F378808
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 273 | 188 | 273 | 508 |
Family's Representative Sequence
| Representative Sequence | 3300005328|Ga0070676_10004351|Ga0070676_100043514 |
| Length | 524 |
| Sequence | LSGRWWDDAYQVNGALPVRRLSVTAEEWRPCASGLAAAGGRLLSLWVVPGTPDTAPALVRAAVAIASGVLVLELSVADQVRGGAAEGSTGAGNYPGLEAIFPCASRMQRAAYDLCGVRSTDPDRRPWLRHAAWPADWFPLQGAGDAQVAAGAVVDDYAFLRVQGDGVHEIPVGPVHAGIIEPGHFRFSVVGEKVLRLETRLAYTHKGIERRFAEIGLFEGHRLAARVSGDSSVAYSWAYCQALEGLAGCTVPPRAAWLRGLMLEAERIANHLGDLGALGNDAGFAFGLAQFSRLKEHWLRAIEALFGQRYLMDAIVPGGTAVNVASDVVQRFVGHAGQLAHDVCALRQIYEEHDGLRDRFATTGSVSPTLATWLGIIGLAGRASGQAHDARVDWPTPPYDDVTPAIVVRSYGDVAARIAVRFDEVLESCRLVARLAGGLPEGPSRAEVALPTAPAFGLGVVEAWRGPVLVALDAGPGNRVLRCHPHDPSWQNWPALEHAVIGNIVPDFPLINKSFNLSYSGHDL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 58 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 122 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 124 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 125 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 126 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 127 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 128 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 129 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 130 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 131 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 132 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 133 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 134 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 135 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 136 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 137 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 138 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 139 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 140 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 141 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 142 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 143 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 144 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 145 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 146 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 147 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 148 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 149 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 150 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 151 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 155 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 156 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 157 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 160 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 161 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 162 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 163 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 164 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 165 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 186 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 187 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.73 |
| Nodule | 0 |
| Rhizoplane | 4.03 |
| Rhizosphere | 92.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_365350 | 2162886007 | Bacteria | 8655 |
| 2 | Ga0065704_10000717 | 3300005289 | Bacteria | 14357 |
| 3 | Ga0070676_10004351 | 3300005328 | Bacteria | 7440 |
| 4 | Ga0070690_100006096 | 3300005330 | Bacteria | 6825 |
| 5 | Ga0070670_100016443 | 3300005331 | Bacteria | 6353 |
| 6 | Ga0068869_100004873 | 3300005334 | Bacteria | 8393 |
| 7 | Ga0070666_10007508 | 3300005335 | Bacteria | 6719 |
| 8 | Ga0070680_100000673 | 3300005336 | Bacteria | 23756 |
| 9 | Ga0070680_100027729 | 3300005336 | Bacteria | 4537 |
| 10 | Ga0070682_100010276 | 3300005337 | Bacteria | 5310 |
| 11 | Ga0068868_100004800 | 3300005338 | Bacteria | 9487 |
| 12 | Ga0068868_100055765 | 3300005338 | Bacteria | 3119 |
| 13 | Ga0070689_100000421 | 3300005340 | Bacteria | 24985 |
| 14 | Ga0070689_100026563 | 3300005340 | Bacteria | 4359 |
| 15 | Ga0070687_100014852 | 3300005343 | Bacteria | 3508 |
| 16 | Ga0070692_10020938 | 3300005345 | Bacteria | 3177 |
| 17 | Ga0070668_100018353 | 3300005347 | Bacteria | 5252 |
| 18 | Ga0070669_100002847 | 3300005353 | Bacteria | 12500 |
| 19 | Ga0070671_100005848 | 3300005355 | Bacteria | 9799 |
| 20 | Ga0070674_100003651 | 3300005356 | Bacteria | 8668 |
| 21 | Ga0070673_100147840 | 3300005364 | Bacteria | 1988 |
| 22 | Ga0070659_100110244 | 3300005366 | Bacteria | 2221 |
| 23 | Ga0070667_100041818 | 3300005367 | Bacteria | 3844 |
| 24 | Ga0070709_10001819 | 3300005434 | Bacteria | 11569 |
| 25 | Ga0070714_100001074 | 3300005435 | Bacteria | 19541 |
| 26 | Ga0070701_10005050 | 3300005438 | Bacteria | 5416 |
| 27 | Ga0070711_100027417 | 3300005439 | Bacteria | 3739 |
| 28 | Ga0070705_100004895 | 3300005440 | Bacteria | 6523 |
| 29 | Ga0070700_100071223 | 3300005441 | Bacteria | 2219 |
| 30 | Ga0070678_100079555 | 3300005456 | Bacteria | 2480 |
| 31 | Ga0070662_100005104 | 3300005457 | Bacteria | 8367 |
| 32 | Ga0070662_100031204 | 3300005457 | Bacteria | 3738 |
| 33 | Ga0070681_10002158 | 3300005458 | Bacteria | 17897 |
| 34 | Ga0070681_10002323 | 3300005458 | Bacteria | 17390 |
| 35 | Ga0070681_10011202 | 3300005458 | Bacteria | 8872 |
| 36 | Ga0070681_10011416 | 3300005458 | Bacteria | 8792 |
| 37 | Ga0068867_100005383 | 3300005459 | Bacteria | 9050 |
| 38 | Ga0070685_10021714 | 3300005466 | Bacteria | 3491 |
| 39 | Ga0070679_100002776 | 3300005530 | Bacteria | 15915 |
| 40 | Ga0070684_100008616 | 3300005535 | Bacteria | 7988 |
| 41 | Ga0070684_100031600 | 3300005535 | Bacteria | 4509 |
| 42 | Ga0070672_100010784 | 3300005543 | Bacteria | 6350 |
| 43 | Ga0070686_100017517 | 3300005544 | Bacteria | 4188 |
| 44 | Ga0070686_100037868 | 3300005544 | Bacteria | 2995 |
| 45 | Ga0070665_100001969 | 3300005548 | Bacteria | 23093 |
| 46 | Ga0070665_100007096 | 3300005548 | Bacteria | 11382 |
| 47 | Ga0070704_100058731 | 3300005549 | Bacteria | 2741 |
| 48 | Ga0068855_100002194 | 3300005563 | Bacteria | 24134 |
| 49 | Ga0068855_100005111 | 3300005563 | Bacteria | 15994 |
| 50 | Ga0070664_100012096 | 3300005564 | Bacteria | 7012 |
| 51 | Ga0068856_100014162 | 3300005614 | Bacteria | 7711 |
| 52 | Ga0068856_100055066 | 3300005614 | Bacteria | 3925 |
| 53 | Ga0070702_100000889 | 3300005615 | Bacteria | 11627 |
| 54 | Ga0068859_100006199 | 3300005617 | Bacteria | 12150 |
| 55 | Ga0068859_100039620 | 3300005617 | Bacteria | 4727 |
| 56 | Ga0068859_100051931 | 3300005617 | Bacteria | 4122 |
| 57 | Ga0068864_100001048 | 3300005618 | Bacteria | 23210 |
| 58 | Ga0068864_100005181 | 3300005618 | Bacteria | 10674 |
| 59 | Ga0068864_100043023 | 3300005618 | Bacteria | 3866 |
| 60 | Ga0068861_100008134 | 3300005719 | Bacteria | 7216 |
| 61 | Ga0068861_100008740 | 3300005719 | Bacteria | 6971 |
| 62 | Ga0068861_100060391 | 3300005719 | Bacteria | 2905 |
| 63 | Ga0068863_100001284 | 3300005841 | Bacteria | 25055 |
| 64 | Ga0068863_100014230 | 3300005841 | Bacteria | 7665 |
| 65 | Ga0068860_100008754 | 3300005843 | Bacteria | 10079 |
| 66 | Ga0068862_100003806 | 3300005844 | Bacteria | 12852 |
| 67 | Ga0068862_100065571 | 3300005844 | Bacteria | 3128 |
| 68 | Ga0068862_100104548 | 3300005844 | Bacteria | 2481 |
| 69 | Ga0070712_100182292 | 3300006175 | Bacteria | 1637 |
| 70 | Ga0068871_100062420 | 3300006358 | Bacteria | 3045 |
| 71 | Ga0075428_100001989 | 3300006844 | Bacteria | 22029 |
| 72 | Ga0075428_100002919 | 3300006844 | Bacteria | 18617 |
| 73 | Ga0075428_100058770 | 3300006844 | Bacteria | 4210 |
| 74 | Ga0075430_100006465 | 3300006846 | Bacteria | 9873 |
| 75 | Ga0075430_100031975 | 3300006846 | Bacteria | 4466 |
| 76 | Ga0075430_100033935 | 3300006846 | Bacteria | 4330 |
| 77 | Ga0075430_100058242 | 3300006846 | Bacteria | 3248 |
| 78 | Ga0075431_100000077 | 3300006847 | Bacteria | 57475 |
| 79 | Ga0075431_100009013 | 3300006847 | Bacteria | 10003 |
| 80 | Ga0075431_100025947 | 3300006847 | Bacteria | 6006 |
| 81 | Ga0075431_100131955 | 3300006847 | Bacteria | 2576 |
| 82 | Ga0075433_10022914 | 3300006852 | Bacteria | 5249 |
| 83 | Ga0075429_100002310 | 3300006880 | Bacteria | 16000 |
| 84 | Ga0075429_100056708 | 3300006880 | Bacteria | 3410 |
| 85 | Ga0075429_100113295 | 3300006880 | Bacteria | 2371 |
| 86 | Ga0068865_100058794 | 3300006881 | Bacteria | 2687 |
| 87 | Ga0097620_100006199 | 3300006931 | Bacteria | 12150 |
| 88 | Ga0097620_100039621 | 3300006931 | Bacteria | 4727 |
| 89 | Ga0097620_100051929 | 3300006931 | Bacteria | 4122 |
| 90 | Ga0099794_10026932 | 3300007265 | Bacteria | 2661 |
| 91 | Ga0099795_10000234 | 3300007788 | Bacteria | 9765 |
| 92 | Ga0105240_10000760 | 3300009093 | Bacteria | 58925 |
| 93 | Ga0105240_10002211 | 3300009093 | Bacteria | 31723 |
| 94 | Ga0105240_10003744 | 3300009093 | Bacteria | 23493 |
| 95 | Ga0105240_10006209 | 3300009093 | Bacteria | 17574 |
| 96 | Ga0105240_10055209 | 3300009093 | Bacteria | 4974 |
| 97 | Ga0105240_10143095 | 3300009093 | Bacteria | 2857 |
| 98 | Ga0111539_10000277 | 3300009094 | Bacteria | 61362 |
| 99 | Ga0105245_10028462 | 3300009098 | Bacteria | 4930 |
| 100 | Ga0105247_10002275 | 3300009101 | Bacteria | 13179 |
| 101 | Ga0105247_10008699 | 3300009101 | Bacteria | 6189 |
| 102 | Ga0114129_10013156 | 3300009147 | Bacteria | 11791 |
| 103 | Ga0105241_10055883 | 3300009174 | Bacteria | 3025 |
| 104 | Ga0105242_10026563 | 3300009176 | Bacteria | 4589 |
| 105 | Ga0105248_10005568 | 3300009177 | Bacteria | 13842 |
| 106 | Ga0105237_10006046 | 3300009545 | Bacteria | 13544 |
| 107 | Ga0105238_10002536 | 3300009551 | Bacteria | 18246 |
| 108 | Ga0105238_10037348 | 3300009551 | Bacteria | 4938 |
| 109 | Ga0099796_10009018 | 3300010159 | Bacteria | 2682 |
| 110 | Ga0105239_10047083 | 3300010375 | Bacteria | 4725 |
| 111 | Ga0105239_10061687 | 3300010375 | Bacteria | 4115 |
| 112 | Ga0105239_10086120 | 3300010375 | Bacteria | 3463 |
| 113 | Ga0105246_10001616 | 3300011119 | Bacteria | 13422 |
| 114 | Ga0157370_10003740 | 3300013104 | Bacteria | 17787 |
| 115 | Ga0157369_10185048 | 3300013105 | Bacteria | 2190 |
| 116 | Ga0157374_10005450 | 3300013296 | Bacteria | 10690 |
| 117 | Ga0157374_10156037 | 3300013296 | Bacteria | 2221 |
| 118 | Ga0163162_10055176 | 3300013306 | Bacteria | 3999 |
| 119 | Ga0157375_10103078 | 3300013308 | Bacteria | 2940 |
| 120 | Ga0163163_10001355 | 3300014325 | Bacteria | 20667 |
| 121 | Ga0163163_10004323 | 3300014325 | Bacteria | 12097 |
| 122 | Ga0157380_10006498 | 3300014326 | Bacteria | 8241 |
| 123 | Ga0157380_10093908 | 3300014326 | Bacteria | 2482 |
| 124 | Ga0157379_10013381 | 3300014968 | Bacteria | 7186 |
| 125 | Ga0157379_10193465 | 3300014968 | Bacteria | 1838 |
| 126 | Ga0157376_10048739 | 3300014969 | Bacteria | 3505 |
| 127 | Ga0207680_10016845 | 3300025903 | Bacteria | 3848 |
| 128 | Ga0207699_10004009 | 3300025906 | Bacteria | 7044 |
| 129 | Ga0207645_10000489 | 3300025907 | Bacteria | 32760 |
| 130 | Ga0207643_10005459 | 3300025908 | Bacteria | 6798 |
| 131 | Ga0207707_10000999 | 3300025912 | Bacteria | 27087 |
| 132 | Ga0207695_10004603 | 3300025913 | Bacteria | 18730 |
| 133 | Ga0207695_10011587 | 3300025913 | Bacteria | 10663 |
| 134 | Ga0207695_10117196 | 3300025913 | Bacteria | 2636 |
| 135 | Ga0207693_10005525 | 3300025915 | Bacteria | 10523 |
| 136 | Ga0207663_10051347 | 3300025916 | Bacteria | 2567 |
| 137 | Ga0207660_10004733 | 3300025917 | Bacteria | 8860 |
| 138 | Ga0207660_10038417 | 3300025917 | Bacteria | 3342 |
| 139 | Ga0207662_10003006 | 3300025918 | Bacteria | 8590 |
| 140 | Ga0207649_10021193 | 3300025920 | Bacteria | 3736 |
| 141 | Ga0207652_10007161 | 3300025921 | Bacteria | 8995 |
| 142 | Ga0207650_10013677 | 3300025925 | Bacteria | 5625 |
| 143 | Ga0207664_10004364 | 3300025929 | Bacteria | 9582 |
| 144 | Ga0207706_10000907 | 3300025933 | Bacteria | 30444 |
| 145 | Ga0207706_10000977 | 3300025933 | Bacteria | 29153 |
| 146 | Ga0207704_10053041 | 3300025938 | Bacteria | 2462 |
| 147 | Ga0207665_10033903 | 3300025939 | Bacteria | 3387 |
| 148 | Ga0207691_10004423 | 3300025940 | Bacteria | 13619 |
| 149 | Ga0207691_10076104 | 3300025940 | Bacteria | 3025 |
| 150 | Ga0207689_10003936 | 3300025942 | Bacteria | 13518 |
| 151 | Ga0207689_10138878 | 3300025942 | Bacteria | 2002 |
| 152 | Ga0207679_10004394 | 3300025945 | Bacteria | 8779 |
| 153 | Ga0207667_10001268 | 3300025949 | Bacteria | 31682 |
| 154 | Ga0207667_10003353 | 3300025949 | Bacteria | 19766 |
| 155 | Ga0207667_10080577 | 3300025949 | Bacteria | 3373 |
| 156 | Ga0207651_10040848 | 3300025960 | Bacteria | 3074 |
| 157 | Ga0207651_10047378 | 3300025960 | Bacteria | 2898 |
| 158 | Ga0207658_10030298 | 3300025986 | Bacteria | 3829 |
| 159 | Ga0207677_10012684 | 3300026023 | Bacteria | 4856 |
| 160 | Ga0207703_10015377 | 3300026035 | Bacteria | 5969 |
| 161 | Ga0207708_10010897 | 3300026075 | Bacteria | 6763 |
| 162 | Ga0207708_10096438 | 3300026075 | Bacteria | 2285 |
| 163 | Ga0207702_10160828 | 3300026078 | Bacteria | 2051 |
| 164 | Ga0207641_10003243 | 3300026088 | Bacteria | 14524 |
| 165 | Ga0207641_10012901 | 3300026088 | Bacteria | 6855 |
| 166 | Ga0207648_10037022 | 3300026089 | Bacteria | 4298 |
| 167 | Ga0207648_10159483 | 3300026089 | Bacteria | 1992 |
| 168 | Ga0207676_10025170 | 3300026095 | Bacteria | 4414 |
| 169 | Ga0207676_10029165 | 3300026095 | Bacteria | 4129 |
| 170 | Ga0207674_10034145 | 3300026116 | Bacteria | 5320 |
| 171 | Ga0207675_100000202 | 3300026118 | Bacteria | 55213 |
| 172 | Ga0207675_100003149 | 3300026118 | Bacteria | 16180 |
| 173 | Ga0207675_100003455 | 3300026118 | Bacteria | 15442 |
| 174 | Ga0207675_100021232 | 3300026118 | Bacteria | 6048 |
| 175 | Ga0207683_10127521 | 3300026121 | Bacteria | 2287 |
| 176 | Ga0209179_1000418 | 3300027512 | Bacteria | 4235 |
| 177 | Ga0209983_1001358 | 3300027665 | Bacteria | 5449 |
| 178 | Ga0209588_1020289 | 3300027671 | Bacteria | 2081 |
| 179 | Ga0207428_10016379 | 3300027907 | Bacteria | 6378 |
| 180 | Ga0268266_10003005 | 3300028379 | Bacteria | 17351 |
| 181 | Ga0268266_10062410 | 3300028379 | Bacteria | 3216 |
| 182 | Ga0268265_10002616 | 3300028380 | Bacteria | 13383 |
| 183 | Ga0268265_10003863 | 3300028380 | Bacteria | 10577 |
| 184 | Ga0268265_10091613 | 3300028380 | Bacteria | 2431 |
| 185 | Ga0268264_10079872 | 3300028381 | Bacteria | 2792 |
| 186 | Ga0265318_10000024 | 3300028577 | Bacteria | 159801 |
| 187 | Ga0265338_10002996 | 3300028800 | Bacteria | 24430 |
| 188 | Ga0307511_10011888 | 3300030521 | Bacteria | 8564 |
| 189 | Ga0265332_10041796 | 3300031238 | Bacteria | 1982 |
| 190 | Ga0265328_10001015 | 3300031239 | Bacteria | 12917 |
| 191 | Ga0265329_10002841 | 3300031242 | Bacteria | 7711 |
| 192 | Ga0265331_10005683 | 3300031250 | Bacteria | 7487 |
| 193 | Ga0265316_10012049 | 3300031344 | Bacteria | 7773 |
| 194 | Ga0307509_10000001 | 3300031507 | Bacteria | 629324 |
| 195 | Ga0307509_10000109 | 3300031507 | Bacteria | 117520 |
| 196 | Ga0307408_100093187 | 3300031548 | Bacteria | 2278 |
| 197 | Ga0265314_10017314 | 3300031711 | Bacteria | 5660 |
| 198 | Ga0265342_10006594 | 3300031712 | Bacteria | 8626 |
| 199 | Ga0307411_10076307 | 3300032005 | Bacteria | 2291 |
| 200 | Ga0307510_10000018 | 3300033180 | Bacteria | 192986 |
| 201 | Ga0373934_0046050 | 3300035086 | Bacteria | 1725 |
| 202 | Ga0373936_0002344 | 3300035113 | Bacteria | 7086 |
| 203 | Ga0373936_0003169 | 3300035113 | Bacteria | 6156 |
| 204 | Ga0373955_0008764 | 3300035172 | Bacteria | 4710 |
| 205 | Ga0373927_0014804 | 3300035695 | Bacteria | 5158 |
| 206 | Ga0373937_0006172 | 3300036401 | Bacteria | 10319 |
| 207 | Ga0373937_0064881 | 3300036401 | Bacteria | 3360 |
| 208 | Ga0373937_0190911 | 3300036401 | Bacteria | 1925 |
| 209 | Ga0373937_0226057 | 3300036401 | Bacteria | 1762 |
| 210 | Ga0436363_0441792 | 3300039450 | Bacteria | 8029 |
| 211 | Ga0450909_007425 | 3300042185 | Bacteria | 1587 |
| 212 | Ga0466969_0002107 | 3300044656 | Bacteria | 10610 |
| 213 | Ga0466961_0001050 | 3300044693 | Bacteria | 17009 |
| 214 | Ga0466964_0001846 | 3300044706 | Bacteria | 7373 |
| 215 | Ga0466971_0000216 | 3300044719 | Bacteria | 22087 |
| 216 | Ga0466968_0027460 | 3300044735 | Bacteria | 2343 |
| 217 | Ga0466970_0005778 | 3300044765 | Bacteria | 6149 |
| 218 | Ga0466957_0013272 | 3300044842 | Bacteria | 4779 |
| 219 | Ga0466959_0030233 | 3300045049 | Bacteria | 4011 |
| 220 | Ga0451576_0080478 | 3300045051 | Bacteria | 3389 |
| 221 | Ga0495638_0017571 | 3300046460 | Bacteria | 4766 |
| 222 | Ga0495580_0000015 | 3300046472 | Bacteria | 94575 |
| 223 | Ga0495580_0041108 | 3300046472 | Bacteria | 3298 |
| 224 | Ga0495583_0026392 | 3300046506 | Bacteria | 2881 |
| 225 | Ga0496104_0002001 | 3300048907 | Bacteria | 17686 |
| 226 | Ga0496105_0000504 | 3300048908 | Bacteria | 25756 |
| 227 | Ga0496107_0037254 | 3300048910 | Bacteria | 3490 |
| 228 | Ga0496108_0049247 | 3300048911 | Bacteria | 3524 |
| 229 | Ga0496109_0020711 | 3300048912 | Bacteria | 5808 |
| 230 | Ga0496109_0058446 | 3300048912 | Bacteria | 3522 |
| 231 | Ga0496110_0022106 | 3300048913 | Bacteria | 5395 |
| 232 | Ga0496112_0018347 | 3300048915 | Bacteria | 6588 |
| 233 | Ga0496112_0061555 | 3300048915 | Bacteria | 3700 |
| 234 | Ga0496114_0001514 | 3300048917 | Bacteria | 17656 |
| 235 | Ga0496115_0004457 | 3300048918 | Bacteria | 10148 |
| 236 | Ga0496120_0000061 | 3300048923 | Bacteria | 172817 |
| 237 | Ga0496126_0016341 | 3300048929 | Bacteria | 7424 |
| 238 | Ga0501068_0000336 | 3300049584 | Bacteria | 23645 |
| 239 | Ga0501069_0057338 | 3300049585 | Bacteria | 2171 |
| 240 | Ga0501070_0002573 | 3300049586 | Bacteria | 15879 |
| 241 | Ga0501071_0001594 | 3300049587 | Bacteria | 13292 |
| 242 | Ga0501071_0010302 | 3300049587 | Bacteria | 6260 |
| 243 | Ga0501072_0239708 | 3300049588 | Bacteria | 1444 |
| 244 | Ga0501073_0003148 | 3300049589 | Bacteria | 12375 |
| 245 | Ga0501074_0012536 | 3300049590 | Bacteria | 6163 |
| 246 | Ga0501076_0009249 | 3300049592 | Bacteria | 7269 |
| 247 | Ga0501076_0082697 | 3300049592 | Bacteria | 2578 |
| 248 | Ga0501077_0000288 | 3300049593 | Bacteria | 29818 |
| 249 | Ga0501079_0003630 | 3300049741 | Bacteria | 11360 |
| 250 | Ga0501080_0003832 | 3300049742 | Bacteria | 13282 |
| 251 | Ga0501081_0076327 | 3300049743 | Bacteria | 2340 |
| 252 | Ga0501083_0005053 | 3300049744 | Bacteria | 9346 |
| 253 | nmdc:mga05p37_15695_c1 | 3300050507 | Bacteria | 9104 |
| 254 | nmdc:mga05p37_61171_c1 | 3300050507 | Bacteria | 4636 |
| 255 | nmdc:mga09592_104289_c1 | 3300050508 | Bacteria | 2430 |
| 256 | nmdc:mga09592_16496_c1 | 3300050508 | Bacteria | 6043 |
| 257 | nmdc:mga09592_45511_c1 | 3300050508 | Bacteria | 3696 |
| 258 | nmdc:mga09592_5545_c1 | 3300050508 | Bacteria | 10272 |
| 259 | nmdc:mga0qj67_20641_c1 | 3300050509 | Bacteria | 5047 |
| 260 | nmdc:mga0qj67_37402_c1 | 3300050509 | Bacteria | 3802 |
| 261 | nmdc:mga0qj67_94836_c1 | 3300050509 | Bacteria | 2401 |
| 262 | nmdc:mga06r32_10434_c1 | 3300050510 | Bacteria | 4609 |
| 263 | nmdc:mga06r32_115_c1 | 3300050510 | Bacteria | 57898 |
| 264 | nmdc:mga06r32_2849_c1 | 3300050510 | Bacteria | 15518 |
| 265 | nmdc:mga06r32_8067_c1 | 3300050510 | Bacteria | 9476 |
| 266 | nmdc:mga08y16_23466_c1 | 3300050511 | Bacteria | 6516 |
| 267 | nmdc:mga08y16_266_c1 | 3300050511 | Bacteria | 47344 |
| 268 | nmdc:mga0a205_45257_c1 | 3300050515 | Bacteria | 3944 |
| 269 | Ga0495601_0039091 | 3300053077 | Bacteria | 2970 |
| 270 | Ga0500616_0037011 | 3300053153 | Bacteria | 2644 |
| 271 | Ga0500637_0020184 | 3300053178 | Bacteria | 3605 |
| 272 | Ga0501084_0043627 | 3300054114 | Bacteria | 3751 |
| 273 | Ga0501082_0073265 | 3300060353 | Bacteria | 2950 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049588 | Ga0501072_0239708 | Ga0501072_0239708_174_1427 | 417 |
| 2 | 3300025942 | Ga0207689_10138878 | Ga0207689_101388782 | 426 |
| 3 | 3300035172 | Ga0373955_0008764 | Ga0373955_0008764_17_1354 | 443 |
| 4 | 3300014968 | Ga0157379_10193465 | Ga0157379_101934652 | 448 |
| 5 | 3300042185 | Ga0450909_007425 | Ga0450909_007425_102_1490 | 450 |
| 6 | 3300050508 | nmdc:mga09592_104289_c1 | nmdc:mga09592_104289_c1_291_1679 | 450 |
| 7 | 3300050510 | nmdc:mga06r32_8067_c1 | nmdc:mga06r32_8067_c1_6713_8101 | 450 |
| 8 | 3300044656 | Ga0466969_0002107 | Ga0466969_0002107_199_1608 | 467 |
| 9 | 3300044693 | Ga0466961_0001050 | Ga0466961_0001050_6366_7775 | 467 |
| 10 | 3300044706 | Ga0466964_0001846 | Ga0466964_0001846_1895_3304 | 467 |
| 11 | 3300044719 | Ga0466971_0000216 | Ga0466971_0000216_4377_5786 | 467 |
| 12 | 3300044735 | Ga0466968_0027460 | Ga0466968_0027460_748_2157 | 467 |
| 13 | 3300044765 | Ga0466970_0005778 | Ga0466970_0005778_4221_5630 | 467 |
| 14 | 3300044842 | Ga0466957_0013272 | Ga0466957_0013272_1683_3092 | 467 |
| 15 | 3300045049 | Ga0466959_0030233 | Ga0466959_0030233_2536_3945 | 467 |
| 16 | 3300035113 | Ga0373936_0003169 | Ga0373936_0003169_211_1644 | 476 |
| 17 | 3300048923 | Ga0496120_0000061 | Ga0496120_0000061_20542_21978 | 476 |
| 18 | 3300053153 | Ga0500616_0037011 | Ga0500616_0037011_375_1820 | 480 |
| 19 | 3300046460 | Ga0495638_0017571 | Ga0495638_0017571_1168_2700 | 487 |
| 20 | 3300046506 | Ga0495583_0026392 | Ga0495583_0026392_965_2428 | 487 |
| 21 | 3300009093 | Ga0105240_10003744 | Ga0105240_1000374423 | 488 |
| 22 | 3300009093 | Ga0105240_10055209 | Ga0105240_100552094 | 488 |
| 23 | 3300009551 | Ga0105238_10037348 | Ga0105238_100373485 | 488 |
| 24 | 3300026089 | Ga0207648_10037022 | Ga0207648_100370223 | 488 |
| 25 | 3300048929 | Ga0496126_0016341 | Ga0496126_0016341_2867_4342 | 488 |
| 26 | 3300005330 | Ga0070690_100006096 | Ga0070690_1000060965 | 490 |
| 27 | 3300005331 | Ga0070670_100016443 | Ga0070670_1000164435 | 490 |
| 28 | 3300005335 | Ga0070666_10007508 | Ga0070666_100075086 | 490 |
| 29 | 3300005338 | Ga0068868_100004800 | Ga0068868_1000048005 | 490 |
| 30 | 3300005355 | Ga0070671_100005848 | Ga0070671_1000058483 | 490 |
| 31 | 3300005367 | Ga0070667_100041818 | Ga0070667_1000418182 | 490 |
| 32 | 3300005457 | Ga0070662_100031204 | Ga0070662_1000312042 | 490 |
| 33 | 3300005466 | Ga0070685_10021714 | Ga0070685_100217142 | 490 |
| 34 | 3300005548 | Ga0070665_100007096 | Ga0070665_10000709612 | 490 |
| 35 | 3300005564 | Ga0070664_100012096 | Ga0070664_1000120962 | 490 |
| 36 | 3300005617 | Ga0068859_100051931 | Ga0068859_1000519313 | 490 |
| 37 | 3300005618 | Ga0068864_100001048 | Ga0068864_1000010483 | 490 |
| 38 | 3300005841 | Ga0068863_100001284 | Ga0068863_1000012844 | 490 |
| 39 | 3300005843 | Ga0068860_100008754 | Ga0068860_1000087544 | 490 |
| 40 | 3300006358 | Ga0068871_100062420 | Ga0068871_1000624202 | 490 |
| 41 | 3300006931 | Ga0097620_100051929 | Ga0097620_1000519293 | 490 |
| 42 | 3300013308 | Ga0157375_10103078 | Ga0157375_101030782 | 490 |
| 43 | 3300014968 | Ga0157379_10013381 | Ga0157379_100133815 | 490 |
| 44 | 3300025925 | Ga0207650_10013677 | Ga0207650_100136772 | 490 |
| 45 | 3300025960 | Ga0207651_10047378 | Ga0207651_100473782 | 490 |
| 46 | 3300025986 | Ga0207658_10030298 | Ga0207658_100302983 | 490 |
| 47 | 3300026023 | Ga0207677_10012684 | Ga0207677_100126844 | 490 |
| 48 | 3300026035 | Ga0207703_10015377 | Ga0207703_100153773 | 490 |
| 49 | 3300026078 | Ga0207702_10160828 | Ga0207702_101608282 | 490 |
| 50 | 3300026088 | Ga0207641_10003243 | Ga0207641_100032433 | 490 |
| 51 | 3300045051 | Ga0451576_0080478 | Ga0451576_0080478_12_1490 | 490 |
| 52 | 3300048912 | Ga0496109_0058446 | Ga0496109_0058446_1599_3077 | 490 |
| 53 | 3300048915 | Ga0496112_0061555 | Ga0496112_0061555_441_1919 | 490 |
| 54 | 3300006844 | Ga0075428_100002919 | Ga0075428_1000029196 | 499 |
| 55 | 3300005364 | Ga0070673_100147840 | Ga0070673_1001478402 | 502 |
| 56 | 3300025960 | Ga0207651_10040848 | Ga0207651_100408483 | 502 |
| 57 | 3300006844 | Ga0075428_100001989 | Ga0075428_10000198915 | 503 |
| 58 | 3300006847 | Ga0075431_100000077 | Ga0075431_10000007712 | 503 |
| 59 | 3300006880 | Ga0075429_100002310 | Ga0075429_10000231012 | 503 |
| 60 | 3300009094 | Ga0111539_10000277 | Ga0111539_1000027710 | 503 |
| 61 | 3300009147 | Ga0114129_10013156 | Ga0114129_1001315613 | 503 |
| 62 | 3300050507 | nmdc:mga05p37_61171_c1 | nmdc:mga05p37_61171_c1_485_2044 | 503 |
| 63 | 3300050508 | nmdc:mga09592_5545_c1 | nmdc:mga09592_5545_c1_678_2237 | 503 |
| 64 | 3300050510 | nmdc:mga06r32_115_c1 | nmdc:mga06r32_115_c1_7159_8718 | 503 |
| 65 | 3300050511 | nmdc:mga08y16_266_c1 | nmdc:mga08y16_266_c1_39245_40804 | 503 |
| 66 | 3300009098 | Ga0105245_10028462 | Ga0105245_100284623 | 507 |
| 67 | 3300009101 | Ga0105247_10002275 | Ga0105247_1000227513 | 507 |
| 68 | 3300009177 | Ga0105248_10005568 | Ga0105248_100055682 | 507 |
| 69 | 3300010375 | Ga0105239_10047083 | Ga0105239_100470832 | 507 |
| 70 | 3300011119 | Ga0105246_10001616 | Ga0105246_100016163 | 507 |
| 71 | 3300013296 | Ga0157374_10005450 | Ga0157374_100054503 | 507 |
| 72 | 3300013306 | Ga0163162_10055176 | Ga0163162_100551762 | 507 |
| 73 | 3300014325 | Ga0163163_10004323 | Ga0163163_100043236 | 507 |
| 74 | 3300014969 | Ga0157376_10048739 | Ga0157376_100487392 | 507 |
| 75 | 3300036401 | Ga0373937_0190911 | Ga0373937_0190911_30_1571 | 507 |
| 76 | 3300048917 | Ga0496114_0001514 | Ga0496114_0001514_10957_12486 | 507 |
| 77 | 3300053077 | Ga0495601_0039091 | Ga0495601_0039091_563_2092 | 507 |
| 78 | 3300036401 | Ga0373937_0006172 | Ga0373937_0006172_4716_6251 | 508 |
| 79 | 3300049587 | Ga0501071_0010302 | Ga0501071_0010302_3128_4657 | 508 |
| 80 | 3300060353 | Ga0501082_0073265 | Ga0501082_0073265_842_2371 | 508 |
| 81 | 3300005334 | Ga0068869_100004873 | Ga0068869_1000048732 | 509 |
| 82 | 3300005336 | Ga0070680_100000673 | Ga0070680_10000067316 | 509 |
| 83 | 3300005337 | Ga0070682_100010276 | Ga0070682_1000102762 | 509 |
| 84 | 3300005338 | Ga0068868_100055765 | Ga0068868_1000557652 | 509 |
| 85 | 3300005340 | Ga0070689_100000421 | Ga0070689_1000004217 | 509 |
| 86 | 3300005340 | Ga0070689_100026563 | Ga0070689_1000265632 | 509 |
| 87 | 3300005343 | Ga0070687_100014852 | Ga0070687_1000148522 | 509 |
| 88 | 3300005345 | Ga0070692_10020938 | Ga0070692_100209383 | 509 |
| 89 | 3300005366 | Ga0070659_100110244 | Ga0070659_1001102442 | 509 |
| 90 | 3300005438 | Ga0070701_10005050 | Ga0070701_100050504 | 509 |
| 91 | 3300005440 | Ga0070705_100004895 | Ga0070705_1000048955 | 509 |
| 92 | 3300005441 | Ga0070700_100071223 | Ga0070700_1000712232 | 509 |
| 93 | 3300005456 | Ga0070678_100079555 | Ga0070678_1000795552 | 509 |
| 94 | 3300005458 | Ga0070681_10002158 | Ga0070681_100021586 | 509 |
| 95 | 3300005530 | Ga0070679_100002776 | Ga0070679_1000027766 | 509 |
| 96 | 3300005535 | Ga0070684_100008616 | Ga0070684_1000086165 | 509 |
| 97 | 3300005544 | Ga0070686_100017517 | Ga0070686_1000175173 | 509 |
| 98 | 3300005544 | Ga0070686_100037868 | Ga0070686_1000378683 | 509 |
| 99 | 3300005548 | Ga0070665_100001969 | Ga0070665_10000196912 | 509 |
| 100 | 3300005549 | Ga0070704_100058731 | Ga0070704_1000587313 | 509 |
| 101 | 3300005563 | Ga0068855_100005111 | Ga0068855_1000051116 | 509 |
| 102 | 3300005615 | Ga0070702_100000889 | Ga0070702_1000008894 | 509 |
| 103 | 3300005617 | Ga0068859_100006199 | Ga0068859_1000061996 | 509 |
| 104 | 3300005617 | Ga0068859_100039620 | Ga0068859_1000396202 | 509 |
| 105 | 3300005618 | Ga0068864_100005181 | Ga0068864_1000051818 | 509 |
| 106 | 3300005618 | Ga0068864_100043023 | Ga0068864_1000430232 | 509 |
| 107 | 3300005719 | Ga0068861_100008134 | Ga0068861_1000081342 | 509 |
| 108 | 3300005719 | Ga0068861_100060391 | Ga0068861_1000603913 | 509 |
| 109 | 3300005841 | Ga0068863_100014230 | Ga0068863_1000142308 | 509 |
| 110 | 3300005844 | Ga0068862_100065571 | Ga0068862_1000655712 | 509 |
| 111 | 3300005844 | Ga0068862_100104548 | Ga0068862_1001045483 | 509 |
| 112 | 3300006846 | Ga0075430_100006465 | Ga0075430_10000646511 | 509 |
| 113 | 3300006846 | Ga0075430_100031975 | Ga0075430_1000319752 | 509 |
| 114 | 3300006846 | Ga0075430_100058242 | Ga0075430_1000582422 | 509 |
| 115 | 3300006847 | Ga0075431_100025947 | Ga0075431_1000259478 | 509 |
| 116 | 3300006847 | Ga0075431_100131955 | Ga0075431_1001319552 | 509 |
| 117 | 3300006852 | Ga0075433_10022914 | Ga0075433_100229143 | 509 |
| 118 | 3300006880 | Ga0075429_100056708 | Ga0075429_1000567083 | 509 |
| 119 | 3300006881 | Ga0068865_100058794 | Ga0068865_1000587942 | 509 |
| 120 | 3300006931 | Ga0097620_100006199 | Ga0097620_1000061996 | 509 |
| 121 | 3300006931 | Ga0097620_100039621 | Ga0097620_1000396216 | 509 |
| 122 | 3300009093 | Ga0105240_10000760 | Ga0105240_100007606 | 509 |
| 123 | 3300009174 | Ga0105241_10055883 | Ga0105241_100558832 | 509 |
| 124 | 3300009551 | Ga0105238_10002536 | Ga0105238_1000253613 | 509 |
| 125 | 3300013104 | Ga0157370_10003740 | Ga0157370_100037406 | 509 |
| 126 | 3300014325 | Ga0163163_10001355 | Ga0163163_100013557 | 509 |
| 127 | 3300014326 | Ga0157380_10093908 | Ga0157380_100939082 | 509 |
| 128 | 3300025908 | Ga0207643_10005459 | Ga0207643_100054594 | 509 |
| 129 | 3300025912 | Ga0207707_10000999 | Ga0207707_100009997 | 509 |
| 130 | 3300025913 | Ga0207695_10004603 | Ga0207695_100046036 | 509 |
| 131 | 3300025917 | Ga0207660_10004733 | Ga0207660_100047334 | 509 |
| 132 | 3300025917 | Ga0207660_10038417 | Ga0207660_100384173 | 509 |
| 133 | 3300025918 | Ga0207662_10003006 | Ga0207662_100030065 | 509 |
| 134 | 3300025920 | Ga0207649_10021193 | Ga0207649_100211933 | 509 |
| 135 | 3300025921 | Ga0207652_10007161 | Ga0207652_100071615 | 509 |
| 136 | 3300025933 | Ga0207706_10000907 | Ga0207706_100009072 | 509 |
| 137 | 3300025938 | Ga0207704_10053041 | Ga0207704_100530412 | 509 |
| 138 | 3300025940 | Ga0207691_10076104 | Ga0207691_100761042 | 509 |
| 139 | 3300025942 | Ga0207689_10003936 | Ga0207689_100039365 | 509 |
| 140 | 3300025945 | Ga0207679_10004394 | Ga0207679_100043942 | 509 |
| 141 | 3300025949 | Ga0207667_10003353 | Ga0207667_1000335311 | 509 |
| 142 | 3300026075 | Ga0207708_10010897 | Ga0207708_100108975 | 509 |
| 143 | 3300026075 | Ga0207708_10096438 | Ga0207708_100964382 | 509 |
| 144 | 3300026088 | Ga0207641_10012901 | Ga0207641_100129015 | 509 |
| 145 | 3300026095 | Ga0207676_10025170 | Ga0207676_100251702 | 509 |
| 146 | 3300026095 | Ga0207676_10029165 | Ga0207676_100291654 | 509 |
| 147 | 3300026116 | Ga0207674_10034145 | Ga0207674_100341452 | 509 |
| 148 | 3300026118 | Ga0207675_100003149 | Ga0207675_1000031497 | 509 |
| 149 | 3300026118 | Ga0207675_100003455 | Ga0207675_1000034555 | 509 |
| 150 | 3300026118 | Ga0207675_100021232 | Ga0207675_1000212322 | 509 |
| 151 | 3300026121 | Ga0207683_10127521 | Ga0207683_101275212 | 509 |
| 152 | 3300027907 | Ga0207428_10016379 | Ga0207428_100163794 | 509 |
| 153 | 3300028379 | Ga0268266_10003005 | Ga0268266_100030058 | 509 |
| 154 | 3300028380 | Ga0268265_10002616 | Ga0268265_100026163 | 509 |
| 155 | 3300028380 | Ga0268265_10091613 | Ga0268265_100916132 | 509 |
| 156 | 3300028381 | Ga0268264_10079872 | Ga0268264_100798722 | 509 |
| 157 | 3300031507 | Ga0307509_10000109 | Ga0307509_1000010993 | 509 |
| 158 | 3300031548 | Ga0307408_100093187 | Ga0307408_1000931872 | 509 |
| 159 | 3300032005 | Ga0307411_10076307 | Ga0307411_100763072 | 509 |
| 160 | 3300049584 | Ga0501068_0000336 | Ga0501068_0000336_19924_21453 | 509 |
| 161 | 3300049585 | Ga0501069_0057338 | Ga0501069_0057338_523_2052 | 509 |
| 162 | 3300049586 | Ga0501070_0002573 | Ga0501070_0002573_12995_14524 | 509 |
| 163 | 3300049587 | Ga0501071_0001594 | Ga0501071_0001594_10927_12456 | 509 |
| 164 | 3300049589 | Ga0501073_0003148 | Ga0501073_0003148_8650_10179 | 509 |
| 165 | 3300049590 | Ga0501074_0012536 | Ga0501074_0012536_1466_2995 | 509 |
| 166 | 3300049592 | Ga0501076_0009249 | Ga0501076_0009249_4181_5710 | 509 |
| 167 | 3300049593 | Ga0501077_0000288 | Ga0501077_0000288_26863_28392 | 509 |
| 168 | 3300049741 | Ga0501079_0003630 | Ga0501079_0003630_6755_8284 | 509 |
| 169 | 3300049742 | Ga0501080_0003832 | Ga0501080_0003832_6979_8508 | 509 |
| 170 | 3300049743 | Ga0501081_0076327 | Ga0501081_0076327_649_2178 | 509 |
| 171 | 3300049744 | Ga0501083_0005053 | Ga0501083_0005053_1866_3395 | 509 |
| 172 | 3300050507 | nmdc:mga05p37_15695_c1 | nmdc:mga05p37_15695_c1_5930_7489 | 509 |
| 173 | 3300050508 | nmdc:mga09592_16496_c1 | nmdc:mga09592_16496_c1_2869_4428 | 509 |
| 174 | 3300050508 | nmdc:mga09592_45511_c1 | nmdc:mga09592_45511_c1_1331_2890 | 509 |
| 175 | 3300050509 | nmdc:mga0qj67_20641_c1 | nmdc:mga0qj67_20641_c1_2483_4042 | 509 |
| 176 | 3300050509 | nmdc:mga0qj67_37402_c1 | nmdc:mga0qj67_37402_c1_2087_3646 | 509 |
| 177 | 3300050509 | nmdc:mga0qj67_94836_c1 | nmdc:mga0qj67_94836_c1_122_1681 | 509 |
| 178 | 3300050510 | nmdc:mga06r32_10434_c1 | nmdc:mga06r32_10434_c1_1141_2700 | 509 |
| 179 | 3300050510 | nmdc:mga06r32_2849_c1 | nmdc:mga06r32_2849_c1_10047_11606 | 509 |
| 180 | 3300050511 | nmdc:mga08y16_23466_c1 | nmdc:mga08y16_23466_c1_1914_3446 | 509 |
| 181 | 3300050515 | nmdc:mga0a205_45257_c1 | nmdc:mga0a205_45257_c1_288_1823 | 509 |
| 182 | 3300054114 | Ga0501084_0043627 | Ga0501084_0043627_1406_2935 | 509 |
| 183 | 3300005328 | Ga0070676_10004351 | Ga0070676_100043514 | 510 |
| 184 | 3300005347 | Ga0070668_100018353 | Ga0070668_1000183533 | 510 |
| 185 | 3300005353 | Ga0070669_100002847 | Ga0070669_1000028476 | 510 |
| 186 | 3300005356 | Ga0070674_100003651 | Ga0070674_1000036513 | 510 |
| 187 | 3300005434 | Ga0070709_10001819 | Ga0070709_100018195 | 510 |
| 188 | 3300005435 | Ga0070714_100001074 | Ga0070714_1000010742 | 510 |
| 189 | 3300005457 | Ga0070662_100005104 | Ga0070662_1000051047 | 510 |
| 190 | 3300005458 | Ga0070681_10002323 | Ga0070681_100023236 | 510 |
| 191 | 3300005459 | Ga0068867_100005383 | Ga0068867_1000053835 | 510 |
| 192 | 3300005543 | Ga0070672_100010784 | Ga0070672_1000107844 | 510 |
| 193 | 3300005614 | Ga0068856_100055066 | Ga0068856_1000550662 | 510 |
| 194 | 3300005719 | Ga0068861_100008740 | Ga0068861_1000087403 | 510 |
| 195 | 3300005844 | Ga0068862_100003806 | Ga0068862_1000038069 | 510 |
| 196 | 3300006844 | Ga0075428_100058770 | Ga0075428_1000587703 | 510 |
| 197 | 3300006846 | Ga0075430_100033935 | Ga0075430_1000339353 | 510 |
| 198 | 3300006847 | Ga0075431_100009013 | Ga0075431_1000090133 | 510 |
| 199 | 3300006880 | Ga0075429_100113295 | Ga0075429_1001132953 | 510 |
| 200 | 3300009093 | Ga0105240_10143095 | Ga0105240_101430952 | 510 |
| 201 | 3300010375 | Ga0105239_10061687 | Ga0105239_100616872 | 510 |
| 202 | 3300014326 | Ga0157380_10006498 | Ga0157380_100064987 | 510 |
| 203 | 3300025906 | Ga0207699_10004009 | Ga0207699_100040092 | 510 |
| 204 | 3300025907 | Ga0207645_10000489 | Ga0207645_1000048919 | 510 |
| 205 | 3300025913 | Ga0207695_10117196 | Ga0207695_101171962 | 510 |
| 206 | 3300025929 | Ga0207664_10004364 | Ga0207664_100043646 | 510 |
| 207 | 3300025933 | Ga0207706_10000977 | Ga0207706_100009777 | 510 |
| 208 | 3300025940 | Ga0207691_10004423 | Ga0207691_100044238 | 510 |
| 209 | 3300026118 | Ga0207675_100000202 | Ga0207675_1000002027 | 510 |
| 210 | 3300027665 | Ga0209983_1001358 | Ga0209983_10013582 | 510 |
| 211 | 3300028380 | Ga0268265_10003863 | Ga0268265_100038633 | 510 |
| 212 | 3300031507 | Ga0307509_10000001 | Ga0307509_10000001278 | 510 |
| 213 | 3300035086 | Ga0373934_0046050 | Ga0373934_0046050_69_1604 | 510 |
| 214 | 3300036401 | Ga0373937_0064881 | Ga0373937_0064881_335_1870 | 510 |
| 215 | 3300036401 | Ga0373937_0226057 | Ga0373937_0226057_48_1610 | 510 |
| 216 | 3300005336 | Ga0070680_100027729 | Ga0070680_1000277292 | 511 |
| 217 | 3300005439 | Ga0070711_100027417 | Ga0070711_1000274172 | 511 |
| 218 | 3300005458 | Ga0070681_10011202 | Ga0070681_100112023 | 511 |
| 219 | 3300005458 | Ga0070681_10011416 | Ga0070681_100114167 | 511 |
| 220 | 3300005535 | Ga0070684_100031600 | Ga0070684_1000316003 | 511 |
| 221 | 3300005563 | Ga0068855_100002194 | Ga0068855_10000219410 | 511 |
| 222 | 3300005614 | Ga0068856_100014162 | Ga0068856_1000141623 | 511 |
| 223 | 3300006175 | Ga0070712_100182292 | Ga0070712_1001822921 | 511 |
| 224 | 3300007265 | Ga0099794_10026932 | Ga0099794_100269322 | 511 |
| 225 | 3300007788 | Ga0099795_10000234 | Ga0099795_100002343 | 511 |
| 226 | 3300009093 | Ga0105240_10002211 | Ga0105240_1000221126 | 511 |
| 227 | 3300009093 | Ga0105240_10006209 | Ga0105240_100062093 | 511 |
| 228 | 3300009101 | Ga0105247_10008699 | Ga0105247_100086997 | 511 |
| 229 | 3300009176 | Ga0105242_10026563 | Ga0105242_100265632 | 511 |
| 230 | 3300009545 | Ga0105237_10006046 | Ga0105237_1000604613 | 511 |
| 231 | 3300010159 | Ga0099796_10009018 | Ga0099796_100090182 | 511 |
| 232 | 3300010375 | Ga0105239_10086120 | Ga0105239_100861204 | 511 |
| 233 | 3300013105 | Ga0157369_10185048 | Ga0157369_101850482 | 511 |
| 234 | 3300013296 | Ga0157374_10156037 | Ga0157374_101560372 | 511 |
| 235 | 3300025903 | Ga0207680_10016845 | Ga0207680_100168453 | 511 |
| 236 | 3300025913 | Ga0207695_10011587 | Ga0207695_100115875 | 511 |
| 237 | 3300025915 | Ga0207693_10005525 | Ga0207693_100055253 | 511 |
| 238 | 3300025916 | Ga0207663_10051347 | Ga0207663_100513472 | 511 |
| 239 | 3300025939 | Ga0207665_10033903 | Ga0207665_100339032 | 511 |
| 240 | 3300025949 | Ga0207667_10001268 | Ga0207667_1000126817 | 511 |
| 241 | 3300025949 | Ga0207667_10080577 | Ga0207667_100805772 | 511 |
| 242 | 3300026089 | Ga0207648_10159483 | Ga0207648_101594832 | 511 |
| 243 | 3300027512 | Ga0209179_1000418 | Ga0209179_10004182 | 511 |
| 244 | 3300027671 | Ga0209588_1020289 | Ga0209588_10202892 | 511 |
| 245 | 3300028379 | Ga0268266_10062410 | Ga0268266_100624102 | 511 |
| 246 | 3300028577 | Ga0265318_10000024 | Ga0265318_10000024119 | 511 |
| 247 | 3300028800 | Ga0265338_10002996 | Ga0265338_1000299613 | 511 |
| 248 | 3300030521 | Ga0307511_10011888 | Ga0307511_100118885 | 511 |
| 249 | 3300031238 | Ga0265332_10041796 | Ga0265332_100417962 | 511 |
| 250 | 3300031239 | Ga0265328_10001015 | Ga0265328_1000101510 | 511 |
| 251 | 3300031242 | Ga0265329_10002841 | Ga0265329_100028415 | 511 |
| 252 | 3300031250 | Ga0265331_10005683 | Ga0265331_100056836 | 511 |
| 253 | 3300031344 | Ga0265316_10012049 | Ga0265316_100120495 | 511 |
| 254 | 3300031711 | Ga0265314_10017314 | Ga0265314_100173142 | 511 |
| 255 | 3300031712 | Ga0265342_10006594 | Ga0265342_100065945 | 511 |
| 256 | 3300033180 | Ga0307510_10000018 | Ga0307510_1000001885 | 511 |
| 257 | 3300035113 | Ga0373936_0002344 | Ga0373936_0002344_2754_4292 | 511 |
| 258 | 3300035695 | Ga0373927_0014804 | Ga0373927_0014804_650_2188 | 511 |
| 259 | 3300039450 | Ga0436363_0441792 | Ga0436363_0441792_4967_6505 | 511 |
| 260 | 3300046472 | Ga0495580_0000015 | Ga0495580_0000015_23002_24540 | 511 |
| 261 | 3300046472 | Ga0495580_0041108 | Ga0495580_0041108_1177_2715 | 511 |
| 262 | 3300048907 | Ga0496104_0002001 | Ga0496104_0002001_7986_9551 | 511 |
| 263 | 3300048908 | Ga0496105_0000504 | Ga0496105_0000504_18823_20388 | 511 |
| 264 | 3300048910 | Ga0496107_0037254 | Ga0496107_0037254_456_1994 | 511 |
| 265 | 3300048911 | Ga0496108_0049247 | Ga0496108_0049247_1452_2990 | 511 |
| 266 | 3300048912 | Ga0496109_0020711 | Ga0496109_0020711_3979_5517 | 511 |
| 267 | 3300048913 | Ga0496110_0022106 | Ga0496110_0022106_1326_2864 | 511 |
| 268 | 3300048915 | Ga0496112_0018347 | Ga0496112_0018347_2409_3947 | 511 |
| 269 | 3300048918 | Ga0496115_0004457 | Ga0496115_0004457_5369_6934 | 511 |
| 270 | 3300049592 | Ga0501076_0082697 | Ga0501076_0082697_350_1924 | 511 |
| 271 | 3300053178 | Ga0500637_0020184 | Ga0500637_0020184_1447_2985 | 511 |
| 272 | 2162886007 | SwRhRL2b_contig_365350 | SwRhRL2b_0592.00009820 | 512 |
| 273 | 3300005289 | Ga0065704_10000717 | Ga0065704_1000071710 | 512 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6zjl-assembly1.cif.gz_4 | respiratory complex i from thermus thermophilus, nad+ dataset, major state | 0.9322 | 189 | 512 |
| 7o6y-assembly1.cif.gz_C | cryo-em structure of respiratory complex i under turnover | 0.9305 | 194 | 509 |
| 7zm7-assembly1.cif.gz_C | cryoem structure of mitochondrial complex i from chaetomium thermophilum (inhibited by ddm) | 0.9303 | 194 | 509 |
| 6u8y-assembly1.cif.gz_l | structure of the membrane-bound sulfane sulfur reductase (mbs), an archaeal respiratory membrane complex | 0.9302 | 189 | 512 |
| 6yj4-assembly1.cif.gz_D | structure of yarrowia lipolytica complex i at 2.7 a | 0.9293 | 194 | 512 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P16431_180_537_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9616 | 190 | 508 | 1.10.645.10 |
| af_Q58433_9_368_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9526 | 194 | 509 | 1.10.645.10 |
| af_Q57935_5_362_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9311 | 189 | 509 | 1.10.645.10 |
| af_P9WJH5_38_440_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9279 | 189 | 509 | 1.10.645.10 |
| af_P56753_10_393_1.10.645.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B | 0.9173 | 189 | 512 | 1.10.645.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N9R9H2-F1-model_v4 | Ni,Fe-hydrogenase III large subunit | 0.9754 | 211 | 512 |
GO:0016651
GO:0048038 GO:0051287 |
| AF-A0A6N9R9H2-F1-model_v4 | Ni,Fe-hydrogenase III large subunit | 0.9722 | 211 | 512 |
GO:0016651
GO:0048038 GO:0051287 |
| AF-T1B8V6-F1-model_v4 | NADH dehydrogenase (Ubiquinone) 30 kDa subunit | 0.9713 | 276 | 442 |
GO:0016651
GO:0048038 GO:0051287 |
| AF-A0A0B0PWL7-F1-model_v4 | Carbon monoxide-induced hydrogenase | 0.9659 | 189 | 433 |
GO:0016151
GO:0016651 GO:0048038 GO:0051287 |
| AF-A0A7J3FCD5-F1-model_v4 | NADH:ubiquinone oxidoreductase | 0.9658 | 190 | 508 |
GO:0008901
GO:0016151 GO:0016651 GO:0048038 GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar