 3300013102 Bacteria 28586
46 Ga0157369_10121024 3300013105 Bacteria 2777
47 Ga0157369_10240446 3300013105 Bacteria 1891
48 Ga0157369_10481363 3300013105 Bacteria 1285
49 Ga0157378_10409787 3300013297 Bacteria 1337
50 Ga0163163_10016192 3300014325 Bacteria 6922
51 Ga0163163_10119656 3300014325 Bacteria 2667
52 Ga0182008_10120270 3300014497 Bacteria 1305
53 Ga0197907_10486104 3300020069 Bacteria 1611
54 Ga0206349_1573561 3300020075 Bacteria 1055
55 Ga0206355_1561139 3300020076 Bacteria 1806
56 Ga0206350_11245485 3300020080 Bacteria 930
57 Ga0206354_11496684 3300020081 Bacteria 1231
58 Ga0206353_11318590 3300020082 Bacteria 1676
59 Ga0213872_10088968 3300021361 Bacteria 1383
60 Ga0213874_10003223 3300021377 Bacteria 3599
61 Ga0213875_10000580 3300021388 Bacteria 29736
62 Ga0213875_10002216 3300021388 Bacteria 11824
63 Ga0213875_10103414 3300021388 Bacteria 1329
64 Ga0224712_10093320 3300022467 Bacteria 1265
65 Ga0224712_10125662 3300022467 Bacteria 1115
66 Ga0209674_102910 3300025226 Bacteria 3386
67 Ga0209147_100145 3300025229 Bacteria 106552
68 Ga0209147_100242 3300025229 Bacteria 53145
69 Ga0207656_10040892 3300025321 Bacteria 1967
70 Ga0207655_1000806 3300025728 Bacteria 34049
71 Ga0207645_10180957 3300025907 Bacteria 1383
72 Ga0207705_10028098 3300025909 Bacteria 4010
73 Ga0207654_10051493 3300025911 Bacteria 2370
74 Ga0207707_10285329 3300025912 Bacteria 1429
75 Ga0207695_10145081 3300025913 Bacteria 2319
76 Ga0207693_10352315 3300025915 Bacteria 1152
77 Ga0207663_10022731 3300025916 Bacteria 3589
78 Ga0207649_10004014 3300025920 Bacteria 8014
79 Ga0207649_10036234 3300025920 Bacteria 2970
80 Ga0207649_10068143 3300025920 Bacteria 2261
81 Ga0207687_10493954 3300025927 Bacteria 1021
82 Ga0207700_10502901 3300025928 Bacteria 1073
83 Ga0207690_10057509 3300025932 Bacteria 2627
84 Ga0207679_10063145 3300025945 Bacteria 2764
85 Ga0207667_10067174 3300025949 Bacteria 3735
86 Ga0207640_10161469 3300025981 Bacteria 1658
87 Ga0207639_10003360 3300026041 Bacteria 10764
88 Ga0207678_10810959 3300026067 Bacteria 826
89 Ga0207674_10009871 3300026116 Bacteria 10861
90 Ga0207675_100030830 3300026118 Bacteria 4994
91 Ga0207683_10090064 3300026121 Bacteria 2731
92 Ga0207698_10401461 3300026142 Bacteria 1310
93 Ga0268266_10118463 3300028379 Bacteria 2354
94 Ga0265338_10109599 3300028800 Bacteria 2227
95 Ga0265338_10527801 3300028800 Bacteria 829
96 Ga0265314_10077526 3300031711 Bacteria 2204
97 Ga0307416_100378079 3300032002 Bacteria 1445
98 Ga0373926_0035765 3300035083 Bacteria 1763
99 Ga0373936_0154908 3300035113 Bacteria 995
100 Ga0373945_0088879 3300035116 Bacteria 1194
101 Ga0373953_0086571 3300035117 Bacteria 1308
102 Ga0373953_0112901 3300035117 Bacteria 1150
103 Ga0373954_0046588 3300035118 Bacteria 2027
104 Ga0373956_0009707 3300035119 Bacteria 3919
105 Ga0373943_0057214 3300035170 Bacteria 1937
106 Ga0373946_0016537 3300035171 Bacteria 2812
107 Ga0373955_0355546 3300035172 Bacteria 887
108 Ga0373931_0024218 3300035691 Bacteria 3073
109 Ga0373931_0123376 3300035691 Bacteria 1483
110 Ga0373927_0304426 3300035695 Bacteria 1049
111 Ga0373927_0306092 3300035695 Bacteria 1046
112 Ga0373933_0027625 3300035724 Bacteria 3269
113 Ga0373947_0008718 3300035725 Bacteria 5833
114 Ga0373937_0003675 3300036401 Bacteria 12955
115 Ga0373937_0026345 3300036401 Bacteria 5254
116 Ga0373937_0061345 3300036401 Bacteria 3456
117 Ga0373937_0149147 3300036401 Bacteria 2190
118 Ga0373937_0352484 3300036401 Bacteria 1394
119 Ga0373925_0020218 3300037068 Bacteria 4844
120 Ga0373925_0033066 3300037068 Bacteria 3811
121 Ga0373925_0306422 3300037068 Bacteria 1283
122 Ga0395905_0000132 3300037471 Bacteria 123636
123 Ga0436364_0056802 3300037853 Bacteria 6930
124 Ga0436364_0727525 3300037853 Bacteria 12494
125 Ga0436364_0783603 3300037853 Bacteria 20633
126 Ga0436364_0898896 3300037853 Bacteria 2542
127 Ga0436364_1100477 3300037853 Bacteria 2281
128 Ga0436364_1376752 3300037853 Bacteria 12366
129 Ga0436365_0120856 3300039437 Bacteria 4697
130 Ga0436365_1458467 3300039437 Bacteria 2819
131 Ga0436360_0007134 3300039438 Bacteria 1649
132 Ga0436360_0543256 3300039438 Bacteria 6725
133 Ga0436360_0593787 3300039438 Bacteria 1189
134 Ga0436360_0707619 3300039438 Bacteria 1056
135 Ga0436360_1377170 3300039438 Bacteria 1952
136 Ga0436361_0428500 3300039447 Bacteria 1896
137 Ga0436361_0721546 3300039447 Bacteria 3123
138 Ga0436361_0948238 3300039447 Bacteria 1675
139 Ga0436363_0261799 3300039450 Bacteria 3335
140 Ga0436363_0884029 3300039450 Bacteria 1061
141 Ga0436363_0961536 3300039450 Bacteria 1200
142 Ga0436362_0386836 3300039453 Bacteria 1369
143 Ga0436362_0778940 3300039453 Bacteria 4371
144 Ga0439438_003955 3300041405 Bacteria 5833
145 Ga0439447_001534 3300041407 Bacteria 8449
146 Ga0439466_0000187 3300041411 Bacteria 24679
147 Ga0439466_0001070 3300041411 Bacteria 10568
148 Ga0439452_007431 3300042010 Bacteria 3356
149 Ga0450902_000762 3300042137 Bacteria 4147
150 Ga0450903_004628 3300042138 Bacteria 2336
151 Ga0466967_0728062 3300045976 Bacteria 983
152 Ga0495592_0120556 3300046454 Bacteria 1846
153 Ga0495651_0084783 3300046462 Bacteria 2387
154 Ga0495653_0001028 3300046463 Bacteria 21502
155 Ga0495580_0000009 3300046472 Bacteria 101827
156 Ga0495605_0010166 3300046474 Bacteria 5269
157 Ga0495639_0021232 3300046475 Bacteria 2841
158 Ga0495664_0001050 3300046477 Bacteria 14264
159 Ga0495664_0134715 3300046477 Bacteria 1496
160 Ga0495585_0007802 3300046492 Bacteria 6516
161 Ga0495583_0005202 3300046506 Bacteria 8943
162 Ga0495583_0116206 3300046506 Bacteria 1130
163 Ga0495583_0128283 3300046506 Bacteria 1063
164 Ga0495608_0121930 3300046511 Bacteria 1671
165 Ga0495628_0053545 3300046516 Bacteria 3184
166 Ga0495628_0057896 3300046516 Bacteria 3048
167 Ga0495628_0411804 3300046516 Bacteria 986
168 Ga0495630_0401637 3300046517 Bacteria 1050
169 Ga0495648_0050377 3300046524 Bacteria 2545
170 Ga0495666_0000960 3300046526 Bacteria 13595
171 Ga0495666_0073258 3300046526 Bacteria 1625
172 Ga0495652_0005590 3300046529 Bacteria 11808
173 Ga0495652_0116109 3300046529 Bacteria 2144
174 Ga0495654_0000345 3300046530 Bacteria 40180
175 Ga0495665_0005374 3300046531 Bacteria 6904
176 Ga0495665_0170592 3300046531 Bacteria 1133
177 Ga0495640_0027177 3300046533 Bacteria 4130
178 Ga0495640_0043793 3300046533 Bacteria 3115
179 Ga0495587_0046104 3300046536 Bacteria 2588
180 Ga0495587_0058109 3300046536 Bacteria 2273
181 Ga0495597_0002911 3300046542 Bacteria 10399
182 Ga0495645_0001337 3300046543 Bacteria 16682
183 Ga0495645_0050732 3300046543 Bacteria 3020
184 Ga0495645_0263297 3300046543 Bacteria 1140
185 Ga0495667_0042521 3300046559 Bacteria 3013
186 Ga0495667_0049986 3300046559 Bacteria 2760
187 Ga0495667_0315991 3300046559 Bacteria 989
188 Ga0495611_0041265 3300046648 Bacteria 2058
189 Ga0495635_0006593 3300046663 Bacteria 8103
190 Ga0495635_0027669 3300046663 Bacteria 3943
191 Ga0495657_0071918 3300046675 Bacteria 2257
192 Ga0495657_0314416 3300046675 Bacteria 932
193 Ga0495599_0100640 3300046678 Bacteria 1801
194 Ga0495599_0101308 3300046678 Bacteria 1795
195 Ga0495623_0089473 3300046679 Bacteria 1892
196 Ga0495646_0123905 3300046680 Bacteria 1460
197 Ga0495669_0127154 3300046684 Bacteria 1198
198 Ga0495624_0010563 3300046690 Bacteria 6361
199 Ga0495624_0285093 3300046690 Bacteria 997
200 Ga0495671_0215119 3300046692 Bacteria 931
201 Ga0495649_0000568 3300046694 Bacteria 31251
202 Ga0495589_0038918 3300046794 Bacteria 2378
203 Ga0495600_0083839 3300046809 Bacteria 2080
204 Ga0495600_0195973 3300046809 Bacteria 1298
205 Ga0495604_0038752 3300047317 Bacteria 3750
206 Ga0495604_0190291 3300047317 Bacteria 1430
207 Ga0495604_0307717 3300047317 Bacteria 1062
208 Ga0495674_0053469 3300047319 Bacteria 3550
209 Ga0495674_0284062 3300047319 Bacteria 1355
210 Ga0495674_0639962 3300047319 Bacteria 839
211 Ga0495672_0017556 3300047320 Bacteria 4783
212 Ga0495680_0005821 3300047322 Bacteria 11538
213 Ga0495675_0009923 3300047444 Bacteria 5936
214 Ga0495677_0119668 3300047445 Bacteria 1004
215 Ga0495673_0008377 3300047469 Bacteria 5826
216 Ga0495684_0061528 3300047471 Bacteria 2856
217 Ga0495686_0043983 3300047472 Bacteria 2828
218 Ga0495593_0001947 3300047673 Bacteria 12321
219 Ga0495602_0011229 3300048088 Bacteria 9262
220 Ga0495602_0050521 3300048088 Bacteria 3714
221 Ga0495602_0093812 3300048088 Bacteria 2482
222 Ga0495602_0139547 3300048088 Bacteria 1920
223 Ga0495602_0176019 3300048088 Bacteria 1655
224 Ga0496101_0051662 3300048904 Bacteria 2962
225 Ga0496104_0024976 3300048907 Bacteria 5504
226 Ga0496105_0026423 3300048908 Bacteria 4734
227 Ga0496105_0074894 3300048908 Bacteria 2796
228 Ga0496118_0138159 3300048921 Bacteria 1551
229 Ga0496119_0032262 3300048922 Bacteria 3494
230 Ga0496120_0205687 3300048923 Bacteria 950
231 Ga0496121_0001337 3300048924 Bacteria 42201
232 Ga0496121_0040083 3300048924 Bacteria 4114
233 Ga0495678_030269 3300049459 Bacteria 2266
234 Ga0501033_0171066 3300049570 Bacteria 1560
235 Ga0501034_0669046 3300049571 Bacteria 939
236 Ga0501037_0024139 3300049573 Bacteria 4496
237 Ga0501043_0025817 3300049579 Bacteria 4608
238 Ga0501046_0243095 3300049580 Bacteria 1327
239 Ga0501046_0483188 3300049580 Bacteria 888
240 Ga0501047_0085202 3300049581 Bacteria 3036
241 Ga0501048_0371867 3300049582 Bacteria 1020
242 Ga0501048_0444099 3300049582 Bacteria 929
243 Ga0501070_0215692 3300049586 Bacteria 1574
244 Ga0501070_0664217 3300049586 Bacteria 827
245 Ga0501071_0256838 3300049587 Bacteria 1319
246 Ga0501075_0172110 3300049591 Bacteria 1653
247 Ga0501076_0160041 3300049592 Bacteria 1834
248 Ga0501077_0274182 3300049593 Bacteria 1073
249 Ga0501080_0065946 3300049742 Bacteria 3367
250 Ga0501080_0151905 3300049742 Bacteria 2140
251 Ga0501080_0191570 3300049742 Bacteria 1879
252 Ga0501081_0266334 3300049743 Bacteria 1253
253 Ga0501083_0081363 3300049744 Bacteria 2147
254 Ga0501035_0190897 3300049822 Bacteria 1761
255 Ga0501044_0163517 3300049823 Bacteria 2201
256 Ga0495601_0004037 3300053077 Bacteria 8456
257 Ga0495612_0008546 3300053078 Bacteria 4152
258 Ga0495619_0202815 3300053085 Bacteria 1373
259 Ga0500651_0009945 3300053093 Bacteria 5679
260 Ga0501084_0405754 3300054114 Bacteria 1152
261 Ga0501082_0068155 3300060353 Bacteria 3064
262 Ga0501082_0191861 3300060353 Bacteria 1777
263 2519461949 2519103095 Bacteria 6629912
264 2585295606 2582581311 Bacteria 6763856
265 2792835586 2791355137 Bacteria 9654227
266 2842326574 2842324504 Bacteria 9364110
267 2842350907 2842348783 Bacteria 9002918
268 2909401839 2909399089 Bacteria 3922598
269 2921648561 2921643360 Bacteria 11448031
270 641335224 641228493 Bacteria 3999591
271 643391518 643348555 Bacteria 3914947
272 8055272656 8055266321 Bacteria 7999742
273 Ga0500566_0163162
274 Ga0058862_12740279
275 Ga0070676_10409812
276 Ga0068868_100126958
277 Ga0070660_100147137
278 Ga0070661_100075004
279 Ga0070661_100082843
280 Ga0070674_100005259
281 Ga0070673_100046469
282 Ga0070659_100065339
283 Ga0070709_10007706
284 Ga0070714_100110509
285 Ga0070713_100006820
286 Ga0070711_100541508
287 Ga0070684_100569570
288 Ga0068853_100001085
289 Ga0068853_100015377
290 Ga0068853_100345771
291 Ga0070696_100280189
292 Ga0070693_100190764
293 Ga0070665_100069728
294 Ga0070664_100151179
295 Ga0068857_100076221
296 Ga0068857_100566760
297 Ga0068854_100118790
298 Ga0068856_100530328
299 Ga0068852_100098218
300 Ga0068852_100424798
301 Ga0068861_100018265
302 Ga0081455_10161632
303 Ga0081538_10019739
304 Ga0081538_10109702
305 Ga0070717_10144995
306 Ga0070712_100170182
307 Ga0068865_100712114
308 Ga0105244_10002538
309 Ga0105240_10305899
310 Ga0105240_10527994
311 Ga0105245_10328696
312 Ga0105245_10529800
313 Ga0105248_10412041
314 Ga0105238_10111059
315 Ga0105239_10005533
316 Ga0105239_10486843
317 Ga0157371_10001143
318 Ga0157369_10121024
319 Ga0157369_10240446
320 Ga0157369_10481363
321 Ga0157378_10409787
322 Ga0163163_10016192
323 Ga0163163_10119656
324 Ga0182008_10120270
325 Ga0197907_10486104
326 Ga0206349_1573561
327 Ga0206355_1561139
328 Ga0206350_11245485
329 Ga0206354_11496684
330 Ga0206353_11318590
331 Ga0213872_10088968
332 Ga0213874_10003223
333 Ga0213875_10000580
334 Ga0213875_10002216
335 Ga0213875_10103414
336 Ga0224712_10093320
337 Ga0224712_10125662
338 Ga0209674_102910
339 Ga0209147_100145
340 Ga0209147_100242
341 Ga0207656_10040892
342 Ga0207655_1000806
343 Ga0207645_10180957
344 Ga0207705_10028098
345 Ga0207654_10051493
346 Ga0207707_10285329
347 Ga0207695_10145081
348 Ga0207693_10352315
349 Ga0207663_10022731
350 Ga0207649_10004014
351 Ga0207649_10036234
352 Ga0207649_10068143
353 Ga0207687_10493954
354 Ga0207700_10502901
355 Ga0207690_10057509
356 Ga0207679_10063145
357 Ga0207667_10067174
358 Ga0207640_10161469
359 Ga0207639_10003360
360 Ga0207678_10810959
361 Ga0207674_10009871
362 Ga0207675_100030830
363 Ga0207683_10090064
364 Ga0207698_10401461
365 Ga0268266_10118463
366 Ga0265338_10109599
367 Ga0265338_10527801
368 Ga0265314_10077526
369 Ga0307416_100378079
370 Ga0373926_0035765
371 Ga0373936_0154908
372 Ga0373945_0088879
373 Ga0373953_0086571
374 Ga0373953_0112901
375 Ga0373954_0046588
376 Ga0373956_0009707
377 Ga0373943_0057214
378 Ga0373946_0016537
379 Ga0373955_0355546
380 Ga0373931_0024218
381 Ga0373931_0123376
382 Ga0373927_0304426
383 Ga0373927_0306092
384 Ga0373933_0027625
385 Ga0373947_0008718
386 Ga0373937_0003675
387 Ga0373937_0026345
388 Ga0373937_0061345
389 Ga0373937_0149147
390 Ga0373937_0352484
391 Ga0373925_0020218
392 Ga0373925_0033066
393 Ga0373925_0306422
394 Ga0395905_0000132
395 Ga0436364_0056802
396 Ga0436364_0727525
397 Ga0436364_0783603
398 Ga0436364_0898896
399 Ga0436364_1100477
400 Ga0436364_1376752
401 Ga0436365_0120856
402 Ga0436365_1458467
403 Ga0436360_0007134
404 Ga0436360_0543256
405 Ga0436360_0593787
406 Ga0436360_0707619
407 Ga0436360_1377170
408 Ga0436361_0428500
409 Ga0436361_0721546
410 Ga0436361_0948238
411 Ga0436363_0261799
412 Ga0436363_0884029
413 Ga0436363_0961536
414 Ga0436362_0386836
415 Ga0436362_0778940
416 Ga0439438_003955
417 Ga0439447_001534
418 Ga0439466_0000187
419 Ga0439466_0001070
420 Ga0439452_007431
421 Ga0450902_000762
422 Ga0450903_004628
423 Ga0466967_0728062
424 Ga0495592_0120556
425 Ga0495651_0084783
426 Ga0495653_0001028
427 Ga0495580_0000009
428 Ga0495605_0010166
429 Ga0495639_0021232
430 Ga0495664_0001050
431 Ga0495664_0134715
432 Ga0495585_0007802
433 Ga0495583_0005202
434 Ga0495583_0116206
435 Ga0495583_0128283
436 Ga0495608_0121930
437 Ga0495628_0053545
438 Ga0495628_0057896
439 Ga0495628_0411804
440 Ga0495630_0401637
441 Ga0495648_0050377
442 Ga0495666_0000960
443 Ga0495666_0073258
444 Ga0495652_0005590
445 Ga0495652_0116109
446 Ga0495654_0000345
447 Ga0495665_0005374
448 Ga0495665_0170592
449 Ga0495640_0027177
450 Ga0495640_0043793
451 Ga0495587_0046104
452 Ga0495587_0058109
453 Ga0495597_0002911
454 Ga0495645_0001337
455 Ga0495645_0050732
456 Ga0495645_0263297
457 Ga0495667_0042521
458 Ga0495667_0049986
459 Ga0495667_0315991
460 Ga0495611_0041265
461 Ga0495635_0006593
462 Ga0495635_0027669
463 Ga0495657_0071918
464 Ga0495657_0314416
465 Ga0495599_0100640
466 Ga0495599_0101308
467 Ga0495623_0089473
468 Ga0495646_0123905
469 Ga0495669_0127154
470 Ga0495624_0010563
471 Ga0495624_0285093
472 Ga0495671_0215119
473 Ga0495649_0000568
474 Ga0495589_0038918
475 Ga0495600_0083839
476 Ga0495600_0195973
477 Ga0495604_0038752
478 Ga0495604_0190291
479 Ga0495604_0307717
480 Ga0495674_0053469
481 Ga0495674_0284062
482 Ga0495674_0639962
483 Ga0495672_0017556
484 Ga0495680_0005821
485 Ga0495675_0009923
486 Ga0495677_0119668
487 Ga0495673_0008377
488 Ga0495684_0061528
489 Ga0495686_0043983
490 Ga0495593_0001947
491 Ga0495602_0011229
492 Ga0495602_0050521
493 Ga0495602_0093812
494 Ga0495602_0139547
495 Ga0495602_0176019
496 Ga0496101_0051662
497 Ga0496104_0024976
498 Ga0496105_0026423
499 Ga0496105_0074894
500 Ga0496118_0138159
501 Ga0496119_0032262
502 Ga0496120_0205687
503 Ga0496121_0001337
504 Ga0496121_0040083
505 Ga0495678_030269
506 Ga0501033_0171066
507 Ga0501034_0669046
508 Ga0501037_0024139
509 Ga0501043_0025817
510 Ga0501046_0243095
511 Ga0501046_0483188
512 Ga0501047_0085202
513 Ga0501048_0371867
514 Ga0501048_0444099
515 Ga0501070_0215692
516 Ga0501070_0664217
517 Ga0501071_0256838
518 Ga0501075_0172110
519 Ga0501076_0160041
520 Ga0501077_0274182
521 Ga0501080_0065946
522 Ga0501080_0151905
523 Ga0501080_0191570
524 Ga0501081_0266334
525 Ga0501083_0081363
526 Ga0501035_0190897
527 Ga0501044_0163517
528 Ga0495601_0004037
529 Ga0495612_0008546
530 Ga0495619_0202815
531 Ga0500651_0009945
532 Ga0501084_0405754
533 Ga0501082_0068155
534 Ga0501082_0191861
535 2519461949
536 2585295606
537 2792835586
538 2842326574
539 2842350907
540 2909401839
541 2921648561
542 641335224
543 643391518
544 8055272656

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01012

ETF

Electron transfer flavoprotein domain

23

208

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.9718 1 224
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.9509 1 224
2a1t-assembly1.cif.gz_S structure of the human mcad:etf e165betaa complex 0.9341 2 242
1efp-assembly2.cif.gz_D electron transfer flavoprotein (etf) from paracoccus denitrificans 0.9275 1 242
1o95-assembly1.cif.gz_E ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.9225 1 223
ID Description Score Start End Superfamily
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9718 1 224 3.40.50.620
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9509 1 224 3.40.50.620
af_Q54YZ4_1_250_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9279 2 248 3.40.50.620
1o94C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9177 1 223 3.40.50.620
af_Q54YZ4_1_250_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9171 2 248 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A2T0QHW5-F1-model_v4 Electron transfer flavoprotein beta subunit 1 1 86 GO:0009055
AF-A0A3D5N4G0-F1-model_v4 Electron transfer flavoprotein subunit beta 0.9996 1 100 GO:0009055
AF-A0A7W9RY60-F1-model_v4 Electron transfer flavoprotein alpha/beta subunit 0.9987 1 110 GO:0009055
AF-A0A4V2DP92-F1-model_v4 Electron transfer flavoprotein subunit beta/FixA family protein 0.9983 1 85 GO:0009055
AF-A0A1H2PLR8-F1-model_v4 Electron transfer flavoprotein beta subunit 0.9981 1 113 GO:0009055

Map