F378808

General Info

Members Datasets Scaffolds Average Seq Length
273 188 273 508

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10004351|Ga0070676_100043514
Length 524
Sequence LSGRWWDDAYQVNGALPVRRLSVTAEEWRPCASGLAAAGGRLLSLWVVPGTPDTAPALVRAAVAIASGVLVLELSVADQVRGGAAEGSTGAGNYPGLEAIFPCASRMQRAAYDLCGVRSTDPDRRPWLRHAAWPADWFPLQGAGDAQVAAGAVVDDYAFLRVQGDGVHEIPVGPVHAGIIEPGHFRFSVVGEKVLRLETRLAYTHKGIERRFAEIGLFEGHRLAARVSGDSSVAYSWAYCQALEGLAGCTVPPRAAWLRGLMLEAERIANHLGDLGALGNDAGFAFGLAQFSRLKEHWLRAIEALFGQRYLMDAIVPGGTAVNVASDVVQRFVGHAGQLAHDVCALRQIYEEHDGLRDRFATTGSVSPTLATWLGIIGLAGRASGQAHDARVDWPTPPYDDVTPAIVVRSYGDVAARIAVRFDEVLESCRLVARLAGGLPEGPSRAEVALPTAPAFGLGVVEAWRGPVLVALDAGPGNRVLRCHPHDPSWQNWPALEHAVIGNIVPDFPLINKSFNLSYSGHDL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
124 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
125 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
126 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
145 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
146 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
186 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 4.03
Rhizosphere 92.67
Stem 0
Stem Tuber 0
Unclassified 2.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_365350 2162886007 Bacteria 8655
2 Ga0065704_10000717 3300005289 Bacteria 14357
3 Ga0070676_10004351 3300005328 Bacteria 7440
4 Ga0070690_100006096 3300005330 Bacteria 6825
5 Ga0070670_100016443 3300005331 Bacteria 6353
6 Ga0068869_100004873 3300005334 Bacteria 8393
7 Ga0070666_10007508 3300005335 Bacteria 6719
8 Ga0070680_100000673 3300005336 Bacteria 23756
9 Ga0070680_100027729 3300005336 Bacteria 4537
10 Ga0070682_100010276 3300005337 Bacteria 5310
11 Ga0068868_100004800 3300005338 Bacteria 9487
12 Ga0068868_100055765 3300005338 Bacteria 3119
13 Ga0070689_100000421 3300005340 Bacteria 24985
14 Ga0070689_100026563 3300005340 Bacteria 4359
15 Ga0070687_100014852 3300005343 Bacteria 3508
16 Ga0070692_10020938 3300005345 Bacteria 3177
17 Ga0070668_100018353 3300005347 Bacteria 5252
18 Ga0070669_100002847 3300005353 Bacteria 12500
19 Ga0070671_100005848 3300005355 Bacteria 9799
20 Ga0070674_100003651 3300005356 Bacteria 8668
21 Ga0070673_100147840 3300005364 Bacteria 1988
22 Ga0070659_100110244 3300005366 Bacteria 2221
23 Ga0070667_100041818 3300005367 Bacteria 3844
24 Ga0070709_10001819 3300005434 Bacteria 11569
25 Ga0070714_100001074 3300005435 Bacteria 19541
26 Ga0070701_10005050 3300005438 Bacteria 5416
27 Ga0070711_100027417 3300005439 Bacteria 3739
28 Ga0070705_100004895 3300005440 Bacteria 6523
29 Ga0070700_100071223 3300005441 Bacteria 2219
30 Ga0070678_100079555 3300005456 Bacteria 2480
31 Ga0070662_100005104 3300005457 Bacteria 8367
32 Ga0070662_100031204 3300005457 Bacteria 3738
33 Ga0070681_10002158 3300005458 Bacteria 17897
34 Ga0070681_10002323 3300005458 Bacteria 17390
35 Ga0070681_10011202 3300005458 Bacteria 8872
36 Ga0070681_10011416 3300005458 Bacteria 8792
37 Ga0068867_100005383 3300005459 Bacteria 9050
38 Ga0070685_10021714 3300005466 Bacteria 3491
39 Ga0070679_100002776 3300005530 Bacteria 15915
40 Ga0070684_100008616 3300005535 Bacteria 7988
41 Ga0070684_100031600 3300005535 Bacteria 4509
42 Ga0070672_100010784 3300005543 Bacteria 6350
43 Ga0070686_100017517 3300005544 Bacteria 4188
44 Ga0070686_100037868 3300005544 Bacteria 2995
45 Ga0070665_100001969 3300005548 Bacteria 23093
46 Ga0070665_100007096 3300005548 Bacteria 11382
47 Ga0070704_100058731 3300005549 Bacteria 2741
48 Ga0068855_100002194 3300005563 Bacteria 24134
49 Ga0068855_100005111 3300005563 Bacteria 15994
50 Ga0070664_100012096 3300005564 Bacteria 7012
51 Ga0068856_100014162 3300005614 Bacteria 7711
52 Ga0068856_100055066 3300005614 Bacteria 3925
53 Ga0070702_100000889 3300005615 Bacteria 11627
54 Ga0068859_100006199 3300005617 Bacteria 12150
55 Ga0068859_100039620 3300005617 Bacteria 4727
56 Ga0068859_100051931 3300005617 Bacteria 4122
57 Ga0068864_100001048 3300005618 Bacteria 23210
58 Ga0068864_100005181 3300005618 Bacteria 10674
59 Ga0068864_100043023 3300005618 Bacteria 3866
60 Ga0068861_100008134 3300005719 Bacteria 7216
61 Ga0068861_100008740 3300005719 Bacteria 6971
62 Ga0068861_100060391 3300005719 Bacteria 2905
63 Ga0068863_100001284 3300005841 Bacteria 25055
64 Ga0068863_100014230 3300005841 Bacteria 7665
65 Ga0068860_100008754 3300005843 Bacteria 10079
66 Ga0068862_100003806 3300005844 Bacteria 12852
67 Ga0068862_100065571 3300005844 Bacteria 3128
68 Ga0068862_100104548 3300005844 Bacteria 2481
69 Ga0070712_100182292 3300006175 Bacteria 1637
70 Ga0068871_100062420 3300006358 Bacteria 3045
71 Ga0075428_100001989 3300006844 Bacteria 22029
72 Ga0075428_100002919 3300006844 Bacteria 18617
73 Ga0075428_100058770 3300006844 Bacteria 4210
74 Ga0075430_100006465 3300006846 Bacteria 9873
75 Ga0075430_100031975 3300006846 Bacteria 4466
76 Ga0075430_100033935 3300006846 Bacteria 4330
77 Ga0075430_100058242 3300006846 Bacteria 3248
78 Ga0075431_100000077 3300006847 Bacteria 57475
79 Ga0075431_100009013 3300006847 Bacteria 10003
80 Ga0075431_100025947 3300006847 Bacteria 6006
81 Ga0075431_100131955 3300006847 Bacteria 2576
82 Ga0075433_10022914 3300006852 Bacteria 5249
83 Ga0075429_100002310 3300006880 Bacteria 16000
84 Ga0075429_100056708 3300006880 Bacteria 3410
85 Ga0075429_100113295 3300006880 Bacteria 2371
86 Ga0068865_100058794 3300006881 Bacteria 2687
87 Ga0097620_100006199 3300006931 Bacteria 12150
88 Ga0097620_100039621 3300006931 Bacteria 4727
89 Ga0097620_100051929 3300006931 Bacteria 4122
90 Ga0099794_10026932 3300007265 Bacteria 2661
91 Ga0099795_10000234 3300007788 Bacteria 9765
92 Ga0105240_10000760 3300009093 Bacteria 58925
93 Ga0105240_10002211 3300009093 Bacteria 31723
94 Ga0105240_10003744 3300009093 Bacteria 23493
95 Ga0105240_10006209 3300009093 Bacteria 17574
96 Ga0105240_10055209 3300009093 Bacteria 4974
97 Ga0105240_10143095 3300009093 Bacteria 2857
98 Ga0111539_10000277 3300009094 Bacteria 61362
99 Ga0105245_10028462 3300009098 Bacteria 4930
100 Ga0105247_10002275 3300009101 Bacteria 13179
101 Ga0105247_10008699 3300009101 Bacteria 6189
102 Ga0114129_10013156 3300009147 Bacteria 11791
103 Ga0105241_10055883 3300009174 Bacteria 3025
104 Ga0105242_10026563 3300009176 Bacteria 4589
105 Ga0105248_10005568 3300009177 Bacteria 13842
106 Ga0105237_10006046 3300009545 Bacteria 13544
107 Ga0105238_10002536 3300009551 Bacteria 18246
108 Ga0105238_10037348 3300009551 Bacteria 4938
109 Ga0099796_10009018 3300010159 Bacteria 2682
110 Ga0105239_10047083 3300010375 Bacteria 4725
111 Ga0105239_10061687 3300010375 Bacteria 4115
112 Ga0105239_10086120 3300010375 Bacteria 3463
113 Ga0105246_10001616 3300011119 Bacteria 13422
114 Ga0157370_10003740 3300013104 Bacteria 17787
115 Ga0157369_10185048 3300013105 Bacteria 2190
116 Ga0157374_10005450 3300013296 Bacteria 10690
117 Ga0157374_10156037 3300013296 Bacteria 2221
118 Ga0163162_10055176 3300013306 Bacteria 3999
119 Ga0157375_10103078 3300013308 Bacteria 2940
120 Ga0163163_10001355 3300014325 Bacteria 20667
121 Ga0163163_10004323 3300014325 Bacteria 12097
122 Ga0157380_10006498 3300014326 Bacteria 8241
123 Ga0157380_10093908 3300014326 Bacteria 2482
124 Ga0157379_10013381 3300014968 Bacteria 7186
125 Ga0157379_10193465 3300014968 Bacteria 1838
126 Ga0157376_10048739 3300014969 Bacteria 3505
127 Ga0207680_10016845 3300025903 Bacteria 3848
128 Ga0207699_10004009 3300025906 Bacteria 7044
129 Ga0207645_10000489 3300025907 Bacteria 32760
130 Ga0207643_10005459 3300025908 Bacteria 6798
131 Ga0207707_10000999 3300025912 Bacteria 27087
132 Ga0207695_10004603 3300025913 Bacteria 18730
133 Ga0207695_10011587 3300025913 Bacteria 10663
134 Ga0207695_10117196 3300025913 Bacteria 2636
135 Ga0207693_10005525 3300025915 Bacteria 10523
136 Ga0207663_10051347 3300025916 Bacteria 2567
137 Ga0207660_10004733 3300025917 Bacteria 8860
138 Ga0207660_10038417 3300025917 Bacteria 3342
139 Ga0207662_10003006 3300025918 Bacteria 8590
140 Ga0207649_10021193 3300025920 Bacteria 3736
141 Ga0207652_10007161 3300025921 Bacteria 8995
142 Ga0207650_10013677 3300025925 Bacteria 5625
143 Ga0207664_10004364 3300025929 Bacteria 9582
144 Ga0207706_10000907 3300025933 Bacteria 30444
145 Ga0207706_10000977 3300025933 Bacteria 29153
146 Ga0207704_10053041 3300025938 Bacteria 2462
147 Ga0207665_10033903 3300025939 Bacteria 3387
148 Ga0207691_10004423 3300025940 Bacteria 13619
149 Ga0207691_10076104 3300025940 Bacteria 3025
150 Ga0207689_10003936 3300025942 Bacteria 13518
151 Ga0207689_10138878 3300025942 Bacteria 2002
152 Ga0207679_10004394 3300025945 Bacteria 8779
153 Ga0207667_10001268 3300025949 Bacteria 31682
154 Ga0207667_10003353 3300025949 Bacteria 19766
155 Ga0207667_10080577 3300025949 Bacteria 3373
156 Ga0207651_10040848 3300025960 Bacteria 3074
157 Ga0207651_10047378 3300025960 Bacteria 2898
158 Ga0207658_10030298 3300025986 Bacteria 3829
159 Ga0207677_10012684 3300026023 Bacteria 4856
160 Ga0207703_10015377 3300026035 Bacteria 5969
161 Ga0207708_10010897 3300026075 Bacteria 6763
162 Ga0207708_10096438 3300026075 Bacteria 2285
163 Ga0207702_10160828 3300026078 Bacteria 2051
164 Ga0207641_10003243 3300026088 Bacteria 14524
165 Ga0207641_10012901 3300026088 Bacteria 6855
166 Ga0207648_10037022 3300026089 Bacteria 4298
167 Ga0207648_10159483 3300026089 Bacteria 1992
168 Ga0207676_10025170 3300026095 Bacteria 4414
169 Ga0207676_10029165 3300026095 Bacteria 4129
170 Ga0207674_10034145 3300026116 Bacteria 5320
171 Ga0207675_100000202 3300026118 Bacteria 55213
172 Ga0207675_100003149 3300026118 Bacteria 16180
173 Ga0207675_100003455 3300026118 Bacteria 15442
174 Ga0207675_100021232 3300026118 Bacteria 6048
175 Ga0207683_10127521 3300026121 Bacteria 2287
176 Ga0209179_1000418 3300027512 Bacteria 4235
177 Ga0209983_1001358 3300027665 Bacteria 5449
178 Ga0209588_1020289 3300027671 Bacteria 2081
179 Ga0207428_10016379 3300027907 Bacteria 6378
180 Ga0268266_10003005 3300028379 Bacteria 17351
181 Ga0268266_10062410 3300028379 Bacteria 3216
182 Ga0268265_10002616 3300028380 Bacteria 13383
183 Ga0268265_10003863 3300028380 Bacteria 10577
184 Ga0268265_10091613 3300028380 Bacteria 2431
185 Ga0268264_10079872 3300028381 Bacteria 2792
186 Ga0265318_10000024 3300028577 Bacteria 159801
187 Ga0265338_10002996 3300028800 Bacteria 24430
188 Ga0307511_10011888 3300030521 Bacteria 8564
189 Ga0265332_10041796 3300031238 Bacteria 1982
190 Ga0265328_10001015 3300031239 Bacteria 12917
191 Ga0265329_10002841 3300031242 Bacteria 7711
192 Ga0265331_10005683 3300031250 Bacteria 7487
193 Ga0265316_10012049 3300031344 Bacteria 7773
194 Ga0307509_10000001 3300031507 Bacteria 629324
195 Ga0307509_10000109 3300031507 Bacteria 117520
196 Ga0307408_100093187 3300031548 Bacteria 2278
197 Ga0265314_10017314 3300031711 Bacteria 5660
198 Ga0265342_10006594 3300031712 Bacteria 8626
199 Ga0307411_10076307 3300032005 Bacteria 2291
200 Ga0307510_10000018 3300033180 Bacteria 192986
201 Ga0373934_0046050 3300035086 Bacteria 1725
202 Ga0373936_0002344 3300035113 Bacteria 7086
203 Ga0373936_0003169 3300035113 Bacteria 6156
204 Ga0373955_0008764 3300035172 Bacteria 4710
205 Ga0373927_0014804 3300035695 Bacteria 5158
206 Ga0373937_0006172 3300036401 Bacteria 10319
207 Ga0373937_0064881 3300036401 Bacteria 3360
208 Ga0373937_0190911 3300036401 Bacteria 1925
209 Ga0373937_0226057 3300036401 Bacteria 1762
210 Ga0436363_0441792 3300039450 Bacteria 8029
211 Ga0450909_007425 3300042185 Bacteria 1587
212 Ga0466969_0002107 3300044656 Bacteria 10610
213 Ga0466961_0001050 3300044693 Bacteria 17009
214 Ga0466964_0001846 3300044706 Bacteria 7373
215 Ga0466971_0000216 3300044719 Bacteria 22087
216 Ga0466968_0027460 3300044735 Bacteria 2343
217 Ga0466970_0005778 3300044765 Bacteria 6149
218 Ga0466957_0013272 3300044842 Bacteria 4779
219 Ga0466959_0030233 3300045049 Bacteria 4011
220 Ga0451576_0080478 3300045051 Bacteria 3389
221 Ga0495638_0017571 3300046460 Bacteria 4766
222 Ga0495580_0000015 3300046472 Bacteria 94575
223 Ga0495580_0041108 3300046472 Bacteria 3298
224 Ga0495583_0026392 3300046506 Bacteria 2881
225 Ga0496104_0002001 3300048907 Bacteria 17686
226 Ga0496105_0000504 3300048908 Bacteria 25756
227 Ga0496107_0037254 3300048910 Bacteria 3490
228 Ga0496108_0049247 3300048911 Bacteria 3524
229 Ga0496109_0020711 3300048912 Bacteria 5808
230 Ga0496109_0058446 3300048912 Bacteria 3522
231 Ga0496110_0022106 3300048913 Bacteria 5395
232 Ga0496112_0018347 3300048915 Bacteria 6588
233 Ga0496112_0061555 3300048915 Bacteria 3700
234 Ga0496114_0001514 3300048917 Bacteria 17656
235 Ga0496115_0004457 3300048918 Bacteria 10148
236 Ga0496120_0000061 3300048923 Bacteria 172817
237 Ga0496126_0016341 3300048929 Bacteria 7424
238 Ga0501068_0000336 3300049584 Bacteria 23645
239 Ga0501069_0057338 3300049585 Bacteria 2171
240 Ga0501070_0002573 3300049586 Bacteria 15879
241 Ga0501071_0001594 3300049587 Bacteria 13292
242 Ga0501071_0010302 3300049587 Bacteria 6260
243 Ga0501072_0239708 3300049588 Bacteria 1444
244 Ga0501073_0003148 3300049589 Bacteria 12375
245 Ga0501074_0012536 3300049590 Bacteria 6163
246 Ga0501076_0009249 3300049592 Bacteria 7269
247 Ga0501076_0082697 3300049592 Bacteria 2578
248 Ga0501077_0000288 3300049593 Bacteria 29818
249 Ga0501079_0003630 3300049741 Bacteria 11360
250 Ga0501080_0003832 3300049742 Bacteria 13282
251 Ga0501081_0076327 3300049743 Bacteria 2340
252 Ga0501083_0005053 3300049744 Bacteria 9346
253 nmdc:mga05p37_15695_c1 3300050507 Bacteria 9104
254 nmdc:mga05p37_61171_c1 3300050507 Bacteria 4636
255 nmdc:mga09592_104289_c1 3300050508 Bacteria 2430
256 nmdc:mga09592_16496_c1 3300050508 Bacteria 6043
257 nmdc:mga09592_45511_c1 3300050508 Bacteria 3696
258 nmdc:mga09592_5545_c1 3300050508 Bacteria 10272
259 nmdc:mga0qj67_20641_c1 3300050509 Bacteria 5047
260 nmdc:mga0qj67_37402_c1 3300050509 Bacteria 3802
261 nmdc:mga0qj67_94836_c1 3300050509 Bacteria 2401
262 nmdc:mga06r32_10434_c1 3300050510 Bacteria 4609
263 nmdc:mga06r32_115_c1 3300050510 Bacteria 57898
264 nmdc:mga06r32_2849_c1 3300050510 Bacteria 15518
265 nmdc:mga06r32_8067_c1 3300050510 Bacteria 9476
266 nmdc:mga08y16_23466_c1 3300050511 Bacteria 6516
267 nmdc:mga08y16_266_c1 3300050511 Bacteria 47344
268 nmdc:mga0a205_45257_c1 3300050515 Bacteria 3944
269 Ga0495601_0039091 3300053077 Bacteria 2970
270 Ga0500616_0037011 3300053153 Bacteria 2644
271 Ga0500637_0020184 3300053178 Bacteria 3605
272 Ga0501084_0043627 3300054114 Bacteria 3751
273 Ga0501082_0073265 3300060353 Bacteria 2950

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049588 Ga0501072_0239708 Ga0501072_0239708_174_1427 417
2 3300025942 Ga0207689_10138878 Ga0207689_101388782 426
3 3300035172 Ga0373955_0008764 Ga0373955_0008764_17_1354 443
4 3300014968 Ga0157379_10193465 Ga0157379_101934652 448
5 3300042185 Ga0450909_007425 Ga0450909_007425_102_1490 450
6 3300050508 nmdc:mga09592_104289_c1 nmdc:mga09592_104289_c1_291_1679 450
7 3300050510 nmdc:mga06r32_8067_c1 nmdc:mga06r32_8067_c1_6713_8101 450
8 3300044656 Ga0466969_0002107 Ga0466969_0002107_199_1608 467
9 3300044693 Ga0466961_0001050 Ga0466961_0001050_6366_7775 467
10 3300044706 Ga0466964_0001846 Ga0466964_0001846_1895_3304 467
11 3300044719 Ga0466971_0000216 Ga0466971_0000216_4377_5786 467
12 3300044735 Ga0466968_0027460 Ga0466968_0027460_748_2157 467
13 3300044765 Ga0466970_0005778 Ga0466970_0005778_4221_5630 467
14 3300044842 Ga0466957_0013272 Ga0466957_0013272_1683_3092 467
15 3300045049 Ga0466959_0030233 Ga0466959_0030233_2536_3945 467
16 3300035113 Ga0373936_0003169 Ga0373936_0003169_211_1644 476
17 3300048923 Ga0496120_0000061 Ga0496120_0000061_20542_21978 476
18 3300053153 Ga0500616_0037011 Ga0500616_0037011_375_1820 480
19 3300046460 Ga0495638_0017571 Ga0495638_0017571_1168_2700 487
20 3300046506 Ga0495583_0026392 Ga0495583_0026392_965_2428 487
21 3300009093 Ga0105240_10003744 Ga0105240_1000374423 488
22 3300009093 Ga0105240_10055209 Ga0105240_100552094 488
23 3300009551 Ga0105238_10037348 Ga0105238_100373485 488
24 3300026089 Ga0207648_10037022 Ga0207648_100370223 488
25 3300048929 Ga0496126_0016341 Ga0496126_0016341_2867_4342 488
26 3300005330 Ga0070690_100006096 Ga0070690_1000060965 490
27 3300005331 Ga0070670_100016443 Ga0070670_1000164435 490
28 3300005335 Ga0070666_10007508 Ga0070666_100075086 490
29 3300005338 Ga0068868_100004800 Ga0068868_1000048005 490
30 3300005355 Ga0070671_100005848 Ga0070671_1000058483 490
31 3300005367 Ga0070667_100041818 Ga0070667_1000418182 490
32 3300005457 Ga0070662_100031204 Ga0070662_1000312042 490
33 3300005466 Ga0070685_10021714 Ga0070685_100217142 490
34 3300005548 Ga0070665_100007096 Ga0070665_10000709612 490
35 3300005564 Ga0070664_100012096 Ga0070664_1000120962 490
36 3300005617 Ga0068859_100051931 Ga0068859_1000519313 490
37 3300005618 Ga0068864_100001048 Ga0068864_1000010483 490
38 3300005841 Ga0068863_100001284 Ga0068863_1000012844 490
39 3300005843 Ga0068860_100008754 Ga0068860_1000087544 490
40 3300006358 Ga0068871_100062420 Ga0068871_1000624202 490
41 3300006931 Ga0097620_100051929 Ga0097620_1000519293 490
42 3300013308 Ga0157375_10103078 Ga0157375_101030782 490
43 3300014968 Ga0157379_10013381 Ga0157379_100133815 490
44 3300025925 Ga0207650_10013677 Ga0207650_100136772 490
45 3300025960 Ga0207651_10047378 Ga0207651_100473782 490
46 3300025986 Ga0207658_10030298 Ga0207658_100302983 490
47 3300026023 Ga0207677_10012684 Ga0207677_100126844 490
48 3300026035 Ga0207703_10015377 Ga0207703_100153773 490
49 3300026078 Ga0207702_10160828 Ga0207702_101608282 490
50 3300026088 Ga0207641_10003243 Ga0207641_100032433 490
51 3300045051 Ga0451576_0080478 Ga0451576_0080478_12_1490 490
52 3300048912 Ga0496109_0058446 Ga0496109_0058446_1599_3077 490
53 3300048915 Ga0496112_0061555 Ga0496112_0061555_441_1919 490
54 3300006844 Ga0075428_100002919 Ga0075428_1000029196 499
55 3300005364 Ga0070673_100147840 Ga0070673_1001478402 502
56 3300025960 Ga0207651_10040848 Ga0207651_100408483 502
57 3300006844 Ga0075428_100001989 Ga0075428_10000198915 503
58 3300006847 Ga0075431_100000077 Ga0075431_10000007712 503
59 3300006880 Ga0075429_100002310 Ga0075429_10000231012 503
60 3300009094 Ga0111539_10000277 Ga0111539_1000027710 503
61 3300009147 Ga0114129_10013156 Ga0114129_1001315613 503
62 3300050507 nmdc:mga05p37_61171_c1 nmdc:mga05p37_61171_c1_485_2044 503
63 3300050508 nmdc:mga09592_5545_c1 nmdc:mga09592_5545_c1_678_2237 503
64 3300050510 nmdc:mga06r32_115_c1 nmdc:mga06r32_115_c1_7159_8718 503
65 3300050511 nmdc:mga08y16_266_c1 nmdc:mga08y16_266_c1_39245_40804 503
66 3300009098 Ga0105245_10028462 Ga0105245_100284623 507
67 3300009101 Ga0105247_10002275 Ga0105247_1000227513 507
68 3300009177 Ga0105248_10005568 Ga0105248_100055682 507
69 3300010375 Ga0105239_10047083 Ga0105239_100470832 507
70 3300011119 Ga0105246_10001616 Ga0105246_100016163 507
71 3300013296 Ga0157374_10005450 Ga0157374_100054503 507
72 3300013306 Ga0163162_10055176 Ga0163162_100551762 507
73 3300014325 Ga0163163_10004323 Ga0163163_100043236 507
74 3300014969 Ga0157376_10048739 Ga0157376_100487392 507
75 3300036401 Ga0373937_0190911 Ga0373937_0190911_30_1571 507
76 3300048917 Ga0496114_0001514 Ga0496114_0001514_10957_12486 507
77 3300053077 Ga0495601_0039091 Ga0495601_0039091_563_2092 507
78 3300036401 Ga0373937_0006172 Ga0373937_0006172_4716_6251 508
79 3300049587 Ga0501071_0010302 Ga0501071_0010302_3128_4657 508
80 3300060353 Ga0501082_0073265 Ga0501082_0073265_842_2371 508
81 3300005334 Ga0068869_100004873 Ga0068869_1000048732 509
82 3300005336 Ga0070680_100000673 Ga0070680_10000067316 509
83 3300005337 Ga0070682_100010276 Ga0070682_1000102762 509
84 3300005338 Ga0068868_100055765 Ga0068868_1000557652 509
85 3300005340 Ga0070689_100000421 Ga0070689_1000004217 509
86 3300005340 Ga0070689_100026563 Ga0070689_1000265632 509
87 3300005343 Ga0070687_100014852 Ga0070687_1000148522 509
88 3300005345 Ga0070692_10020938 Ga0070692_100209383 509
89 3300005366 Ga0070659_100110244 Ga0070659_1001102442 509
90 3300005438 Ga0070701_10005050 Ga0070701_100050504 509
91 3300005440 Ga0070705_100004895 Ga0070705_1000048955 509
92 3300005441 Ga0070700_100071223 Ga0070700_1000712232 509
93 3300005456 Ga0070678_100079555 Ga0070678_1000795552 509
94 3300005458 Ga0070681_10002158 Ga0070681_100021586 509
95 3300005530 Ga0070679_100002776 Ga0070679_1000027766 509
96 3300005535 Ga0070684_100008616 Ga0070684_1000086165 509
97 3300005544 Ga0070686_100017517 Ga0070686_1000175173 509
98 3300005544 Ga0070686_100037868 Ga0070686_1000378683 509
99 3300005548 Ga0070665_100001969 Ga0070665_10000196912 509
100 3300005549 Ga0070704_100058731 Ga0070704_1000587313 509
101 3300005563 Ga0068855_100005111 Ga0068855_1000051116 509
102 3300005615 Ga0070702_100000889 Ga0070702_1000008894 509
103 3300005617 Ga0068859_100006199 Ga0068859_1000061996 509
104 3300005617 Ga0068859_100039620 Ga0068859_1000396202 509
105 3300005618 Ga0068864_100005181 Ga0068864_1000051818 509
106 3300005618 Ga0068864_100043023 Ga0068864_1000430232 509
107 3300005719 Ga0068861_100008134 Ga0068861_1000081342 509
108 3300005719 Ga0068861_100060391 Ga0068861_1000603913 509
109 3300005841 Ga0068863_100014230 Ga0068863_1000142308 509
110 3300005844 Ga0068862_100065571 Ga0068862_1000655712 509
111 3300005844 Ga0068862_100104548 Ga0068862_1001045483 509
112 3300006846 Ga0075430_100006465 Ga0075430_10000646511 509
113 3300006846 Ga0075430_100031975 Ga0075430_1000319752 509
114 3300006846 Ga0075430_100058242 Ga0075430_1000582422 509
115 3300006847 Ga0075431_100025947 Ga0075431_1000259478 509
116 3300006847 Ga0075431_100131955 Ga0075431_1001319552 509
117 3300006852 Ga0075433_10022914 Ga0075433_100229143 509
118 3300006880 Ga0075429_100056708 Ga0075429_1000567083 509
119 3300006881 Ga0068865_100058794 Ga0068865_1000587942 509
120 3300006931 Ga0097620_100006199 Ga0097620_1000061996 509
121 3300006931 Ga0097620_100039621 Ga0097620_1000396216 509
122 3300009093 Ga0105240_10000760 Ga0105240_100007606 509
123 3300009174 Ga0105241_10055883 Ga0105241_100558832 509
124 3300009551 Ga0105238_10002536 Ga0105238_1000253613 509
125 3300013104 Ga0157370_10003740 Ga0157370_100037406 509
126 3300014325 Ga0163163_10001355 Ga0163163_100013557 509
127 3300014326 Ga0157380_10093908 Ga0157380_100939082 509
128 3300025908 Ga0207643_10005459 Ga0207643_100054594 509
129 3300025912 Ga0207707_10000999 Ga0207707_100009997 509
130 3300025913 Ga0207695_10004603 Ga0207695_100046036 509
131 3300025917 Ga0207660_10004733 Ga0207660_100047334 509
132 3300025917 Ga0207660_10038417 Ga0207660_100384173 509
133 3300025918 Ga0207662_10003006 Ga0207662_100030065 509
134 3300025920 Ga0207649_10021193 Ga0207649_100211933 509
135 3300025921 Ga0207652_10007161 Ga0207652_100071615 509
136 3300025933 Ga0207706_10000907 Ga0207706_100009072 509
137 3300025938 Ga0207704_10053041 Ga0207704_100530412 509
138 3300025940 Ga0207691_10076104 Ga0207691_100761042 509
139 3300025942 Ga0207689_10003936 Ga0207689_100039365 509
140 3300025945 Ga0207679_10004394 Ga0207679_100043942 509
141 3300025949 Ga0207667_10003353 Ga0207667_1000335311 509
142 3300026075 Ga0207708_10010897 Ga0207708_100108975 509
143 3300026075 Ga0207708_10096438 Ga0207708_100964382 509
144 3300026088 Ga0207641_10012901 Ga0207641_100129015 509
145 3300026095 Ga0207676_10025170 Ga0207676_100251702 509
146 3300026095 Ga0207676_10029165 Ga0207676_100291654 509
147 3300026116 Ga0207674_10034145 Ga0207674_100341452 509
148 3300026118 Ga0207675_100003149 Ga0207675_1000031497 509
149 3300026118 Ga0207675_100003455 Ga0207675_1000034555 509
150 3300026118 Ga0207675_100021232 Ga0207675_1000212322 509
151 3300026121 Ga0207683_10127521 Ga0207683_101275212 509
152 3300027907 Ga0207428_10016379 Ga0207428_100163794 509
153 3300028379 Ga0268266_10003005 Ga0268266_100030058 509
154 3300028380 Ga0268265_10002616 Ga0268265_100026163 509
155 3300028380 Ga0268265_10091613 Ga0268265_100916132 509
156 3300028381 Ga0268264_10079872 Ga0268264_100798722 509
157 3300031507 Ga0307509_10000109 Ga0307509_1000010993 509
158 3300031548 Ga0307408_100093187 Ga0307408_1000931872 509
159 3300032005 Ga0307411_10076307 Ga0307411_100763072 509
160 3300049584 Ga0501068_0000336 Ga0501068_0000336_19924_21453 509
161 3300049585 Ga0501069_0057338 Ga0501069_0057338_523_2052 509
162 3300049586 Ga0501070_0002573 Ga0501070_0002573_12995_14524 509
163 3300049587 Ga0501071_0001594 Ga0501071_0001594_10927_12456 509
164 3300049589 Ga0501073_0003148 Ga0501073_0003148_8650_10179 509
165 3300049590 Ga0501074_0012536 Ga0501074_0012536_1466_2995 509
166 3300049592 Ga0501076_0009249 Ga0501076_0009249_4181_5710 509
167 3300049593 Ga0501077_0000288 Ga0501077_0000288_26863_28392 509
168 3300049741 Ga0501079_0003630 Ga0501079_0003630_6755_8284 509
169 3300049742 Ga0501080_0003832 Ga0501080_0003832_6979_8508 509
170 3300049743 Ga0501081_0076327 Ga0501081_0076327_649_2178 509
171 3300049744 Ga0501083_0005053 Ga0501083_0005053_1866_3395 509
172 3300050507 nmdc:mga05p37_15695_c1 nmdc:mga05p37_15695_c1_5930_7489 509
173 3300050508 nmdc:mga09592_16496_c1 nmdc:mga09592_16496_c1_2869_4428 509
174 3300050508 nmdc:mga09592_45511_c1 nmdc:mga09592_45511_c1_1331_2890 509
175 3300050509 nmdc:mga0qj67_20641_c1 nmdc:mga0qj67_20641_c1_2483_4042 509
176 3300050509 nmdc:mga0qj67_37402_c1 nmdc:mga0qj67_37402_c1_2087_3646 509
177 3300050509 nmdc:mga0qj67_94836_c1 nmdc:mga0qj67_94836_c1_122_1681 509
178 3300050510 nmdc:mga06r32_10434_c1 nmdc:mga06r32_10434_c1_1141_2700 509
179 3300050510 nmdc:mga06r32_2849_c1 nmdc:mga06r32_2849_c1_10047_11606 509
180 3300050511 nmdc:mga08y16_23466_c1 nmdc:mga08y16_23466_c1_1914_3446 509
181 3300050515 nmdc:mga0a205_45257_c1 nmdc:mga0a205_45257_c1_288_1823 509
182 3300054114 Ga0501084_0043627 Ga0501084_0043627_1406_2935 509
183 3300005328 Ga0070676_10004351 Ga0070676_100043514 510
184 3300005347 Ga0070668_100018353 Ga0070668_1000183533 510
185 3300005353 Ga0070669_100002847 Ga0070669_1000028476 510
186 3300005356 Ga0070674_100003651 Ga0070674_1000036513 510
187 3300005434 Ga0070709_10001819 Ga0070709_100018195 510
188 3300005435 Ga0070714_100001074 Ga0070714_1000010742 510
189 3300005457 Ga0070662_100005104 Ga0070662_1000051047 510
190 3300005458 Ga0070681_10002323 Ga0070681_100023236 510
191 3300005459 Ga0068867_100005383 Ga0068867_1000053835 510
192 3300005543 Ga0070672_100010784 Ga0070672_1000107844 510
193 3300005614 Ga0068856_100055066 Ga0068856_1000550662 510
194 3300005719 Ga0068861_100008740 Ga0068861_1000087403 510
195 3300005844 Ga0068862_100003806 Ga0068862_1000038069 510
196 3300006844 Ga0075428_100058770 Ga0075428_1000587703 510
197 3300006846 Ga0075430_100033935 Ga0075430_1000339353 510
198 3300006847 Ga0075431_100009013 Ga0075431_1000090133 510
199 3300006880 Ga0075429_100113295 Ga0075429_1001132953 510
200 3300009093 Ga0105240_10143095 Ga0105240_101430952 510
201 3300010375 Ga0105239_10061687 Ga0105239_100616872 510
202 3300014326 Ga0157380_10006498 Ga0157380_100064987 510
203 3300025906 Ga0207699_10004009 Ga0207699_100040092 510
204 3300025907 Ga0207645_10000489 Ga0207645_1000048919 510
205 3300025913 Ga0207695_10117196 Ga0207695_101171962 510
206 3300025929 Ga0207664_10004364 Ga0207664_100043646 510
207 3300025933 Ga0207706_10000977 Ga0207706_100009777 510
208 3300025940 Ga0207691_10004423 Ga0207691_100044238 510
209 3300026118 Ga0207675_100000202 Ga0207675_1000002027 510
210 3300027665 Ga0209983_1001358 Ga0209983_10013582 510
211 3300028380 Ga0268265_10003863 Ga0268265_100038633 510
212 3300031507 Ga0307509_10000001 Ga0307509_10000001278 510
213 3300035086 Ga0373934_0046050 Ga0373934_0046050_69_1604 510
214 3300036401 Ga0373937_0064881 Ga0373937_0064881_335_1870 510
215 3300036401 Ga0373937_0226057 Ga0373937_0226057_48_1610 510
216 3300005336 Ga0070680_100027729 Ga0070680_1000277292 511
217 3300005439 Ga0070711_100027417 Ga0070711_1000274172 511
218 3300005458 Ga0070681_10011202 Ga0070681_100112023 511
219 3300005458 Ga0070681_10011416 Ga0070681_100114167 511
220 3300005535 Ga0070684_100031600 Ga0070684_1000316003 511
221 3300005563 Ga0068855_100002194 Ga0068855_10000219410 511
222 3300005614 Ga0068856_100014162 Ga0068856_1000141623 511
223 3300006175 Ga0070712_100182292 Ga0070712_1001822921 511
224 3300007265 Ga0099794_10026932 Ga0099794_100269322 511
225 3300007788 Ga0099795_10000234 Ga0099795_100002343 511
226 3300009093 Ga0105240_10002211 Ga0105240_1000221126 511
227 3300009093 Ga0105240_10006209 Ga0105240_100062093 511
228 3300009101 Ga0105247_10008699 Ga0105247_100086997 511
229 3300009176 Ga0105242_10026563 Ga0105242_100265632 511
230 3300009545 Ga0105237_10006046 Ga0105237_1000604613 511
231 3300010159 Ga0099796_10009018 Ga0099796_100090182 511
232 3300010375 Ga0105239_10086120 Ga0105239_100861204 511
233 3300013105 Ga0157369_10185048 Ga0157369_101850482 511
234 3300013296 Ga0157374_10156037 Ga0157374_101560372 511
235 3300025903 Ga0207680_10016845 Ga0207680_100168453 511
236 3300025913 Ga0207695_10011587 Ga0207695_100115875 511
237 3300025915 Ga0207693_10005525 Ga0207693_100055253 511
238 3300025916 Ga0207663_10051347 Ga0207663_100513472 511
239 3300025939 Ga0207665_10033903 Ga0207665_100339032 511
240 3300025949 Ga0207667_10001268 Ga0207667_1000126817 511
241 3300025949 Ga0207667_10080577 Ga0207667_100805772 511
242 3300026089 Ga0207648_10159483 Ga0207648_101594832 511
243 3300027512 Ga0209179_1000418 Ga0209179_10004182 511
244 3300027671 Ga0209588_1020289 Ga0209588_10202892 511
245 3300028379 Ga0268266_10062410 Ga0268266_100624102 511
246 3300028577 Ga0265318_10000024 Ga0265318_10000024119 511
247 3300028800 Ga0265338_10002996 Ga0265338_1000299613 511
248 3300030521 Ga0307511_10011888 Ga0307511_100118885 511
249 3300031238 Ga0265332_10041796 Ga0265332_100417962 511
250 3300031239 Ga0265328_10001015 Ga0265328_1000101510 511
251 3300031242 Ga0265329_10002841 Ga0265329_100028415 511
252 3300031250 Ga0265331_10005683 Ga0265331_100056836 511
253 3300031344 Ga0265316_10012049 Ga0265316_100120495 511
254 3300031711 Ga0265314_10017314 Ga0265314_100173142 511
255 3300031712 Ga0265342_10006594 Ga0265342_100065945 511
256 3300033180 Ga0307510_10000018 Ga0307510_1000001885 511
257 3300035113 Ga0373936_0002344 Ga0373936_0002344_2754_4292 511
258 3300035695 Ga0373927_0014804 Ga0373927_0014804_650_2188 511
259 3300039450 Ga0436363_0441792 Ga0436363_0441792_4967_6505 511
260 3300046472 Ga0495580_0000015 Ga0495580_0000015_23002_24540 511
261 3300046472 Ga0495580_0041108 Ga0495580_0041108_1177_2715 511
262 3300048907 Ga0496104_0002001 Ga0496104_0002001_7986_9551 511
263 3300048908 Ga0496105_0000504 Ga0496105_0000504_18823_20388 511
264 3300048910 Ga0496107_0037254 Ga0496107_0037254_456_1994 511
265 3300048911 Ga0496108_0049247 Ga0496108_0049247_1452_2990 511
266 3300048912 Ga0496109_0020711 Ga0496109_0020711_3979_5517 511
267 3300048913 Ga0496110_0022106 Ga0496110_0022106_1326_2864 511
268 3300048915 Ga0496112_0018347 Ga0496112_0018347_2409_3947 511
269 3300048918 Ga0496115_0004457 Ga0496115_0004457_5369_6934 511
270 3300049592 Ga0501076_0082697 Ga0501076_0082697_350_1924 511
271 3300053178 Ga0500637_0020184 Ga0500637_0020184_1447_2985 511
272 2162886007 SwRhRL2b_contig_365350 SwRhRL2b_0592.00009820 512
273 3300005289 Ga0065704_10000717 Ga0065704_1000071710 512

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00346

Complex1_49kDa

Respiratory-chain NADH dehydrogenase, 49 Kd subunit

281

457

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zjl-assembly1.cif.gz_4 respiratory complex i from thermus thermophilus, nad+ dataset, major state 0.9322 189 512
7o6y-assembly1.cif.gz_C cryo-em structure of respiratory complex i under turnover 0.9305 194 509
7zm7-assembly1.cif.gz_C cryoem structure of mitochondrial complex i from chaetomium thermophilum (inhibited by ddm) 0.9303 194 509
6u8y-assembly1.cif.gz_l structure of the membrane-bound sulfane sulfur reductase (mbs), an archaeal respiratory membrane complex 0.9302 189 512
6yj4-assembly1.cif.gz_D structure of yarrowia lipolytica complex i at 2.7 a 0.9293 194 512
ID Description Score Start End Superfamily
af_P16431_180_537_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9616 190 508 1.10.645.10
af_Q58433_9_368_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9526 194 509 1.10.645.10
af_Q57935_5_362_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9311 189 509 1.10.645.10
af_P9WJH5_38_440_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9279 189 509 1.10.645.10
af_P56753_10_393_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9173 189 512 1.10.645.10
ID Description Score Start End GO Terms
AF-A0A6N9R9H2-F1-model_v4 Ni,Fe-hydrogenase III large subunit 0.9754 211 512 GO:0016651
GO:0048038
GO:0051287
AF-A0A6N9R9H2-F1-model_v4 Ni,Fe-hydrogenase III large subunit 0.9722 211 512 GO:0016651
GO:0048038
GO:0051287
AF-T1B8V6-F1-model_v4 NADH dehydrogenase (Ubiquinone) 30 kDa subunit 0.9713 276 442 GO:0016651
GO:0048038
GO:0051287
AF-A0A0B0PWL7-F1-model_v4 Carbon monoxide-induced hydrogenase 0.9659 189 433 GO:0016151
GO:0016651
GO:0048038
GO:0051287
AF-A0A7J3FCD5-F1-model_v4 NADH:ubiquinone oxidoreductase 0.9658 190 508 GO:0008901
GO:0016151
GO:0016651
GO:0048038
GO:0051287

Feature Viewer

pLDDT pTM Quality
82.25 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map