F378740

General Info

Members Datasets Scaffolds Average Seq Length
272 179 544 276

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2937843397|2937847143
Length 313
Sequence LEGRVANGVSRVGSSMPSTADGTPPGRSPSAFGHPPLEGEGHTSHAYVTLVTNADYAMGATALVRSLKLTGTTADLVVMHTGGASVDELKPLEDLGAKLVEAALLPTSDAFNARHGRGNIHGQNPFTKGRKPHFHTPLDNFAKLRLWQLEEYDACVFIDADAVVLRNIDRLFLYPEFSAAPNVYESLADFHRLNSGVFVARPSQETFARMLDALDAPEAFWKRTDQTFLQSFFPEWHGLPVFFNMLQYVWFNLPELWDWASVSVVHYQYEKPWEENHPKAERLRPLIELWRAYYNGEAIPDIDALPNPTIKAG

Samples

Sample ID Description Type Environment
1 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
26 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
29 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
30 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
31 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
32 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
33 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
34 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
37 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
39 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
41 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
52 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
53 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
54 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
55 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
56 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
57 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
58 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
59 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
60 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
61 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
62 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
63 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
64 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
65 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
66 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
67 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
68 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
69 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
70 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
71 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
72 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
73 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
74 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
75 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
76 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
77 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
78 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
79 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
80 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
81 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
82 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
83 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
91 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
92 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
93 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
94 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
95 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
96 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
97 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
98 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
99 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
101 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
102 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
103 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
104 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
105 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
106 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
107 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
108 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
109 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
110 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
111 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
112 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
113 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
114 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
115 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
116 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
117 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
118 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
119 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
120 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
121 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
122 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
123 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
124 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
125 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
126 2643221557 Ensifer sp. Root558 Isolate Unclassified
127 2643221610 Ensifer sp. Root74 Isolate Unclassified
128 2643221618 Ensifer sp. Root231 Isolate Unclassified
129 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
130 2643221655 Ensifer sp. Root1252 Isolate Unclassified
131 2643221668 Ensifer sp. Root423 Isolate Unclassified
132 2643221675 Ensifer sp. Root1298 Isolate Unclassified
133 2643221680 Ensifer sp. Root1312 Isolate Unclassified
134 2643221712 Ensifer sp. Root258 Isolate Unclassified
135 2643221726 Ensifer sp. Root954 Isolate Unclassified
136 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
137 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
138 2738541293 Rhizobium sp. GV031 Isolate Unclassified
139 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
140 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
141 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
142 2791355260 Rhizobium sp. L9 Isolate Nodule
143 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
144 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
145 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
146 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
147 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
148 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
149 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
150 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
151 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
152 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
153 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
154 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
155 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
156 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
157 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
158 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
159 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
160 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
161 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
162 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
163 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
164 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
165 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
166 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
167 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
168 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
169 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
170 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
171 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
172 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
173 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
174 8005382845 Rhizobium sp. R634 Isolate Nodule
175 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
176 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
177 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
178 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
179 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.63
Metatranscriptomes 0
Isolates 25.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.88
Nodule 7.72
Rhizoplane 1.47
Rhizosphere 35.29
Stem 0
Stem Tuber 0.37
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001615 3300002773 Bacteria 9426
2 JGI25152J39213_1002896 3300002773 Bacteria 6124
3 JGI25152J39213_1002942 3300002773 Bacteria 6065
4 JGI25152J39213_1002949 3300002773 Bacteria 6055
5 JGI25150J39212_1000456 3300002774 Bacteria 17986
6 JGI25159J45721_1003715 3300002987 Bacteria 5292
7 JGI25151J46595_10000031 3300003187 Bacteria 197865
8 JGI25151J46595_10006064 3300003187 Bacteria 6148
9 JGI25151J46595_10006795 3300003187 Bacteria 5695
10 JGI25153J46596_10003264 3300003215 Bacteria 9119
11 JGI25153J46596_10006184 3300003215 Bacteria 6124
12 JGI25153J46596_10006287 3300003215 Bacteria 6055
13 JGI25153J46596_10014604 3300003215 Bacteria 3253
14 rootL2_10292081 3300003322 Bacteria 2570
15 rootH1_10003032 3300003323 Bacteria 1907
16 rootH1_10223117 3300003323 Bacteria 1162
17 JGI25160J50197_1011643 3300003354 Bacteria 3102
18 JGI25161J50226_1000104 3300003374 Bacteria 67942
19 JGI25161J50226_1000396 3300003374 Bacteria 21728
20 Ga0055526_1003218 3300003771 Bacteria 10527
21 Ga0055526_1014051 3300003771 Bacteria 3327
22 Ga0055524_1001018 3300003775 Bacteria 17359
23 Ga0055524_1002189 3300003775 Bacteria 10270
24 Ga0055524_1003691 3300003775 Bacteria 7328
25 Ga0055524_1009980 3300003775 Bacteria 3815
26 Ga0055524_1019819 3300003775 Bacteria 2286
27 Ga0055534_1000347 3300003784 Bacteria 29712
28 Ga0055528_1000176 3300003790 Bacteria 54005
29 Ga0055528_1001761 3300003790 Bacteria 12455
30 Ga0055528_1003686 3300003790 Bacteria 7596
31 Ga0055540_1030732 3300003792 Bacteria 1242
32 Ga0055543_1000280 3300004625 Bacteria 37509
33 Ga0065165_1002557 3300005262 Bacteria 15059
34 Ga0065165_1011641 3300005262 Bacteria 3644
35 Ga0065165_1031675 3300005262 Bacteria 1668
36 Ga0070670_100000108 3300005331 Bacteria 77575
37 Ga0070669_100018808 3300005353 Bacteria 4939
38 Ga0070671_100017297 3300005355 Bacteria 5838
39 Ga0070667_100394286 3300005367 Bacteria 1259
40 Ga0070663_100004996 3300005455 Bacteria 7834
41 Ga0070663_100037471 3300005455 Bacteria 3376
42 Ga0070662_100133398 3300005457 Bacteria 1918
43 Ga0070665_100273104 3300005548 Bacteria 1692
44 Ga0068855_100647694 3300005563 Bacteria 1135
45 Ga0079104_1000015 3300006946 Bacteria 321803
46 Ga0105251_10006623 3300009011 Bacteria 7334
47 Ga0105248_10393073 3300009177 Bacteria 1561
48 Ga0157314_1001023 3300012500 Bacteria 2193
49 Ga0209436_100023 3300025208 Bacteria 96401
50 Ga0209436_100027 3300025208 Bacteria 87534
51 Ga0207425_1000058 3300025245 Bacteria 149214
52 Ga0207425_1002292 3300025245 Bacteria 6876
53 Ga0207425_1008941 3300025245 Bacteria 2523
54 Ga0209129_1000107 3300025258 Bacteria 154705
55 Ga0209129_1000242 3300025258 Bacteria 58534
56 Ga0209129_1000714 3300025258 Bacteria 21436
57 Ga0209129_1001351 3300025258 Bacteria 13854
58 Ga0209129_1002248 3300025258 Bacteria 9644
59 Ga0209129_1003216 3300025258 Bacteria 7288
60 Ga0209673_1000781 3300025273 Bacteria 42606
61 Ga0209673_1001374 3300025273 Bacteria 23942
62 Ga0209673_1004444 3300025273 Bacteria 7508
63 Ga0209130_1000173 3300025284 Bacteria 92248
64 Ga0209130_1003293 3300025284 Bacteria 7007
65 Ga0209675_1000286 3300025291 Bacteria 47873
66 Ga0209676_1000866 3300025292 Bacteria 38931
67 Ga0209025_1000083 3300025294 Bacteria 265556
68 Ga0209025_1004678 3300025294 Bacteria 11692
69 Ga0209025_1006972 3300025294 Bacteria 8579
70 Ga0209025_1007469 3300025294 Bacteria 8128
71 Ga0209025_1010821 3300025294 Bacteria 6120
72 Ga0209025_1036275 3300025294 Bacteria 2211
73 Ga0209564_1001273 3300025295 Bacteria 27736
74 Ga0209564_1015694 3300025295 Bacteria 3064
75 Ga0209564_1020726 3300025295 Bacteria 2396
76 Ga0209758_1000090 3300025297 Bacteria 246564
77 Ga0209758_1000928 3300025297 Bacteria 39646
78 Ga0209758_1001059 3300025297 Bacteria 35937
79 Ga0209758_1001969 3300025297 Bacteria 22184
80 Ga0209758_1039622 3300025297 Bacteria 1790
81 Ga0209758_1071857 3300025297 Bacteria 1085
82 Ga0209256_1000276 3300025299 Bacteria 89888
83 Ga0209256_1001891 3300025299 Bacteria 19189
84 Ga0209256_1002912 3300025299 Bacteria 12900
85 Ga0209256_1010603 3300025299 Bacteria 3830
86 Ga0207426_1000047 3300025302 Bacteria 417011
87 Ga0207426_1007738 3300025302 Bacteria 4457
88 Ga0209051_1000930 3300025303 Bacteria 29014
89 Ga0209051_1002526 3300025303 Bacteria 12962
90 Ga0209051_1011389 3300025303 Bacteria 4394
91 Ga0209257_1005519 3300025304 Bacteria 8819
92 Ga0207681_10025049 3300025923 Bacteria 3834
93 Ga0207650_10000316 3300025925 Bacteria 47420
94 Ga0207690_10137184 3300025932 Bacteria 1797
95 Ga0207658_10327370 3300025986 Bacteria 1328
96 Ga0207678_10035813 3300026067 Bacteria 4321
97 Ga0207678_10202345 3300026067 Bacteria 1698
98 Ga0209281_1000068 3300027111 Bacteria 280238
99 Ga0268266_10116100 3300028379 Bacteria 2377
100 Ga0268265_10205542 3300028380 Bacteria 1712
101 Ga0316576_10005724 3300031727 Bacteria 7646
102 Ga0316576_10372473 3300031727 Bacteria 1061
103 Ga0307412_10001366 3300031911 Bacteria 13566
104 Ga0439465_0027603 3300041413 Bacteria 1798
105 Ga0439465_0032998 3300041413 Bacteria 1654
106 Ga0439465_0046490 3300041413 Bacteria 1413
107 Ga0439435_0014546 3300042436 Bacteria 1945
108 Ga0466965_0082295 3300044683 Bacteria 1628
109 Ga0495592_0077817 3300046454 Bacteria 2403
110 Ga0495662_0011870 3300046476 Bacteria 4259
111 Ga0495607_0031525 3300046501 Bacteria 3245
112 Ga0495606_0134164 3300046507 Bacteria 1468
113 Ga0495610_0004893 3300046512 Bacteria 9734
114 Ga0495610_0098913 3300046512 Bacteria 1310
115 Ga0495643_0032151 3300046522 Bacteria 2915
116 Ga0495640_0195615 3300046533 Bacteria 1284
117 Ga0495587_0033034 3300046536 Bacteria 3125
118 Ga0495588_0033065 3300046674 Bacteria 2610
119 Ga0495658_0005340 3300046683 Bacteria 6319
120 Ga0495604_0075163 3300047317 Bacteria 2544
121 Ga0495673_0057690 3300047469 Bacteria 1676
122 Ga0495686_0007518 3300047472 Bacteria 8160
123 Ga0496106_0108751 3300048909 Bacteria 2156
124 Ga0496110_0192859 3300048913 Bacteria 1850
125 Ga0496111_0076996 3300048914 Bacteria 2432
126 Ga0496116_0018241 3300048919 Bacteria 5417
127 Ga0496116_0019107 3300048919 Bacteria 5257
128 Ga0496116_0023544 3300048919 Bacteria 4584
129 Ga0496116_0024966 3300048919 Bacteria 4404
130 Ga0496117_0037883 3300048920 Bacteria 3585
131 Ga0496117_0051692 3300048920 Bacteria 2902
132 Ga0496118_0012603 3300048921 Bacteria 8092
133 Ga0496118_0020398 3300048921 Bacteria 5877
134 Ga0496118_0033646 3300048921 Bacteria 4201
135 Ga0496119_0080954 3300048922 Bacteria 1872
136 Ga0496121_0014793 3300048924 Bacteria 8243
137 Ga0496121_0063481 3300048924 Bacteria 3017
138 Ga0496121_0095224 3300048924 Bacteria 2314
139 Ga0496121_0152600 3300048924 Bacteria 1698
140 Ga0496121_0213907 3300048924 Bacteria 1363
141 Ga0496121_0313391 3300048924 Bacteria 1059
142 Ga0496122_0000042 3300048925 Bacteria 280482
143 Ga0496122_0022309 3300048925 Bacteria 5633
144 Ga0496122_0023714 3300048925 Bacteria 5394
145 Ga0496122_0054415 3300048925 Bacteria 3006
146 Ga0496122_0055696 3300048925 Bacteria 2955
147 Ga0496123_0000030 3300048926 Bacteria 291764
148 Ga0496123_0009194 3300048926 Bacteria 8930
149 Ga0496123_0033116 3300048926 Bacteria 3725
150 Ga0496124_0010430 3300048927 Bacteria 9405
151 Ga0496124_0025437 3300048927 Bacteria 5361
152 Ga0496124_0025740 3300048927 Bacteria 5321
153 Ga0496124_0048013 3300048927 Bacteria 3650
154 Ga0496124_0067402 3300048927 Bacteria 2978
155 Ga0496124_0216340 3300048927 Bacteria 1445
156 Ga0496125_0019067 3300048928 Bacteria 6489
157 Ga0496125_0051450 3300048928 Bacteria 3397
158 Ga0496125_0181081 3300048928 Bacteria 1404
159 Ga0496126_0288041 3300048929 Bacteria 1359
160 Ga0496126_0438065 3300048929 Bacteria 1054
161 Ga0495678_039497 3300049459 Bacteria 1903
162 Ga0501032_0056130 3300049569 Bacteria 2648
163 Ga0501032_0080463 3300049569 Bacteria 2168
164 Ga0501033_0004437 3300049570 Bacteria 11224
165 Ga0501036_0155341 3300049572 Bacteria 1930
166 Ga0501036_0156315 3300049572 Bacteria 1923
167 Ga0501037_0000274 3300049573 Bacteria 44054
168 Ga0501037_0191435 3300049573 Bacteria 1448
169 Ga0501037_0262386 3300049573 Bacteria 1207
170 Ga0501041_0202112 3300049577 Bacteria 1246
171 Ga0501043_0000008 3300049579 Bacteria 223654
172 Ga0501043_0066871 3300049579 Bacteria 2822
173 Ga0501047_0061606 3300049581 Bacteria 3620
174 Ga0501047_0136677 3300049581 Bacteria 2331
175 Ga0501068_0016003 3300049584 Bacteria 4320
176 Ga0501069_0000028 3300049585 Bacteria 106038
177 Ga0501070_0004350 3300049586 Bacteria 12177
178 Ga0501070_0108421 3300049586 Bacteria 2294
179 Ga0501071_0001459 3300049587 Bacteria 13705
180 Ga0501072_0462870 3300049588 Bacteria 1004
181 Ga0501073_0142405 3300049589 Bacteria 1661
182 Ga0501073_0153046 3300049589 Bacteria 1598
183 Ga0501074_0001156 3300049590 Bacteria 17272
184 Ga0501080_0000065 3300049742 Bacteria 69171
185 Ga0501080_0091728 3300049742 Bacteria 2821
186 Ga0501083_0004054 3300049744 Bacteria 10304
187 Ga0501083_0041325 3300049744 Bacteria 3127
188 Ga0501035_0000335 3300049822 Bacteria 54785
189 Ga0501035_0052759 3300049822 Bacteria 3638
190 Ga0501035_0128927 3300049822 Bacteria 2206
191 Ga0501044_0000011 3300049823 Bacteria 257385
192 Ga0501044_0417913 3300049823 Bacteria 1251
193 nmdc:mga0sz30_64016_c1 3300050516 Bacteria 1574
194 Ga0495619_0351841 3300053085 Bacteria 1019
195 Ga0500651_0142793 3300053093 Bacteria 1442
196 Ga0500618_050074 3300053125 Bacteria 946
197 Ga0500658_0003838 3300053134 Bacteria 5652
198 Ga0500568_0004963 3300053139 Bacteria 6994
199 Ga0500568_0043181 3300053139 Bacteria 1803
200 Ga0500590_034822 3300053148 Bacteria 2606
201 Ga0500622_0008211 3300053156 Bacteria 5862
202 Ga0500633_0001776 3300053160 Bacteria 4216
203 Ga0501082_0493874 3300060353 Bacteria 1070
204 2937847143 2937843397 Bacteria 5256375
205 2511200449 2510917030 Bacteria 7460662
206 2513867581 2513237138 Bacteria 7368160
207 2513908322 2513237144 Bacteria 7530820
208 2585224945 2582581298 Bacteria 7315509
209 2585227641 2582581299 Bacteria 6518058
210 2585257655 2582581304 Bacteria 5831370
211 2585403386 2582581867 Bacteria 7184437
212 2585547501 2585427529 Bacteria 7395659
213 2585823682 2585427590 Bacteria 6824633
214 2585845173 2585427594 Bacteria 6180594
215 2585997015 2585427633 Bacteria 6413184
216 2586001614 2585427634 Bacteria 6455027
217 2599722484 2599185236 Bacteria 6875203
218 2616307255 2615840626 Bacteria 7921970
219 2643804062 2643221557 Bacteria 7184309
220 2644064862 2643221610 Bacteria 7480339
221 2644108601 2643221618 Bacteria 7717186
222 2644191541 2643221634 Bacteria 6705461
223 2644312276 2643221655 Bacteria 7722067
224 2644376196 2643221668 Bacteria 7306521
225 2644416535 2643221675 Bacteria 7473456
226 2644449575 2643221680 Bacteria 7473610
227 2644617959 2643221712 Bacteria 7729434
228 2644688150 2643221726 Bacteria 7455827
229 2671694793 2671180139 Bacteria 4196045
230 2715500412 2713897090 Bacteria 3353799
231 2738800609 2738541293 Bacteria 7065685
232 2738944392 2738541317 Bacteria 5340176
233 2776914450 2775507049 Bacteria 6284736
234 2793281726 2791355253 Bacteria 5171699
235 2793319864 2791355260 Bacteria 6598818
236 2821126025 2821123053 Bacteria 7836056
237 2834580224 2834578030 Bacteria 3530182
238 2837654295 2837651117 Bacteria 3772164
239 2838671296 2838668709 Bacteria 6671819
240 2838703523 2838701080 Bacteria 6669771
241 2838737498 2838736955 Bacteria 5760694
242 2841842133 2841840854 Bacteria 5761912
243 2842141912 2842140634 Bacteria 5759631
244 2842149475 2842146304 Bacteria 5957337
245 2842253887 2842250916 Bacteria 6579627
246 2854682698 2854681122 Bacteria 4548679
247 2854920203 2854916844 Bacteria 5725939
248 2855020937 2855020534 Bacteria 3204685
249 2857532587 2857531043 Bacteria 6754041
250 2889794599 2889790730 Bacteria 5689708
251 2889919314 2889914905 Bacteria 5702301
252 2891050741 2891048133 Bacteria 4447501
253 2896386344 2896384573 Bacteria 7700774
254 2899262156 2899259804 Bacteria 3320927
255 2913309011 2913308742 Bacteria 5350706
256 2919104403 2919100787 Bacteria 7710546
257 2920760882 2920760137 Bacteria 7427611
258 2923558927 2923556063 Bacteria 6793593
259 2933018161 2933016740 Bacteria 6355406
260 2941501812 2941499720 Bacteria 7599444
261 2989773409 2989771324 Bacteria 5605128
262 3000408689 3000405567 Bacteria 3779330
263 3003934803 3003930520 Bacteria 5667563
264 3005449121 3005445848 Bacteria 6906074
265 3005455401 3005452660 Bacteria 5889319
266 643826981 643692032 Bacteria 6891900
267 8005383987 8005382845 Bacteria 6732062
268 8005547281 8005542996 Bacteria 7077758
269 8024487863 8024486573 Bacteria 6540512
270 8054558488 8054558443 Bacteria 5204801
271 8056876060 8056875544 Bacteria 4355797
272 8057135307 8057132660 Bacteria 4061191
273 JGI25152J39213_1001615
274 JGI25152J39213_1002896
275 JGI25152J39213_1002942
276 JGI25152J39213_1002949
277 JGI25150J39212_1000456
278 JGI25159J45721_1003715
279 JGI25151J46595_10000031
280 JGI25151J46595_10006064
281 JGI25151J46595_10006795
282 JGI25153J46596_10003264
283 JGI25153J46596_10006184
284 JGI25153J46596_10006287
285 JGI25153J46596_10014604
286 rootL2_10292081
287 rootH1_10003032
288 rootH1_10223117
289 JGI25160J50197_1011643
290 JGI25161J50226_1000104
291 JGI25161J50226_1000396
292 Ga0055526_1003218
293 Ga0055526_1014051
294 Ga0055524_1001018
295 Ga0055524_1002189
296 Ga0055524_1003691
297 Ga0055524_1009980
298 Ga0055524_1019819
299 Ga0055534_1000347
300 Ga0055528_1000176
301 Ga0055528_1001761
302 Ga0055528_1003686
303 Ga0055540_1030732
304 Ga0055543_1000280
305 Ga0065165_1002557
306 Ga0065165_1011641
307 Ga0065165_1031675
308 Ga0070670_100000108
309 Ga0070669_100018808
310 Ga0070671_100017297
311 Ga0070667_100394286
312 Ga0070663_100004996
313 Ga0070663_100037471
314 Ga0070662_100133398
315 Ga0070665_100273104
316 Ga0068855_100647694
317 Ga0079104_1000015
318 Ga0105251_10006623
319 Ga0105248_10393073
320 Ga0157314_1001023
321 Ga0209436_100023
322 Ga0209436_100027
323 Ga0207425_1000058
324 Ga0207425_1002292
325 Ga0207425_1008941
326 Ga0209129_1000107
327 Ga0209129_1000242
328 Ga0209129_1000714
329 Ga0209129_1001351
330 Ga0209129_1002248
331 Ga0209129_1003216
332 Ga0209673_1000781
333 Ga0209673_1001374
334 Ga0209673_1004444
335 Ga0209130_1000173
336 Ga0209130_1003293
337 Ga0209675_1000286
338 Ga0209676_1000866
339 Ga0209025_1000083
340 Ga0209025_1004678
341 Ga0209025_1006972
342 Ga0209025_1007469
343 Ga0209025_1010821
344 Ga0209025_1036275
345 Ga0209564_1001273
346 Ga0209564_1015694
347 Ga0209564_1020726
348 Ga0209758_1000090
349 Ga0209758_1000928
350 Ga0209758_1001059
351 Ga0209758_1001969
352 Ga0209758_1039622
353 Ga0209758_1071857
354 Ga0209256_1000276
355 Ga0209256_1001891
356 Ga0209256_1002912
357 Ga0209256_1010603
358 Ga0207426_1000047
359 Ga0207426_1007738
360 Ga0209051_1000930
361 Ga0209051_1002526
362 Ga0209051_1011389
363 Ga0209257_1005519
364 Ga0207681_10025049
365 Ga0207650_10000316
366 Ga0207690_10137184
367 Ga0207658_10327370
368 Ga0207678_10035813
369 Ga0207678_10202345
370 Ga0209281_1000068
371 Ga0268266_10116100
372 Ga0268265_10205542
373 Ga0316576_10005724
374 Ga0316576_10372473
375 Ga0307412_10001366
376 Ga0439465_0027603
377 Ga0439465_0032998
378 Ga0439465_0046490
379 Ga0439435_0014546
380 Ga0466965_0082295
381 Ga0495592_0077817
382 Ga0495662_0011870
383 Ga0495607_0031525
384 Ga0495606_0134164
385 Ga0495610_0004893
386 Ga0495610_0098913
387 Ga0495643_0032151
388 Ga0495640_0195615
389 Ga0495587_0033034
390 Ga0495588_0033065
391 Ga0495658_0005340
392 Ga0495604_0075163
393 Ga0495673_0057690
394 Ga0495686_0007518
395 Ga0496106_0108751
396 Ga0496110_0192859
397 Ga0496111_0076996
398 Ga0496116_0018241
399 Ga0496116_0019107
400 Ga0496116_0023544
401 Ga0496116_0024966
402 Ga0496117_0037883
403 Ga0496117_0051692
404 Ga0496118_0012603
405 Ga0496118_0020398
406 Ga0496118_0033646
407 Ga0496119_0080954
408 Ga0496121_0014793
409 Ga0496121_0063481
410 Ga0496121_0095224
411 Ga0496121_0152600
412 Ga0496121_0213907
413 Ga0496121_0313391
414 Ga0496122_0000042
415 Ga0496122_0022309
416 Ga0496122_0023714
417 Ga0496122_0054415
418 Ga0496122_0055696
419 Ga0496123_0000030
420 Ga0496123_0009194
421 Ga0496123_0033116
422 Ga0496124_0010430
423 Ga0496124_0025437
424 Ga0496124_0025740
425 Ga0496124_0048013
426 Ga0496124_0067402
427 Ga0496124_0216340
428 Ga0496125_0019067
429 Ga0496125_0051450
430 Ga0496125_0181081
431 Ga0496126_0288041
432 Ga0496126_0438065
433 Ga0495678_039497
434 Ga0501032_0056130
435 Ga0501032_0080463
436 Ga0501033_0004437
437 Ga0501036_0155341
438 Ga0501036_0156315
439 Ga0501037_0000274
440 Ga0501037_0191435
441 Ga0501037_0262386
442 Ga0501041_0202112
443 Ga0501043_0000008
444 Ga0501043_0066871
445 Ga0501047_0061606
446 Ga0501047_0136677
447 Ga0501068_0016003
448 Ga0501069_0000028
449 Ga0501070_0004350
450 Ga0501070_0108421
451 Ga0501071_0001459
452 Ga0501072_0462870
453 Ga0501073_0142405
454 Ga0501073_0153046
455 Ga0501074_0001156
456 Ga0501080_0000065
457 Ga0501080_0091728
458 Ga0501083_0004054
459 Ga0501083_0041325
460 Ga0501035_0000335
461 Ga0501035_0052759
462 Ga0501035_0128927
463 Ga0501044_0000011
464 Ga0501044_0417913
465 nmdc:mga0sz30_64016_c1
466 Ga0495619_0351841
467 Ga0500651_0142793
468 Ga0500618_050074
469 Ga0500658_0003838
470 Ga0500568_0004963
471 Ga0500568_0043181
472 Ga0500590_034822
473 Ga0500622_0008211
474 Ga0500633_0001776
475 Ga0501082_0493874
476 2937847143
477 2511200449
478 2513867581
479 2513908322
480 2585224945
481 2585227641
482 2585257655
483 2585403386
484 2585547501
485 2585823682
486 2585845173
487 2585997015
488 2586001614
489 2599722484
490 2616307255
491 2643804062
492 2644064862
493 2644108601
494 2644191541
495 2644312276
496 2644376196
497 2644416535
498 2644449575
499 2644617959
500 2644688150
501 2671694793
502 2715500412
503 2738800609
504 2738944392
505 2776914450
506 2793281726
507 2793319864
508 2821126025
509 2834580224
510 2837654295
511 2838671296
512 2838703523
513 2838737498
514 2841842133
515 2842141912
516 2842149475
517 2842253887
518 2854682698
519 2854920203
520 2855020937
521 2857532587
522 2889794599
523 2889919314
524 2891050741
525 2896386344
526 2899262156
527 2913309011
528 2919104403
529 2920760882
530 2923558927
531 2933018161
532 2941501812
533 2989773409
534 3000408689
535 3003934803
536 3005449121
537 3005455401
538 643826981
539 8005383987
540 8005547281
541 8024487863
542 8054558488
543 8056876060
544 8057135307

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01501

Glyco_transf_8

Glycosyl transferase family 8

47

277

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6eql-assembly1.cif.gz_B crystal structure of human glycogenin-1 (gyg1) tyr195piphe mutant complexed with manganese and udp 0.8262 7 257
6eql-assembly1.cif.gz_B crystal structure of human glycogenin-1 (gyg1) tyr195piphe mutant complexed with manganese and udp 0.7984 7 257
4ueg-assembly1.cif.gz_B-2 crystal structure of human glycogenin-2 catalytic domain 0.7964 7 266
3t7n-assembly1.cif.gz_B crystal structure of human glycogenin-1 (gyg1) complexed with manganese and udp, in a monoclinic closed form 0.7942 7 257
3t7n-assembly1.cif.gz_A crystal structure of human glycogenin-1 (gyg1) complexed with manganese and udp, in a monoclinic closed form 0.7922 3 258
ID Description Score Start End Superfamily
af_Q965I8_90_187_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8307 6 65 3.40.50.1100
5ybwB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8283 8 65 3.40.50.1100
6eqlB00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8262 7 257 3.90.550.10
af_B7ZZ35_27_272_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8008 7 258 3.90.550.10
6eqlB00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7984 7 257 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A418SYD7-F1-model_v4 Glycosyl transferase 0.9851 7 270 GO:0016757
AF-U3AI83-F1-model_v4 Glycogenin-1 0.9813 58 270 GO:0016757
AF-A0A5B8L2P2-F1-model_v4 Glycosyl transferase 0.9803 1 270 GO:0016757
AF-A0A222E6E3-F1-model_v4 Glycosyl transferase family 8 0.9777 11 246 GO:0016757
AF-A0A4R2PQD3-F1-model_v4 Alpha-N-acetylglucosamine transferase 0.9758 5 263 GO:0016757

Map