F378704

General Info

Members Datasets Scaffolds Average Seq Length
272 172 265 325

Family's Representative Sequence

Representative Sequence 3300055283|Ga0500661_002228|Ga0500661_002228_1579_2694
Length 371
Sequence MQTGLLIVPFSLSSFKIIVFYPHQPGDKWTLLQGDLDMIIAYLCLKNMKQVTIVVPSGYANLASIVGTFQILSKANEYWQNMGNKPGIEIRIAGFMKELKLDGGFFSIFPVDLNEVKSTDLVIIPSVSHEYDLVIKENDTMINWIREQYKDGAEIASICTGAFLLAATGLLEGKSCSTHWNAAAAFRRLFPNVDLHTDELLTASLGIYTNGGAYSFLNLVLFLVEKYFDRSTAIFCSKVFQIDIDRNSQSPFFIFQAQKAHGDDLINKAQTYIEENLTQKISFEQIAAELAISRRNFDRRFIKATGNTPVEYMQRVKVEVAKSNLEKGRKSVFEVMNEVGYSDDKAFREVFKKISGLSPLEYRTKYNKQKV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
4 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
5 2738543023 Pedobacter sp. OK628 Isolate Unclassified
6 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
7 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
8 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
77 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
78 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
120 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
128 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
131 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
144 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
153 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
154 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
155 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
156 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
159 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
162 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
163 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
164 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
165 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
166 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
167 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
169 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
170 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
171 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
172 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.43
Metatranscriptomes 0
Isolates 2.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.19
Nodule 0
Rhizoplane 0
Rhizosphere 80.15
Stem 0
Stem Tuber 0
Unclassified 10.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2922140 2162886007 Bacteria 10531
2 JGI25154J39366_1000014 3300002738 Bacteria 265287
3 JGI25157J39369_1004338 3300002741 Unclassified 2608
4 JGI25153J46596_10013231 3300003215 Bacteria 3502
5 rootH1_10029986 3300003316 Bacteria 7381
6 rootH1_10033439 3300003316 Bacteria 30115
7 rootH1_10143439 3300003316 Unclassified 2298
8 rootH2_10006334 3300003320 Bacteria 20923
9 rootH2_10034584 3300003320 Bacteria 27131
10 rootH2_10096712 3300003320 Bacteria 2437
11 rootH2_10181410 3300003320 Unclassified 1608
12 rootL2_10068274 3300003322 Bacteria 19040
13 rootL2_10194323 3300003322 Unclassified 1340
14 rootH1_10008264 3300003323 Bacteria 63477
15 rootH1_10047131 3300003323 Bacteria 4047
16 rootH1_10102527 3300003323 Bacteria 4523
17 rootH1_10276905 3300003323 Bacteria 1802
18 JGI25160J50197_1003463 3300003354 Bacteria 7061
19 Ga0065714_10004016 3300005288 Bacteria 9667
20 Ga0065704_10000229 3300005289 Bacteria 80338
21 Ga0065704_10070574 3300005289 Bacteria 20061
22 Ga0070658_10059406 3300005327 Bacteria 3113
23 Ga0070658_10112175 3300005327 Bacteria 2260
24 Ga0070676_10219687 3300005328 Unclassified 1254
25 Ga0070670_100036844 3300005331 Bacteria 4208
26 Ga0070670_100037307 3300005331 Bacteria 4181
27 Ga0070670_100307240 3300005331 Bacteria 1388
28 Ga0070670_100340451 3300005331 Bacteria 1316
29 Ga0070666_10033602 3300005335 Bacteria 3394
30 Ga0070666_10038964 3300005335 Unclassified 3164
31 Ga0070682_100276693 3300005337 Bacteria 1222
32 Ga0068868_100155346 3300005338 Unclassified 1887
33 Ga0070689_100175600 3300005340 Bacteria 1737
34 Ga0070669_100283595 3300005353 Unclassified 1328
35 Ga0070675_100010590 3300005354 Bacteria 7208
36 Ga0070671_100204615 3300005355 Bacteria 1674
37 Ga0070673_100252281 3300005364 Bacteria 1538
38 Ga0070673_100256035 3300005364 Unclassified 1527
39 Ga0070673_100367101 3300005364 Unclassified 1281
40 Ga0070667_100081188 3300005367 Unclassified 2774
41 Ga0070667_100231646 3300005367 Bacteria 1647
42 Ga0070678_100048739 3300005456 Unclassified 3053
43 Ga0070662_100062969 3300005457 Unclassified 2712
44 Ga0068853_100001245 3300005539 Bacteria 18191
45 Ga0070672_100067740 3300005543 Unclassified 2829
46 Ga0070665_100008203 3300005548 Bacteria 10574
47 Ga0070665_100118344 3300005548 Unclassified 2651
48 Ga0070665_100387310 3300005548 Bacteria 1405
49 Ga0068855_100013183 3300005563 Bacteria 9972
50 Ga0068854_100086286 3300005578 Bacteria 2326
51 Ga0068856_100000031 3300005614 Bacteria 126668
52 Ga0068856_100049815 3300005614 Bacteria 4129
53 Ga0068856_100161487 3300005614 Unclassified 2251
54 Ga0068859_100001069 3300005617 Bacteria 28045
55 Ga0068864_100104123 3300005618 Unclassified 2520
56 Ga0068864_100182072 3300005618 Bacteria 1921
57 Ga0068866_10015301 3300005718 Unclassified 3405
58 Ga0068861_100150076 3300005719 Bacteria 1911
59 Ga0068851_10000140 3300005834 Bacteria 38908
60 Ga0068870_10026774 3300005840 Bacteria 2877
61 Ga0068863_100003354 3300005841 Bacteria 15821
62 Ga0068863_100023318 3300005841 Bacteria 5913
63 Ga0068863_100076530 3300005841 Unclassified 3166
64 Ga0068863_100200180 3300005841 Unclassified 1921
65 Ga0068860_100070948 3300005843 Bacteria 3312
66 Ga0068860_100632118 3300005843 Unclassified 1077
67 Ga0075366_10018099 3300006195 Bacteria 4068
68 Ga0075366_10104126 3300006195 Unclassified 1705
69 Ga0097621_100040412 3300006237 Bacteria 3750
70 Ga0097621_100073822 3300006237 Bacteria 2825
71 Ga0097621_100125737 3300006237 Unclassified 2178
72 Ga0097621_100173127 3300006237 Unclassified 1862
73 Ga0068871_100155366 3300006358 Unclassified 1953
74 Ga0075428_100395125 3300006844 Bacteria 1482
75 Ga0097620_100001069 3300006931 Bacteria 28045
76 Ga0105240_10000208 3300009093 Bacteria 118950
77 Ga0105240_10000225 3300009093 Bacteria 112806
78 Ga0105240_10000723 3300009093 Bacteria 60353
79 Ga0105240_10036668 3300009093 Bacteria 6306
80 Ga0105240_10039894 3300009093 Bacteria 6009
81 Ga0105240_10080274 3300009093 Bacteria 4012
82 Ga0111539_10074105 3300009094 Bacteria 4011
83 Ga0111539_10437695 3300009094 Unclassified 1522
84 Ga0105247_10118726 3300009101 Unclassified 1711
85 Ga0105241_10000516 3300009174 Bacteria 29076
86 Ga0105242_10009462 3300009176 Bacteria 7467
87 Ga0105242_10014379 3300009176 Bacteria 6131
88 Ga0105237_10026056 3300009545 Bacteria 5976
89 Ga0105237_10035299 3300009545 Bacteria 5060
90 Ga0105237_10076335 3300009545 Unclassified 3341
91 Ga0105237_10119771 3300009545 Bacteria 2626
92 Ga0105237_10175145 3300009545 Unclassified 2145
93 Ga0105237_10662518 3300009545 Bacteria 1050
94 Ga0105238_10000678 3300009551 Bacteria 35832
95 Ga0105238_10164600 3300009551 Bacteria 2193
96 Ga0105238_10313023 3300009551 Unclassified 1555
97 Ga0105249_10051577 3300009553 Bacteria 3753
98 Ga0105249_10354321 3300009553 Unclassified 1487
99 Ga0105239_10002897 3300010375 Bacteria 21432
100 Ga0105239_10003136 3300010375 Bacteria 20512
101 Ga0105239_10003456 3300010375 Bacteria 19331
102 Ga0105239_10014159 3300010375 Bacteria 8850
103 Ga0105239_10050829 3300010375 Bacteria 4545
104 Ga0105239_10062051 3300010375 Bacteria 4103
105 Ga0105239_10100590 3300010375 Bacteria 3198
106 Ga0105239_10196397 3300010375 Unclassified 2260
107 Ga0105246_10214279 3300011119 Unclassified 1505
108 Ga0157373_10000406 3300013100 Bacteria 34546
109 Ga0157371_10002696 3300013102 Bacteria 16770
110 Ga0157370_10013118 3300013104 Bacteria 8550
111 Ga0157370_10128732 3300013104 Bacteria 2362
112 Ga0157374_10000013 3300013296 Bacteria 461240
113 Ga0157378_10010603 3300013297 Bacteria 8054
114 Ga0157378_10093214 3300013297 Bacteria 2741
115 Ga0157378_10389770 3300013297 Unclassified 1370
116 Ga0163162_10021216 3300013306 Bacteria 6392
117 Ga0163162_10133462 3300013306 Unclassified 2593
118 Ga0163162_10190693 3300013306 Unclassified 2177
119 Ga0157372_10007957 3300013307 Bacteria 11270
120 Ga0157372_10026776 3300013307 Bacteria 6276
121 Ga0157372_10063605 3300013307 Bacteria 4138
122 Ga0157375_10002912 3300013308 Bacteria 14835
123 Ga0157375_10281839 3300013308 Unclassified 1825
124 Ga0163163_10023633 3300014325 Bacteria 5835
125 Ga0163163_10097737 3300014325 Unclassified 2957
126 Ga0157380_10000027 3300014326 Bacteria 101082
127 Ga0157380_10041646 3300014326 Unclassified 3586
128 Ga0157379_10514606 3300014968 Bacteria 1110
129 Ga0157376_10012444 3300014969 Bacteria 6317
130 Ga0157376_10038722 3300014969 Bacteria 3881
131 Ga0157376_10056466 3300014969 Unclassified 3280
132 Ga0163161_10047215 3300017792 Bacteria 3110
133 Ga0209436_100816 3300025208 Bacteria 12671
134 Ga0209646_1000002 3300025246 Bacteria 1425781
135 Ga0209026_1001201 3300025250 Bacteria 11996
136 Ga0209130_1002016 3300025284 Bacteria 11066
137 Ga0209050_1000990 3300025298 Bacteria 36024
138 Ga0207426_1000073 3300025302 Bacteria 323756
139 Ga0207656_10000258 3300025321 Bacteria 18415
140 Ga0207656_10031415 3300025321 Bacteria 2200
141 Ga0207682_10022668 3300025893 Bacteria 2476
142 Ga0207680_10004310 3300025903 Bacteria 6743
143 Ga0207647_10000717 3300025904 Bacteria 25975
144 Ga0207647_10031791 3300025904 Bacteria 3395
145 Ga0207645_10015785 3300025907 Bacteria 5007
146 Ga0207645_10029103 3300025907 Bacteria 3562
147 Ga0207643_10007039 3300025908 Bacteria 6026
148 Ga0207705_10088925 3300025909 Bacteria 2260
149 Ga0207654_10003830 3300025911 Bacteria 7584
150 Ga0207695_10000257 3300025913 Bacteria 134853
151 Ga0207695_10000643 3300025913 Bacteria 69314
152 Ga0207695_10000648 3300025913 Bacteria 69088
153 Ga0207695_10010126 3300025913 Bacteria 11571
154 Ga0207695_10020383 3300025913 Bacteria 7595
155 Ga0207695_10081023 3300025913 Unclassified 3286
156 Ga0207671_10015081 3300025914 Bacteria 6073
157 Ga0207671_10073108 3300025914 Bacteria 2560
158 Ga0207671_10175044 3300025914 Bacteria 1668
159 Ga0207662_10070079 3300025918 Bacteria 2120
160 Ga0207652_10025915 3300025921 Bacteria 4878
161 Ga0207681_10196282 3300025923 Bacteria 1547
162 Ga0207650_10006283 3300025925 Bacteria 8095
163 Ga0207650_10026434 3300025925 Bacteria 4140
164 Ga0207650_10271096 3300025925 Bacteria 1379
165 Ga0207659_10037395 3300025926 Bacteria 3370
166 Ga0207706_10055159 3300025933 Bacteria 3505
167 Ga0207686_10001307 3300025934 Bacteria 14268
168 Ga0207686_10003874 3300025934 Bacteria 8026
169 Ga0207669_10142870 3300025937 Unclassified 1664
170 Ga0207691_10061915 3300025940 Unclassified 3398
171 Ga0207711_10079239 3300025941 Bacteria 2867
172 Ga0207689_10013217 3300025942 Bacteria 7045
173 Ga0207667_10027149 3300025949 Bacteria 6240
174 Ga0207667_10573802 3300025949 Bacteria 1139
175 Ga0207651_10047554 3300025960 Unclassified 2894
176 Ga0207651_10274570 3300025960 Bacteria 1390
177 Ga0207712_10040669 3300025961 Unclassified 3192
178 Ga0207658_10024927 3300025986 Unclassified 4185
179 Ga0207677_10048583 3300026023 Unclassified 2858
180 Ga0207639_10003540 3300026041 Bacteria 10493
181 Ga0207708_10099251 3300026075 Bacteria 2252
182 Ga0207702_10000071 3300026078 Bacteria 114394
183 Ga0207702_10020296 3300026078 Bacteria 5504
184 Ga0207702_10043821 3300026078 Unclassified 3759
185 Ga0207702_10260911 3300026078 Bacteria 1631
186 Ga0207641_10000422 3300026088 Bacteria 49394
187 Ga0207641_10014619 3300026088 Bacteria 6435
188 Ga0207641_10071665 3300026088 Unclassified 2981
189 Ga0207648_10009835 3300026089 Bacteria 9125
190 Ga0207648_10060785 3300026089 Bacteria 3295
191 Ga0207648_10127426 3300026089 Unclassified 2239
192 Ga0207676_10068043 3300026095 Bacteria 2847
193 Ga0207676_10318753 3300026095 Bacteria 1426
194 Ga0207675_100202765 3300026118 Bacteria 1905
195 Ga0207698_10051867 3300026142 Bacteria 3139
196 Ga0207428_10065752 3300027907 Bacteria 2859
197 Ga0268266_10004384 3300028379 Bacteria 13537
198 Ga0268266_10144932 3300028379 Unclassified 2134
199 Ga0268266_10334565 3300028379 Bacteria 1420
200 Ga0307515_10000072 3300028794 Bacteria 237798
201 Ga0307515_10004317 3300028794 Bacteria 29498
202 Ga0307515_10154983 3300028794 Bacteria 2370
203 Ga0265327_10000254 3300031251 Bacteria 106076
204 Ga0265327_10000405 3300031251 Bacteria 80582
205 Ga0265327_10036134 3300031251 Bacteria 2720
206 Ga0307509_10047575 3300031507 Bacteria 4613
207 Ga0307508_10235495 3300031616 Bacteria 1429
208 Ga0307516_10284873 3300031730 Unclassified 1333
209 Ga0307412_10000045 3300031911 Bacteria 165021
210 Ga0307414_10000719 3300032004 Bacteria 16950
211 Ga0307507_10000152 3300033179 Bacteria 122095
212 Ga0373937_0166251 3300036401 Bacteria 2069
213 Ga0373925_0274380 3300037068 Unclassified 1357
214 Ga0439436_0034326 3300041404 Bacteria 1467
215 Ga0451855_0990856 3300041511 Bacteria 1348
216 Ga0451853_3693827 3300041512 Bacteria 4120
217 Ga0439431_0003228 3300041997 Bacteria 3585
218 Ga0466972_0004636 3300044658 Bacteria 6883
219 Ga0466957_0040413 3300044842 Bacteria 2817
220 Ga0466960_0015376 3300044901 Bacteria 3298
221 Ga0451576_0000002 3300045051 Bacteria 1670975
222 Ga0495638_0000121 3300046460 Bacteria 126440
223 Ga0495585_0004805 3300046492 Bacteria 8682
224 Ga0495648_0027285 3300046524 Bacteria 3825
225 Ga0495652_0115528 3300046529 Bacteria 2150
226 Ga0495633_0000032 3300046558 Bacteria 193765
227 Ga0495667_0061597 3300046559 Bacteria 2460
228 Ga0495625_0000535 3300046660 Bacteria 55840
229 Ga0495625_0002738 3300046660 Bacteria 18671
230 Ga0495625_0037512 3300046660 Bacteria 3556
231 Ga0495635_0079927 3300046663 Bacteria 2238
232 Ga0495661_0022424 3300046665 Bacteria 4108
233 Ga0495657_0268862 3300046675 Bacteria 1023
234 Ga0495658_0125832 3300046683 Bacteria 1555
235 Ga0495674_0118015 3300047319 Bacteria 2244
236 Ga0495687_000026 3300047443 Bacteria 301190
237 Ga0495684_0161833 3300047471 Bacteria 1669
238 Ga0495614_0003726 3300048089 Bacteria 6846
239 Ga0501034_0307643 3300049571 Bacteria 1520
240 Ga0501043_0032101 3300049579 Bacteria 4128
241 Ga0501223_001024 3300049663 Bacteria 6604
242 Ga0501219_000297 3300049703 Bacteria 8775
243 Ga0501225_0002255 3300049705 Bacteria 5962
244 Ga0501264_000876 3300049761 Bacteria 3853
245 Ga0501269_003831 3300049766 Bacteria 1807
246 Ga0501044_0048785 3300049823 Bacteria 4372
247 Ga0501284_00001 3300050005 Bacteria 261916
248 nmdc:mga0k408_24203_c1 3300050493 Bacteria 3431
249 nmdc:mga0k408_474_c1 3300050493 Bacteria 21998
250 nmdc:mga08y16_253291_c1 3300050511 Bacteria 1819
251 Ga0500578_0000144 3300053086 Bacteria 85335
252 Ga0500651_0000270 3300053093 Bacteria 30733
253 Ga0500614_046908 3300053123 Bacteria 1120
254 Ga0500655_013619 3300053133 Bacteria 1485
255 Ga0500559_0005253 3300053136 Bacteria 5971
256 Ga0500568_0036876 3300053139 Bacteria 1987
257 Ga0500604_0003567 3300053151 Bacteria 4186
258 Ga0500616_0000004 3300053153 Bacteria 1002714
259 Ga0500616_0000009 3300053153 Bacteria 779095
260 Ga0500616_0013552 3300053153 Bacteria 4727
261 Ga0500622_0000034 3300053156 Bacteria 187647
262 Ga0500622_0001299 3300053156 Bacteria 20281
263 Ga0500636_0098750 3300053177 Bacteria 1663
264 Ga0500645_050794 3300053730 Bacteria 1210
265 Ga0500661_002228 3300055283 Bacteria 3662

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049579 Ga0501043_0032101 Ga0501043_0032101_49_858 268
2 3300025921 Ga0207652_10025915 Ga0207652_100259157 288
3 3300003323 rootH1_10047131 rootH1_100471314 298
4 3300053086 Ga0500578_0000144 Ga0500578_0000144_71192_72169 299
5 3300013307 Ga0157372_10026776 Ga0157372_100267766 300
6 3300049705 Ga0501225_0002255 Ga0501225_0002255_1949_2884 300
7 3300005841 Ga0068863_100200180 Ga0068863_1002001802 301
8 3300045051 Ga0451576_0000002 Ga0451576_0000002_710534_711517 301
9 3300053151 Ga0500604_0003567 Ga0500604_0003567_2721_3707 302
10 3300053156 Ga0500622_0000034 Ga0500622_0000034_175346_176332 302
11 3300053156 Ga0500622_0001299 Ga0500622_0001299_14513_15499 302
12 3300006844 Ga0075428_100395125 Ga0075428_1003951251 304
13 3300003316 rootH1_10033439 rootH1_1003343920 305
14 3300003322 rootL2_10068274 rootL2_100682749 305
15 3300003323 rootH1_10008264 rootH1_1000826449 305
16 3300010375 Ga0105239_10014159 Ga0105239_100141592 305
17 3300053133 Ga0500655_013619 Ga0500655_013619_162_1148 305
18 3300028794 Ga0307515_10154983 Ga0307515_101549832 306
19 3300005614 Ga0068856_100049815 Ga0068856_1000498155 307
20 3300026078 Ga0207702_10020296 Ga0207702_100202965 307
21 3300013307 Ga0157372_10063605 Ga0157372_100636052 308
22 3300005617 Ga0068859_100001069 Ga0068859_1000010693 311
23 3300006195 Ga0075366_10104126 Ga0075366_101041262 311
24 3300006931 Ga0097620_100001069 Ga0097620_10000106927 311
25 3300013306 Ga0163162_10021216 Ga0163162_100212163 311
26 3300014969 Ga0157376_10012444 Ga0157376_100124445 311
27 3300025925 Ga0207650_10271096 Ga0207650_102710961 311
28 3300046675 Ga0495657_0268862 Ga0495657_0268862_22_960 311
29 3300025941 Ga0207711_10079239 Ga0207711_100792393 312
30 3300049663 Ga0501223_001024 Ga0501223_001024_3625_4605 312
31 3300031251 Ga0265327_10000254 Ga0265327_1000025460 313
32 3300005614 Ga0068856_100000031 Ga0068856_10000003135 315
33 3300026078 Ga0207702_10000071 Ga0207702_1000007136 315
34 3300005563 Ga0068855_100013183 Ga0068855_1000131838 316
35 3300010375 Ga0105239_10003136 Ga0105239_100031364 316
36 3300025949 Ga0207667_10027149 Ga0207667_100271492 316
37 iso_pu_bacteria 2896109856 2896111976 317
38 3300014326 Ga0157380_10041646 Ga0157380_100416462 320
39 iso_pu_bacteria 2738543023 2739300672 320
40 3300003316 rootH1_10143439 rootH1_101434391 321
41 3300003320 rootH2_10034584 rootH2_1003458412 321
42 3300031251 Ga0265327_10000405 Ga0265327_1000040547 321
43 iso_pu_bacteria 2522125168 2522550459 321
44 iso_pu_bacteria 2585428060 2587746726 321
45 iso_pu_bacteria 2588253712 2588445036 321
46 iso_pu_bacteria 2775506987 2776613765 321
47 iso_pu_bacteria 2929921140 2929923691 321
48 3300033179 Ga0307507_10000152 Ga0307507_1000015264 322
49 3300044842 Ga0466957_0040413 Ga0466957_0040413_134_1105 322
50 3300046529 Ga0495652_0115528 Ga0495652_0115528_38_1009 322
51 3300046559 Ga0495667_0061597 Ga0495667_0061597_951_1940 322
52 3300049823 Ga0501044_0048785 Ga0501044_0048785_3258_4229 322
53 3300005578 Ga0068854_100086286 Ga0068854_1000862861 323
54 3300041511 Ga0451855_0990856 Ga0451855_0990856_133_1224 323
55 3300041512 Ga0451853_3693827 Ga0451853_3693827_1936_3027 323
56 3300044901 Ga0466960_0015376 Ga0466960_0015376_117_1103 323
57 3300049703 Ga0501219_000297 Ga0501219_000297_7068_8054 323
58 3300050005 Ga0501284_00001 Ga0501284_00001_163627_164613 323
59 3300053136 Ga0500559_0005253 Ga0500559_0005253_827_1870 323
60 3300053177 Ga0500636_0098750 Ga0500636_0098750_93_1079 323
61 3300055283 Ga0500661_002228 Ga0500661_002228_1579_2694 323
62 3300003320 rootH2_10006334 rootH2_100063349 324
63 3300003320 rootH2_10181410 rootH2_101814101 324
64 3300003322 rootL2_10194323 rootL2_101943231 324
65 3300005614 Ga0068856_100161487 Ga0068856_1001614872 324
66 3300009093 Ga0105240_10000723 Ga0105240_1000072320 324
67 3300009093 Ga0105240_10036668 Ga0105240_100366683 324
68 3300009174 Ga0105241_10000516 Ga0105241_1000051630 324
69 3300009545 Ga0105237_10026056 Ga0105237_100260563 324
70 3300009545 Ga0105237_10035299 Ga0105237_100352994 324
71 3300009551 Ga0105238_10000678 Ga0105238_1000067812 324
72 3300010375 Ga0105239_10003456 Ga0105239_1000345613 324
73 3300010375 Ga0105239_10100590 Ga0105239_101005902 324
74 3300013307 Ga0157372_10007957 Ga0157372_1000795710 324
75 3300014326 Ga0157380_10000027 Ga0157380_1000002729 324
76 3300025904 Ga0207647_10031791 Ga0207647_100317913 324
77 3300025911 Ga0207654_10003830 Ga0207654_100038306 324
78 3300025913 Ga0207695_10000648 Ga0207695_1000064832 324
79 3300025913 Ga0207695_10081023 Ga0207695_100810233 324
80 3300025914 Ga0207671_10015081 Ga0207671_100150813 324
81 3300025914 Ga0207671_10073108 Ga0207671_100731083 324
82 3300026078 Ga0207702_10260911 Ga0207702_102609112 324
83 3300026142 Ga0207698_10051867 Ga0207698_100518672 324
84 3300031251 Ga0265327_10036134 Ga0265327_100361343 324
85 3300044658 Ga0466972_0004636 Ga0466972_0004636_4050_5027 324
86 3300053153 Ga0500616_0000009 Ga0500616_0000009_94009_94989 324
87 3300053153 Ga0500616_0013552 Ga0500616_0013552_484_1458 324
88 3300053730 Ga0500645_050794 Ga0500645_050794_163_1158 324
89 2162886007 SwRhRL2b_contig_2922140 SwRhRL2b_0557.00006640 325
90 3300002738 JGI25154J39366_1000014 JGI25154J39366_1000014113 325
91 3300002741 JGI25157J39369_1004338 JGI25157J39369_10043382 325
92 3300003215 JGI25153J46596_10013231 JGI25153J46596_100132314 325
93 3300003316 rootH1_10029986 rootH1_100299862 325
94 3300003320 rootH2_10096712 rootH2_100967122 325
95 3300003323 rootH1_10102527 rootH1_101025274 325
96 3300003323 rootH1_10276905 rootH1_102769051 325
97 3300003354 JGI25160J50197_1003463 JGI25160J50197_10034636 325
98 3300005288 Ga0065714_10004016 Ga0065714_100040167 325
99 3300005289 Ga0065704_10000229 Ga0065704_1000022972 325
100 3300005289 Ga0065704_10070574 Ga0065704_100705747 325
101 3300005327 Ga0070658_10059406 Ga0070658_100594063 325
102 3300005327 Ga0070658_10112175 Ga0070658_101121752 325
103 3300005328 Ga0070676_10219687 Ga0070676_102196871 325
104 3300005331 Ga0070670_100036844 Ga0070670_1000368441 325
105 3300005331 Ga0070670_100037307 Ga0070670_1000373075 325
106 3300005331 Ga0070670_100307240 Ga0070670_1003072402 325
107 3300005331 Ga0070670_100340451 Ga0070670_1003404511 325
108 3300005335 Ga0070666_10033602 Ga0070666_100336023 325
109 3300005335 Ga0070666_10038964 Ga0070666_100389643 325
110 3300005337 Ga0070682_100276693 Ga0070682_1002766931 325
111 3300005338 Ga0068868_100155346 Ga0068868_1001553462 325
112 3300005340 Ga0070689_100175600 Ga0070689_1001756001 325
113 3300005353 Ga0070669_100283595 Ga0070669_1002835951 325
114 3300005354 Ga0070675_100010590 Ga0070675_1000105908 325
115 3300005355 Ga0070671_100204615 Ga0070671_1002046152 325
116 3300005364 Ga0070673_100252281 Ga0070673_1002522811 325
117 3300005364 Ga0070673_100256035 Ga0070673_1002560351 325
118 3300005364 Ga0070673_100367101 Ga0070673_1003671011 325
119 3300005367 Ga0070667_100081188 Ga0070667_1000811882 325
120 3300005367 Ga0070667_100231646 Ga0070667_1002316462 325
121 3300005456 Ga0070678_100048739 Ga0070678_1000487391 325
122 3300005457 Ga0070662_100062969 Ga0070662_1000629693 325
123 3300005539 Ga0068853_100001245 Ga0068853_1000012454 325
124 3300005543 Ga0070672_100067740 Ga0070672_1000677402 325
125 3300005548 Ga0070665_100008203 Ga0070665_1000082038 325
126 3300005548 Ga0070665_100118344 Ga0070665_1001183442 325
127 3300005548 Ga0070665_100387310 Ga0070665_1003873102 325
128 3300005618 Ga0068864_100104123 Ga0068864_1001041232 325
129 3300005618 Ga0068864_100182072 Ga0068864_1001820722 325
130 3300005718 Ga0068866_10015301 Ga0068866_100153012 325
131 3300005719 Ga0068861_100150076 Ga0068861_1001500762 325
132 3300005834 Ga0068851_10000140 Ga0068851_1000014017 325
133 3300005840 Ga0068870_10026774 Ga0068870_100267743 325
134 3300005841 Ga0068863_100003354 Ga0068863_1000033546 325
135 3300005841 Ga0068863_100023318 Ga0068863_1000233182 325
136 3300005841 Ga0068863_100076530 Ga0068863_1000765302 325
137 3300005843 Ga0068860_100070948 Ga0068860_1000709482 325
138 3300005843 Ga0068860_100632118 Ga0068860_1006321181 325
139 3300006195 Ga0075366_10018099 Ga0075366_100180992 325
140 3300006237 Ga0097621_100040412 Ga0097621_1000404124 325
141 3300006237 Ga0097621_100073822 Ga0097621_1000738224 325
142 3300006237 Ga0097621_100125737 Ga0097621_1001257372 325
143 3300006237 Ga0097621_100173127 Ga0097621_1001731272 325
144 3300006358 Ga0068871_100155366 Ga0068871_1001553662 325
145 3300009093 Ga0105240_10000208 Ga0105240_1000020834 325
146 3300009093 Ga0105240_10000225 Ga0105240_1000022543 325
147 3300009093 Ga0105240_10039894 Ga0105240_100398944 325
148 3300009093 Ga0105240_10080274 Ga0105240_100802742 325
149 3300009094 Ga0111539_10074105 Ga0111539_100741053 325
150 3300009094 Ga0111539_10437695 Ga0111539_104376952 325
151 3300009101 Ga0105247_10118726 Ga0105247_101187261 325
152 3300009176 Ga0105242_10009462 Ga0105242_100094625 325
153 3300009176 Ga0105242_10014379 Ga0105242_100143797 325
154 3300009545 Ga0105237_10076335 Ga0105237_100763352 325
155 3300009545 Ga0105237_10119771 Ga0105237_101197712 325
156 3300009545 Ga0105237_10175145 Ga0105237_101751452 325
157 3300009545 Ga0105237_10662518 Ga0105237_106625181 325
158 3300009551 Ga0105238_10164600 Ga0105238_101646002 325
159 3300009551 Ga0105238_10313023 Ga0105238_103130232 325
160 3300009553 Ga0105249_10051577 Ga0105249_100515773 325
161 3300009553 Ga0105249_10354321 Ga0105249_103543212 325
162 3300010375 Ga0105239_10002897 Ga0105239_100028978 325
163 3300010375 Ga0105239_10050829 Ga0105239_100508292 325
164 3300010375 Ga0105239_10062051 Ga0105239_100620514 325
165 3300010375 Ga0105239_10196397 Ga0105239_101963972 325
166 3300011119 Ga0105246_10214279 Ga0105246_102142792 325
167 3300013100 Ga0157373_10000406 Ga0157373_1000040628 325
168 3300013102 Ga0157371_10002696 Ga0157371_100026965 325
169 3300013104 Ga0157370_10013118 Ga0157370_100131189 325
170 3300013104 Ga0157370_10128732 Ga0157370_101287322 325
171 3300013296 Ga0157374_10000013 Ga0157374_1000001326 325
172 3300013297 Ga0157378_10010603 Ga0157378_100106034 325
173 3300013297 Ga0157378_10093214 Ga0157378_100932143 325
174 3300013297 Ga0157378_10389770 Ga0157378_103897701 325
175 3300013306 Ga0163162_10133462 Ga0163162_101334623 325
176 3300013306 Ga0163162_10190693 Ga0163162_101906932 325
177 3300013308 Ga0157375_10002912 Ga0157375_100029126 325
178 3300013308 Ga0157375_10281839 Ga0157375_102818392 325
179 3300014325 Ga0163163_10023633 Ga0163163_100236332 325
180 3300014325 Ga0163163_10097737 Ga0163163_100977373 325
181 3300014968 Ga0157379_10514606 Ga0157379_105146061 325
182 3300014969 Ga0157376_10038722 Ga0157376_100387224 325
183 3300014969 Ga0157376_10056466 Ga0157376_100564663 325
184 3300017792 Ga0163161_10047215 Ga0163161_100472152 325
185 3300025208 Ga0209436_100816 Ga0209436_1008169 325
186 3300025246 Ga0209646_1000002 Ga0209646_10000021012 325
187 3300025250 Ga0209026_1001201 Ga0209026_10012016 325
188 3300025284 Ga0209130_1002016 Ga0209130_10020169 325
189 3300025298 Ga0209050_1000990 Ga0209050_100099021 325
190 3300025302 Ga0207426_1000073 Ga0207426_100007353 325
191 3300025321 Ga0207656_10000258 Ga0207656_100002582 325
192 3300025321 Ga0207656_10031415 Ga0207656_100314152 325
193 3300025893 Ga0207682_10022668 Ga0207682_100226682 325
194 3300025903 Ga0207680_10004310 Ga0207680_100043103 325
195 3300025904 Ga0207647_10000717 Ga0207647_1000071715 325
196 3300025907 Ga0207645_10015785 Ga0207645_100157852 325
197 3300025907 Ga0207645_10029103 Ga0207645_100291034 325
198 3300025908 Ga0207643_10007039 Ga0207643_100070394 325
199 3300025909 Ga0207705_10088925 Ga0207705_100889252 325
200 3300025913 Ga0207695_10000257 Ga0207695_1000025751 325
201 3300025913 Ga0207695_10000643 Ga0207695_1000064316 325
202 3300025913 Ga0207695_10010126 Ga0207695_100101267 325
203 3300025913 Ga0207695_10020383 Ga0207695_100203833 325
204 3300025914 Ga0207671_10175044 Ga0207671_101750441 325
205 3300025918 Ga0207662_10070079 Ga0207662_100700792 325
206 3300025923 Ga0207681_10196282 Ga0207681_101962821 325
207 3300025925 Ga0207650_10006283 Ga0207650_100062836 325
208 3300025925 Ga0207650_10026434 Ga0207650_100264342 325
209 3300025926 Ga0207659_10037395 Ga0207659_100373953 325
210 3300025933 Ga0207706_10055159 Ga0207706_100551594 325
211 3300025934 Ga0207686_10001307 Ga0207686_1000130711 325
212 3300025934 Ga0207686_10003874 Ga0207686_100038745 325
213 3300025937 Ga0207669_10142870 Ga0207669_101428702 325
214 3300025940 Ga0207691_10061915 Ga0207691_100619152 325
215 3300025942 Ga0207689_10013217 Ga0207689_100132173 325
216 3300025949 Ga0207667_10573802 Ga0207667_105738021 325
217 3300025960 Ga0207651_10047554 Ga0207651_100475542 325
218 3300025960 Ga0207651_10274570 Ga0207651_102745702 325
219 3300025961 Ga0207712_10040669 Ga0207712_100406692 325
220 3300025986 Ga0207658_10024927 Ga0207658_100249273 325
221 3300026023 Ga0207677_10048583 Ga0207677_100485833 325
222 3300026041 Ga0207639_10003540 Ga0207639_100035404 325
223 3300026075 Ga0207708_10099251 Ga0207708_100992513 325
224 3300026078 Ga0207702_10043821 Ga0207702_100438211 325
225 3300026088 Ga0207641_10000422 Ga0207641_1000042216 325
226 3300026088 Ga0207641_10014619 Ga0207641_100146192 325
227 3300026088 Ga0207641_10071665 Ga0207641_100716652 325
228 3300026089 Ga0207648_10009835 Ga0207648_100098353 325
229 3300026089 Ga0207648_10060785 Ga0207648_100607853 325
230 3300026089 Ga0207648_10127426 Ga0207648_101274262 325
231 3300026095 Ga0207676_10068043 Ga0207676_100680434 325
232 3300026095 Ga0207676_10318753 Ga0207676_103187532 325
233 3300026118 Ga0207675_100202765 Ga0207675_1002027652 325
234 3300027907 Ga0207428_10065752 Ga0207428_100657523 325
235 3300028379 Ga0268266_10004384 Ga0268266_1000438413 325
236 3300028379 Ga0268266_10144932 Ga0268266_101449322 325
237 3300028379 Ga0268266_10334565 Ga0268266_103345651 325
238 3300028794 Ga0307515_10000072 Ga0307515_10000072177 325
239 3300028794 Ga0307515_10004317 Ga0307515_100043175 325
240 3300031507 Ga0307509_10047575 Ga0307509_100475755 325
241 3300031616 Ga0307508_10235495 Ga0307508_102354951 325
242 3300031730 Ga0307516_10284873 Ga0307516_102848731 325
243 3300031911 Ga0307412_10000045 Ga0307412_1000004578 325
244 3300032004 Ga0307414_10000719 Ga0307414_100007193 325
245 3300036401 Ga0373937_0166251 Ga0373937_0166251_191_1168 325
246 3300037068 Ga0373925_0274380 Ga0373925_0274380_360_1343 325
247 3300041404 Ga0439436_0034326 Ga0439436_0034326_415_1407 325
248 3300041997 Ga0439431_0003228 Ga0439431_0003228_1686_2675 325
249 3300046460 Ga0495638_0000121 Ga0495638_0000121_118546_119523 325
250 3300046492 Ga0495585_0004805 Ga0495585_0004805_7134_8114 325
251 3300046524 Ga0495648_0027285 Ga0495648_0027285_2504_3484 325
252 3300046558 Ga0495633_0000032 Ga0495633_0000032_44738_45718 325
253 3300046660 Ga0495625_0000535 Ga0495625_0000535_6081_7061 325
254 3300046660 Ga0495625_0002738 Ga0495625_0002738_8329_9309 325
255 3300046660 Ga0495625_0037512 Ga0495625_0037512_1101_2078 325
256 3300046663 Ga0495635_0079927 Ga0495635_0079927_978_1958 325
257 3300046665 Ga0495661_0022424 Ga0495661_0022424_822_1802 325
258 3300046683 Ga0495658_0125832 Ga0495658_0125832_438_1418 325
259 3300047319 Ga0495674_0118015 Ga0495674_0118015_604_1584 325
260 3300047443 Ga0495687_000026 Ga0495687_000026_299455_300489 325
261 3300047471 Ga0495684_0161833 Ga0495684_0161833_578_1558 325
262 3300048089 Ga0495614_0003726 Ga0495614_0003726_3615_4595 325
263 3300049571 Ga0501034_0307643 Ga0501034_0307643_422_1417 325
264 3300049761 Ga0501264_000876 Ga0501264_000876_1299_2285 325
265 3300049766 Ga0501269_003831 Ga0501269_003831_225_1208 325
266 3300050493 nmdc:mga0k408_24203_c1 nmdc:mga0k408_24203_c1_426_1406 325
267 3300050493 nmdc:mga0k408_474_c1 nmdc:mga0k408_474_c1_9900_10880 325
268 3300050511 nmdc:mga08y16_253291_c1 nmdc:mga08y16_253291_c1_670_1647 325
269 3300053093 Ga0500651_0000270 Ga0500651_0000270_19102_20079 325
270 3300053123 Ga0500614_046908 Ga0500614_046908_49_1029 325
271 3300053139 Ga0500568_0036876 Ga0500568_0036876_134_1144 325
272 3300053153 Ga0500616_0000004 Ga0500616_0000004_730511_731488 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

286

365

0.97

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

273

314

0.97

PF01965

DJ-1_PfpI

DJ-1/PfpI family

46

194

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.9381 215 325
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9353 215 318
3oou-assembly1.cif.gz_A the structure of a protein with unkown function from listeria innocua 0.9111 215 318
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9075 216 315
3mn2-assembly2.cif.gz_B the crystal structure of a probable arac family transcriptional regulator from rhodopseudomonas palustris cga009 0.9073 215 320
ID Description Score Start End Superfamily
af_P0A9E0_176_235_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9585 215 271 1.10.10.60
af_P09377_170_274_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9571 215 317 1.10.10.60
af_P31449_179_288_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9551 217 318 1.10.10.60
af_P32677_219_275_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.948 267 318 1.10.10.60
3oouA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9447 271 318 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A239B962-F1-model_v4 Transcriptional regulator, AraC family 0.976 217 318 GO:0003700
GO:0043565
AF-A0A1X7LGY3-F1-model_v4 AraC family transcriptional regulator, regulatory protein of adaptative response / methylphosphotriester-DNA alkyltransferase methyltransferase 0.9742 216 317 GO:0003700
GO:0006281
GO:0008168
GO:0008270
GO:0032259
GO:0043565
AF-A0A069SXS9-F1-model_v4 deleted 0.9713 224 318
AF-A0A090VT83-F1-model_v4 Transcriptional regulator 0.9683 226 315 GO:0003700
GO:0043565
AF-A0A536L2X9-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9645 217 318 GO:0003700
GO:0043565

Feature Viewer

pLDDT pTM Quality
88.29 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map