F378955

General Info

Members Datasets Scaffolds Average Seq Length
273 166 546 451

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100100352|Ga0068871_1001003523
Length 483
Sequence VHSLFSAFKYPFGHKTQHMKKTLIIAISFLFVTHGFSQNEDSVMIKKISDEILTNGKAYDNLHYLTKQIGGRLSGSPQMVKAEKWGVELMKASGADKAWLQECMVPHWVRGGKDKAQATYNSAVKGARNLLLHDKELDVLALGNSQGTKNKALTAKVVLVNSFDELEKKKDSLKGMIVFYNYKFNSTYVQTFRSYGEASQYRGAGPSRAAKYGAAAVIVRSMSHSADNNPHTGATRYDTTYAKIPALAVGLRDADWLSDQIQQNKIISLTIKTNAHFLPDTIGHNVIGELTGSEFPDEIITIGGHLDSWDPAEGAHDDGAGVVHTIEILRAFKALGIKPKHTIRFVLFMNEENGLRGGAKYAEEAKAKNEKHIFALESDAGGFTPRSFSFGGSPEQLKKLQSWVSLLYPYGVYEITNGGGGADIGPLNRTFKTPVAELGPDSQRYFDYHHARNDVFENVNKRELELGAVNMAALIYLIDKYGL

Samples

Sample ID Description Type Environment
1 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
108 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
123 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
124 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
137 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
138 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
139 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
140 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
141 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
142 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
143 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
144 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
145 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
146 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
147 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
148 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
160 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
161 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
162 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
163 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
164 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.56
Nodule 0
Rhizoplane 0
Rhizosphere 94.14
Stem 0
Stem Tuber 0
Unclassified 8.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068871_100100352 3300006358 Bacteria 2424
2 JGI24751J29686_10003826 3300002459 Bacteria 3037
3 rootH1_10052076 3300003316 Bacteria 2793
4 rootL2_10001282 3300003322 Bacteria 10645
5 rootL2_10285495 3300003322 Bacteria 4116
6 Ga0065704_10105663 3300005289 Bacteria 2104
7 Ga0065712_10109776 3300005290 Bacteria 1837
8 Ga0065715_10116463 3300005293 Bacteria 2380
9 Ga0070658_10000176 3300005327 Bacteria 56043
10 Ga0070676_10000034 3300005328 Bacteria 41415
11 Ga0070676_10005918 3300005328 Bacteria 6528
12 Ga0070683_100002536 3300005329 Bacteria 14576
13 Ga0070690_100033819 3300005330 Unclassified 3202
14 Ga0070670_100015951 3300005331 Bacteria 6446
15 Ga0070670_100024086 3300005331 Bacteria 5236
16 Ga0070670_100051725 3300005331 Bacteria 3527
17 Ga0068869_100021715 3300005334 Bacteria 4418
18 Ga0068869_100026132 3300005334 Bacteria 4061
19 Ga0070666_10000431 3300005335 Bacteria 25787
20 Ga0068868_100008188 3300005338 Bacteria 7478
21 Ga0070689_100028266 3300005340 Bacteria 4237
22 Ga0070687_100006118 3300005343 Bacteria 4915
23 Ga0070668_100000087 3300005347 Bacteria 57426
24 Ga0070668_100004850 3300005347 Bacteria 9964
25 Ga0070668_100056628 3300005347 Bacteria 3028
26 Ga0070669_100023291 3300005353 Bacteria 4434
27 Ga0070675_100128555 3300005354 Bacteria 2157
28 Ga0070674_100009316 3300005356 Bacteria 5878
29 Ga0070674_100054106 3300005356 Unclassified 2774
30 Ga0070674_100065255 3300005356 Bacteria 2555
31 Ga0070674_100155944 3300005356 Bacteria 1728
32 Ga0070673_100000074 3300005364 Bacteria 42660
33 Ga0070673_100006246 3300005364 Bacteria 7725
34 Ga0070673_100052433 3300005364 Bacteria 3200
35 Ga0070673_100052559 3300005364 Bacteria 3197
36 Ga0070673_100138324 3300005364 Bacteria 2052
37 Ga0070688_100010924 3300005365 Bacteria 5028
38 Ga0070667_100000031 3300005367 Bacteria 177447
39 Ga0070667_100025990 3300005367 Bacteria 4870
40 Ga0070701_10057465 3300005438 Bacteria 2039
41 Ga0070678_100002885 3300005456 Bacteria 9515
42 Ga0068867_100007209 3300005459 Bacteria 7860
43 Ga0068867_100113720 3300005459 Bacteria 2083
44 Ga0068867_100157724 3300005459 Bacteria 1788
45 Ga0068867_100187738 3300005459 Unclassified 1647
46 Ga0070685_10028792 3300005466 Bacteria 3081
47 Ga0070698_100008254 3300005471 Bacteria 11260
48 Ga0070698_100031236 3300005471 Bacteria 5521
49 Ga0068853_100011672 3300005539 Bacteria 7140
50 Ga0068853_100018897 3300005539 Bacteria 5709
51 Ga0068853_100033787 3300005539 Bacteria 4338
52 Ga0070672_100000002 3300005543 Bacteria 159809
53 Ga0070672_100002698 3300005543 Bacteria 11352
54 Ga0070672_100135956 3300005543 Bacteria 2024
55 Ga0070665_100000222 3300005548 Bacteria 94961
56 Ga0070665_100010164 3300005548 Bacteria 9518
57 Ga0068855_100026121 3300005563 Bacteria 6986
58 Ga0068859_100005979 3300005617 Bacteria 12358
59 Ga0068859_100017266 3300005617 Bacteria 7246
60 Ga0068866_10005336 3300005718 Bacteria 5299
61 Ga0068861_100010883 3300005719 Bacteria 6320
62 Ga0068861_100042941 3300005719 Bacteria 3390
63 Ga0068851_10000266 3300005834 Bacteria 24602
64 Ga0068870_10006683 3300005840 Bacteria 5100
65 Ga0068863_100004520 3300005841 Bacteria 13723
66 Ga0068863_100008926 3300005841 Bacteria 9789
67 Ga0068863_100026031 3300005841 Bacteria 5582
68 Ga0068863_100153838 3300005841 Bacteria 2201
69 Ga0068858_100001512 3300005842 Bacteria 23886
70 Ga0068860_100072596 3300005843 Unclassified 3271
71 Ga0081539_10025864 3300005985 Bacteria 3762
72 Ga0097621_100000691 3300006237 Bacteria 23650
73 Ga0097621_100008450 3300006237 Bacteria 7417
74 Ga0097621_100009845 3300006237 Bacteria 6959
75 Ga0068871_100002873 3300006358 Bacteria 11809
76 Ga0068871_100009260 3300006358 Bacteria 7124
77 Ga0068871_100055708 3300006358 Bacteria 3211
78 Ga0068871_100073610 3300006358 Bacteria 2817
79 Ga0075428_100002129 3300006844 Bacteria 21365
80 Ga0075428_100004442 3300006844 Bacteria 15481
81 Ga0075430_100012472 3300006846 Bacteria 7233
82 Ga0075430_100016854 3300006846 Bacteria 6223
83 Ga0075431_100011013 3300006847 Bacteria 9103
84 Ga0075431_100050638 3300006847 Bacteria 4282
85 Ga0075434_100136723 3300006871 Bacteria 2470
86 Ga0075429_100004992 3300006880 Bacteria 11424
87 Ga0068865_100033163 3300006881 Bacteria 3455
88 Ga0097620_100017266 3300006931 Bacteria 7246
89 Ga0105240_10001361 3300009093 Bacteria 41976
90 Ga0105240_10078802 3300009093 Bacteria 4056
91 Ga0111539_10002597 3300009094 Bacteria 23925
92 Ga0111539_10087356 3300009094 Unclassified 3663
93 Ga0111539_10087915 3300009094 Bacteria 3651
94 Ga0111539_10132676 3300009094 Bacteria 2917
95 Ga0105247_10109100 3300009101 Bacteria 1779
96 Ga0114129_10076733 3300009147 Bacteria 4651
97 Ga0105241_10063931 3300009174 Bacteria 2840
98 Ga0105242_10005938 3300009176 Bacteria 9420
99 Ga0105242_10008165 3300009176 Bacteria 8050
100 Ga0105242_10039978 3300009176 Bacteria 3778
101 Ga0105242_10059437 3300009176 Bacteria 3136
102 Ga0105249_10002226 3300009553 Bacteria 16804
103 Ga0105249_10003042 3300009553 Bacteria 14469
104 Ga0105249_10006302 3300009553 Bacteria 10308
105 Ga0157371_10269889 3300013102 Bacteria 1228
106 Ga0157371_10315264 3300013102 Unclassified 1134
107 Ga0157374_10000074 3300013296 Bacteria 99947
108 Ga0157374_10008894 3300013296 Bacteria 8601
109 Ga0157378_10005674 3300013297 Bacteria 10920
110 Ga0157378_10064919 3300013297 Bacteria 3266
111 Ga0157378_10097950 3300013297 Bacteria 2673
112 Ga0163162_10000029 3300013306 Bacteria 168510
113 Ga0163162_10005911 3300013306 Bacteria 11839
114 Ga0163162_10039038 3300013306 Bacteria 4741
115 Ga0163162_10127199 3300013306 Bacteria 2655
116 Ga0157372_10060027 3300013307 Bacteria 4255
117 Ga0157372_10067019 3300013307 Unclassified 4033
118 Ga0157372_10155359 3300013307 Unclassified 2642
119 Ga0157372_10247188 3300013307 Bacteria 2070
120 Ga0157375_10000042 3300013308 Bacteria 160008
121 Ga0157375_10023948 3300013308 Bacteria 5642
122 Ga0157375_10085763 3300013308 Bacteria 3199
123 Ga0157375_10202039 3300013308 Bacteria 2143
124 Ga0163163_10000174 3300014325 Bacteria 67568
125 Ga0163163_10030768 3300014325 Bacteria 5176
126 Ga0157377_10123306 3300014745 Bacteria 1573
127 Ga0157379_10000080 3300014968 Bacteria 63139
128 Ga0157379_10155403 3300014968 Unclassified 2063
129 Ga0157376_10000521 3300014969 Bacteria 24829
130 Ga0157376_10079031 3300014969 Bacteria 2819
131 Ga0163161_10016307 3300017792 Bacteria 5186
132 Ga0207697_10011915 3300025315 Bacteria 3662
133 Ga0207656_10001176 3300025321 Bacteria 8616
134 Ga0207645_10002278 3300025907 Bacteria 15224
135 Ga0207645_10005443 3300025907 Bacteria 9224
136 Ga0207643_10003128 3300025908 Bacteria 8906
137 Ga0207705_10001116 3300025909 Bacteria 21828
138 Ga0207695_10000431 3300025913 Bacteria 91965
139 Ga0207662_10011253 3300025918 Bacteria 4954
140 Ga0207662_10012705 3300025918 Bacteria 4693
141 Ga0207662_10023866 3300025918 Unclassified 3516
142 Ga0207650_10121909 3300025925 Bacteria 2031
143 Ga0207659_10002122 3300025926 Bacteria 11750
144 Ga0207659_10141424 3300025926 Bacteria 1868
145 Ga0207686_10002663 3300025934 Bacteria 9686
146 Ga0207686_10028947 3300025934 Bacteria 3262
147 Ga0207669_10003839 3300025937 Bacteria 6548
148 Ga0207704_10017822 3300025938 Bacteria 3693
149 Ga0207691_10000004 3300025940 Bacteria 168729
150 Ga0207691_10005078 3300025940 Bacteria 12705
151 Ga0207691_10014368 3300025940 Bacteria 7548
152 Ga0207691_10022119 3300025940 Bacteria 5999
153 Ga0207691_10040789 3300025940 Bacteria 4289
154 Ga0207691_10224311 3300025940 Bacteria 1629
155 Ga0207689_10001010 3300025942 Bacteria 27038
156 Ga0207689_10003497 3300025942 Bacteria 14356
157 Ga0207689_10020206 3300025942 Bacteria 5609
158 Ga0207689_10033109 3300025942 Bacteria 4294
159 Ga0207689_10065050 3300025942 Bacteria 3000
160 Ga0207689_10081788 3300025942 Bacteria 2655
161 Ga0207689_10130226 3300025942 Bacteria 2070
162 Ga0207679_10093679 3300025945 Unclassified 2330
163 Ga0207651_10169298 3300025960 Unclassified 1721
164 Ga0207712_10001318 3300025961 Bacteria 17023
165 Ga0207712_10014943 3300025961 Bacteria 5001
166 Ga0207712_10059096 3300025961 Bacteria 2712
167 Ga0207668_10001201 3300025972 Bacteria 15384
168 Ga0207640_10078344 3300025981 Bacteria 2249
169 Ga0207658_10000059 3300025986 Bacteria 121530
170 Ga0207677_10004077 3300026023 Bacteria 7808
171 Ga0207677_10008024 3300026023 Bacteria 5875
172 Ga0207677_10079629 3300026023 Bacteria 2344
173 Ga0207677_10136443 3300026023 Unclassified 1871
174 Ga0207703_10003800 3300026035 Bacteria 12542
175 Ga0207639_10074881 3300026041 Bacteria 2660
176 Ga0207678_10203735 3300026067 Bacteria 1692
177 Ga0207708_10040621 3300026075 Bacteria 3546
178 Ga0207641_10002750 3300026088 Bacteria 16046
179 Ga0207641_10003172 3300026088 Bacteria 14709
180 Ga0207648_10001709 3300026089 Bacteria 24030
181 Ga0207648_10014174 3300026089 Bacteria 7371
182 Ga0207648_10018228 3300026089 Bacteria 6359
183 Ga0207648_10021501 3300026089 Bacteria 5799
184 Ga0207648_10097919 3300026089 Bacteria 2567
185 Ga0207676_10002009 3300026095 Bacteria 14820
186 Ga0207676_10033102 3300026095 Bacteria 3903
187 Ga0207674_10019675 3300026116 Bacteria 7311
188 Ga0207675_100002556 3300026118 Bacteria 18017
189 Ga0207675_100019313 3300026118 Bacteria 6359
190 Ga0207675_100049618 3300026118 Bacteria 3916
191 Ga0207683_10000974 3300026121 Bacteria 26229
192 Ga0207428_10004445 3300027907 Bacteria 13324
193 Ga0268266_10006335 3300028379 Bacteria 10848
194 Ga0307515_10000001 3300028794 Bacteria 4259510
195 Ga0265327_10002077 3300031251 Bacteria 22378
196 Ga0265327_10012349 3300031251 Bacteria 5773
197 Ga0307509_10023546 3300031507 Bacteria 6909
198 Ga0307408_100018888 3300031548 Bacteria 4635
199 Ga0265313_10040731 3300031595 Bacteria 2293
200 Ga0307508_10001710 3300031616 Bacteria 24355
201 Ga0307516_10000665 3300031730 Bacteria 46476
202 Ga0307406_10017223 3300031901 Unclassified 4207
203 Ga0307412_10013164 3300031911 Bacteria 4842
204 Ga0307415_100025429 3300032126 Unclassified 3715
205 Ga0307507_10063139 3300033179 Bacteria 3432
206 Ga0373924_0004695 3300035410 Bacteria 4794
207 Ga0373937_0009340 3300036401 Bacteria 8516
208 Ga0373937_0072969 3300036401 Bacteria 3166
209 Ga0439457_000276 3300042014 Bacteria 14138
210 Ga0451577_0000103 3300042876 Bacteria 186594
211 Ga0466972_0000104 3300044658 Bacteria 73886
212 Ga0466957_0007502 3300044842 Bacteria 6163
213 Ga0495592_0056455 3300046454 Bacteria 2902
214 Ga0495638_0075579 3300046460 Bacteria 2053
215 Ga0495653_0015741 3300046463 Bacteria 6166
216 Ga0495672_0020338 3300047320 Bacteria 4354
217 Ga0495672_0084804 3300047320 Bacteria 1757
218 Ga0501292_000303 3300049515 Bacteria 6872
219 Ga0501297_001774 3300049520 Unclassified 2022
220 Ga0501031_0006578 3300049568 Bacteria 7583
221 Ga0501032_0006571 3300049569 Bacteria 8539
222 Ga0501034_0120790 3300049571 Bacteria 2606
223 Ga0501036_0044598 3300049572 Bacteria 3756
224 Ga0501037_0013337 3300049573 Bacteria 6057
225 Ga0501037_0029050 3300049573 Unclassified 4084
226 Ga0501038_0027154 3300049574 Bacteria 5095
227 Ga0501043_0036498 3300049579 Bacteria 3867
228 Ga0501046_0106613 3300049580 Unclassified 2144
229 Ga0501047_0042863 3300049581 Bacteria 4372
230 Ga0501048_0012526 3300049582 Bacteria 6311
231 Ga0501073_0132160 3300049589 Unclassified 1730
232 Ga0501201_001678 3300049651 Unclassified 2061
233 Ga0501202_000293 3300049652 Bacteria 6851
234 Ga0501207_000913 3300049654 Bacteria 3551
235 Ga0501222_001303 3300049662 Bacteria 3500
236 Ga0501223_002463 3300049663 Bacteria 4108
237 Ga0501224_000729 3300049664 Bacteria 4129
238 Ga0501228_004439 3300049666 Bacteria 1202
239 Ga0501243_006256 3300049675 Bacteria 1802
240 Ga0501243_007207 3300049675 Unclassified 1697
241 Ga0501259_000503 3300049688 Bacteria 6275
242 Ga0501259_001492 3300049688 Bacteria 3888
243 Ga0501221_000588 3300049704 Bacteria 5798
244 Ga0501225_0001961 3300049705 Bacteria 6434
245 Ga0501234_001095 3300049707 Unclassified 4284
246 Ga0501245_002893 3300049708 Bacteria 2308
247 Ga0501083_0018627 3300049744 Bacteria 4837
248 Ga0501266_001338 3300049763 Bacteria 3143
249 Ga0501035_0006054 3300049822 Bacteria 11393
250 Ga0501035_0197530 3300049822 Bacteria 1727
251 Ga0501044_0069414 3300049823 Bacteria 3587
252 Ga0501044_0134030 3300049823 Bacteria 2469
253 Ga0501045_0149785 3300049824 Bacteria 1736
254 nmdc:mga09592_185754_c1 3300050508 Bacteria 1799
255 nmdc:mga09592_9012_c1 3300050508 Bacteria 8112
256 nmdc:mga0qj67_11771_c1 3300050509 Bacteria 6566
257 nmdc:mga0qj67_42508_c1 3300050509 Bacteria 3578
258 nmdc:mga06r32_229957_c1 3300050510 Bacteria 1842
259 nmdc:mga06r32_66489_c1 3300050510 Bacteria 3478
260 nmdc:mga08y16_11798_c1 3300050511 Bacteria 9180
261 nmdc:mga08y16_134096_c1 3300050511 Bacteria 2574
262 nmdc:mga08y16_193182_c1 3300050511 Bacteria 2111
263 nmdc:mga08y16_212564_c1 3300050511 Bacteria 2003
264 nmdc:mga0n895_295892_c1 3300050512 Bacteria 1641
265 Ga0500578_0017770 3300053086 Bacteria 4570
266 Ga0500583_0000009 3300053092 Bacteria 160749
267 Ga0500583_0000607 3300053092 Bacteria 10683
268 Ga0500568_0000274 3300053139 Bacteria 43327
269 Ga0500604_0003299 3300053151 Bacteria 4344
270 Ga0500639_061500 3300053163 Bacteria 1934
271 Ga0500645_021114 3300053730 Bacteria 2012
272 Ga0501082_0058791 3300060353 Bacteria 3313
273 2738726032 2738541278 Bacteria 9755573
274 Ga0068871_100100352
275 JGI24751J29686_10003826
276 rootH1_10052076
277 rootL2_10001282
278 rootL2_10285495
279 Ga0065704_10105663
280 Ga0065712_10109776
281 Ga0065715_10116463
282 Ga0070658_10000176
283 Ga0070676_10000034
284 Ga0070676_10005918
285 Ga0070683_100002536
286 Ga0070690_100033819
287 Ga0070670_100015951
288 Ga0070670_100024086
289 Ga0070670_100051725
290 Ga0068869_100021715
291 Ga0068869_100026132
292 Ga0070666_10000431
293 Ga0068868_100008188
294 Ga0070689_100028266
295 Ga0070687_100006118
296 Ga0070668_100000087
297 Ga0070668_100004850
298 Ga0070668_100056628
299 Ga0070669_100023291
300 Ga0070675_100128555
301 Ga0070674_100009316
302 Ga0070674_100054106
303 Ga0070674_100065255
304 Ga0070674_100155944
305 Ga0070673_100000074
306 Ga0070673_100006246
307 Ga0070673_100052433
308 Ga0070673_100052559
309 Ga0070673_100138324
310 Ga0070688_100010924
311 Ga0070667_100000031
312 Ga0070667_100025990
313 Ga0070701_10057465
314 Ga0070678_100002885
315 Ga0068867_100007209
316 Ga0068867_100113720
317 Ga0068867_100157724
318 Ga0068867_100187738
319 Ga0070685_10028792
320 Ga0070698_100008254
321 Ga0070698_100031236
322 Ga0068853_100011672
323 Ga0068853_100018897
324 Ga0068853_100033787
325 Ga0070672_100000002
326 Ga0070672_100002698
327 Ga0070672_100135956
328 Ga0070665_100000222
329 Ga0070665_100010164
330 Ga0068855_100026121
331 Ga0068859_100005979
332 Ga0068859_100017266
333 Ga0068866_10005336
334 Ga0068861_100010883
335 Ga0068861_100042941
336 Ga0068851_10000266
337 Ga0068870_10006683
338 Ga0068863_100004520
339 Ga0068863_100008926
340 Ga0068863_100026031
341 Ga0068863_100153838
342 Ga0068858_100001512
343 Ga0068860_100072596
344 Ga0081539_10025864
345 Ga0097621_100000691
346 Ga0097621_100008450
347 Ga0097621_100009845
348 Ga0068871_100002873
349 Ga0068871_100009260
350 Ga0068871_100055708
351 Ga0068871_100073610
352 Ga0075428_100002129
353 Ga0075428_100004442
354 Ga0075430_100012472
355 Ga0075430_100016854
356 Ga0075431_100011013
357 Ga0075431_100050638
358 Ga0075434_100136723
359 Ga0075429_100004992
360 Ga0068865_100033163
361 Ga0097620_100017266
362 Ga0105240_10001361
363 Ga0105240_10078802
364 Ga0111539_10002597
365 Ga0111539_10087356
366 Ga0111539_10087915
367 Ga0111539_10132676
368 Ga0105247_10109100
369 Ga0114129_10076733
370 Ga0105241_10063931
371 Ga0105242_10005938
372 Ga0105242_10008165
373 Ga0105242_10039978
374 Ga0105242_10059437
375 Ga0105249_10002226
376 Ga0105249_10003042
377 Ga0105249_10006302
378 Ga0157371_10269889
379 Ga0157371_10315264
380 Ga0157374_10000074
381 Ga0157374_10008894
382 Ga0157378_10005674
383 Ga0157378_10064919
384 Ga0157378_10097950
385 Ga0163162_10000029
386 Ga0163162_10005911
387 Ga0163162_10039038
388 Ga0163162_10127199
389 Ga0157372_10060027
390 Ga0157372_10067019
391 Ga0157372_10155359
392 Ga0157372_10247188
393 Ga0157375_10000042
394 Ga0157375_10023948
395 Ga0157375_10085763
396 Ga0157375_10202039
397 Ga0163163_10000174
398 Ga0163163_10030768
399 Ga0157377_10123306
400 Ga0157379_10000080
401 Ga0157379_10155403
402 Ga0157376_10000521
403 Ga0157376_10079031
404 Ga0163161_10016307
405 Ga0207697_10011915
406 Ga0207656_10001176
407 Ga0207645_10002278
408 Ga0207645_10005443
409 Ga0207643_10003128
410 Ga0207705_10001116
411 Ga0207695_10000431
412 Ga0207662_10011253
413 Ga0207662_10012705
414 Ga0207662_10023866
415 Ga0207650_10121909
416 Ga0207659_10002122
417 Ga0207659_10141424
418 Ga0207686_10002663
419 Ga0207686_10028947
420 Ga0207669_10003839
421 Ga0207704_10017822
422 Ga0207691_10000004
423 Ga0207691_10005078
424 Ga0207691_10014368
425 Ga0207691_10022119
426 Ga0207691_10040789
427 Ga0207691_10224311
428 Ga0207689_10001010
429 Ga0207689_10003497
430 Ga0207689_10020206
431 Ga0207689_10033109
432 Ga0207689_10065050
433 Ga0207689_10081788
434 Ga0207689_10130226
435 Ga0207679_10093679
436 Ga0207651_10169298
437 Ga0207712_10001318
438 Ga0207712_10014943
439 Ga0207712_10059096
440 Ga0207668_10001201
441 Ga0207640_10078344
442 Ga0207658_10000059
443 Ga0207677_10004077
444 Ga0207677_10008024
445 Ga0207677_10079629
446 Ga0207677_10136443
447 Ga0207703_10003800
448 Ga0207639_10074881
449 Ga0207678_10203735
450 Ga0207708_10040621
451 Ga0207641_10002750
452 Ga0207641_10003172
453 Ga0207648_10001709
454 Ga0207648_10014174
455 Ga0207648_10018228
456 Ga0207648_10021501
457 Ga0207648_10097919
458 Ga0207676_10002009
459 Ga0207676_10033102
460 Ga0207674_10019675
461 Ga0207675_100002556
462 Ga0207675_100019313
463 Ga0207675_100049618
464 Ga0207683_10000974
465 Ga0207428_10004445
466 Ga0268266_10006335
467 Ga0307515_10000001
468 Ga0265327_10002077
469 Ga0265327_10012349
470 Ga0307509_10023546
471 Ga0307408_100018888
472 Ga0265313_10040731
473 Ga0307508_10001710
474 Ga0307516_10000665
475 Ga0307406_10017223
476 Ga0307412_10013164
477 Ga0307415_100025429
478 Ga0307507_10063139
479 Ga0373924_0004695
480 Ga0373937_0009340
481 Ga0373937_0072969
482 Ga0439457_000276
483 Ga0451577_0000103
484 Ga0466972_0000104
485 Ga0466957_0007502
486 Ga0495592_0056455
487 Ga0495638_0075579
488 Ga0495653_0015741
489 Ga0495672_0020338
490 Ga0495672_0084804
491 Ga0501292_000303
492 Ga0501297_001774
493 Ga0501031_0006578
494 Ga0501032_0006571
495 Ga0501034_0120790
496 Ga0501036_0044598
497 Ga0501037_0013337
498 Ga0501037_0029050
499 Ga0501038_0027154
500 Ga0501043_0036498
501 Ga0501046_0106613
502 Ga0501047_0042863
503 Ga0501048_0012526
504 Ga0501073_0132160
505 Ga0501201_001678
506 Ga0501202_000293
507 Ga0501207_000913
508 Ga0501222_001303
509 Ga0501223_002463
510 Ga0501224_000729
511 Ga0501228_004439
512 Ga0501243_006256
513 Ga0501243_007207
514 Ga0501259_000503
515 Ga0501259_001492
516 Ga0501221_000588
517 Ga0501225_0001961
518 Ga0501234_001095
519 Ga0501245_002893
520 Ga0501083_0018627
521 Ga0501266_001338
522 Ga0501035_0006054
523 Ga0501035_0197530
524 Ga0501044_0069414
525 Ga0501044_0134030
526 Ga0501045_0149785
527 nmdc:mga09592_185754_c1
528 nmdc:mga09592_9012_c1
529 nmdc:mga0qj67_11771_c1
530 nmdc:mga0qj67_42508_c1
531 nmdc:mga06r32_229957_c1
532 nmdc:mga06r32_66489_c1
533 nmdc:mga08y16_11798_c1
534 nmdc:mga08y16_134096_c1
535 nmdc:mga08y16_193182_c1
536 nmdc:mga08y16_212564_c1
537 nmdc:mga0n895_295892_c1
538 Ga0500578_0017770
539 Ga0500583_0000009
540 Ga0500583_0000607
541 Ga0500568_0000274
542 Ga0500604_0003299
543 Ga0500639_061500
544 Ga0500645_021114
545 Ga0501082_0058791
546 2738726032

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04389

Peptidase_M28

Peptidase family M28

285

475

0.87

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

311

476

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iib-assembly1.cif.gz_A-2 crystal structure of peptidase m28 precursor (yp_926796.1) from shewanella amazonensis sb2b at 1.70 a resolution 0.9383 20 461
3iib-assembly1.cif.gz_A-2 crystal structure of peptidase m28 precursor (yp_926796.1) from shewanella amazonensis sb2b at 1.70 a resolution 0.9097 20 461
3b3t-assembly1.cif.gz_A crystal structure of the d118n mutant of the aminopeptidase from vibrio proteolyticus 0.8182 265 459
3b3s-assembly1.cif.gz_A crystal structure of the m180a mutant of the aminopeptidase from vibrio proteolyticus in complex with leucine 0.8171 265 462
1tkh-assembly1.cif.gz_A streptomyces griseus aminopeptidase complexed with d-phenylalanine 0.8138 263 461
ID Description Score Start End Superfamily
af_Q54MN6_157_296_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9425 95 254 3.40.630.10
af_Q9Y646_117_259_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9295 95 254 3.40.630.10
3iibA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9243 20 459 3.40.630.10
af_Q54MN6_157_296_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.923 95 254 3.40.630.10
af_Q9Y646_117_259_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9107 95 254 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A4U3KQ47-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.987 23 465 GO:0004180
GO:0005576
GO:0005764
GO:0070573
AF-A0A1G6MW97-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9866 23 465 GO:0004180
GO:0005615
GO:0005764
GO:0006508
GO:0043171
GO:0070573
AF-A0A819QDL7-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9796 21 465 GO:0004180
GO:0005615
GO:0005764
GO:0005783
GO:0005794
GO:0006508
GO:0043171
GO:0070573
AF-A0A821KRC5-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9796 31 465 GO:0004180
GO:0005576
GO:0005764
GO:0005783
GO:0005794
GO:0070573
AF-A0A381FFA3-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9779 285 463 GO:0004177
GO:0004180
GO:0005576
GO:0005764
GO:0070573

Map