F379380

General Info

Members Datasets Scaffolds Average Seq Length
273 182 258 218

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221598|2643998689
Length 263
Sequence FVIAVDGPAASGKGTIASRLAGAYDMPMLDSGLLYRAVGVLLARHGGDFDDVAAATQVARDLTAEMLTDPAFRTREAGEAASRVAIHPSVRLALRDMQQAFALRPDGAVIDGRDIGTVIAPAAPAKLYVTATPEVRAERRWKQLQGQGEAVSYEDILDDIRKRDARDGGRADSPMRPADDAVLLDTTEMTIDQATDAARRIVEAARAXRTAAGKSPAQVSALSVATLNPTPRLRLNAMARWRGHSPFQGRRHLKTKEHQWLTI

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
6 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
7 2643221583 Caulobacter sp. Root655 Isolate Unclassified
8 2643221584 Caulobacter sp. Root656 Isolate Unclassified
9 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
10 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
11 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
12 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
13 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
14 2818991435 Caulobacter henricii 536 Isolate Unclassified
15 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
98 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
99 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
100 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
101 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
102 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
105 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
106 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
107 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
108 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
109 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
110 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
111 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
112 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
113 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
114 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
115 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
116 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
122 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
123 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
124 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
125 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
126 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
127 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
138 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
153 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
160 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
161 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
162 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
163 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
164 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
165 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
166 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
167 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
168 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
169 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
170 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
171 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
172 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
173 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
174 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
175 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
176 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
177 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
178 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
179 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
180 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
181 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.51
Metatranscriptomes 0
Isolates 5.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.02
Nodule 0
Rhizoplane 3.3
Rhizosphere 71.79
Stem 0
Stem Tuber 0
Unclassified 9.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10087600 3300003215 Bacteria 760
2 Ga0055526_1017431 3300003771 Bacteria 2742
3 Ga0055528_1018751 3300003790 Bacteria 2331
4 Ga0055531_10010993 3300003794 Bacteria 4427
5 Ga0065165_1001500 3300005262 Bacteria 24692
6 Ga0070676_10192560 3300005328 Bacteria 1332
7 Ga0070670_100216659 3300005331 Bacteria 1665
8 Ga0070666_10189557 3300005335 Bacteria 1444
9 Ga0070668_100000707 3300005347 Bacteria 22821
10 Ga0070668_100004926 3300005347 Bacteria 9890
11 Ga0070668_100005900 3300005347 Bacteria 9079
12 Ga0070668_100215707 3300005347 Bacteria 1580
13 Ga0070669_100047712 3300005353 Bacteria 3124
14 Ga0070669_100077694 3300005353 Bacteria 2466
15 Ga0070667_100000517 3300005367 Bacteria 38882
16 Ga0070667_100222477 3300005367 Bacteria 1680
17 Ga0070713_100562291 3300005436 Bacteria 1081
18 Ga0070665_100000674 3300005548 Bacteria 45861
19 Ga0070665_100021633 3300005548 Bacteria 6468
20 Ga0070665_100093702 3300005548 Bacteria 3008
21 Ga0068855_100257188 3300005563 Bacteria 1946
22 Ga0068859_100000230 3300005617 Bacteria 55064
23 Ga0068859_100105754 3300005617 Bacteria 2873
24 Ga0068864_100000947 3300005618 Bacteria 24277
25 Ga0068861_100052373 3300005719 Bacteria 3101
26 Ga0068861_100195282 3300005719 Bacteria 1695
27 Ga0068863_100020335 3300005841 Bacteria 6347
28 Ga0068863_100045552 3300005841 Bacteria 4162
29 Ga0068863_100090501 3300005841 Bacteria 2901
30 Ga0068858_100005435 3300005842 Bacteria 12484
31 Ga0068860_100000066 3300005843 Bacteria 182836
32 Ga0068860_100009126 3300005843 Bacteria 9864
33 Ga0068860_100071853 3300005843 Bacteria 3287
34 Ga0068862_100001799 3300005844 Bacteria 19402
35 Ga0068862_100038767 3300005844 Bacteria 4043
36 Ga0070717_10014901 3300006028 Bacteria 5986
37 Ga0075366_10116439 3300006195 Bacteria 1609
38 Ga0075370_10088319 3300006353 Bacteria 1787
39 Ga0097620_100000230 3300006931 Bacteria 55064
40 Ga0097620_100105757 3300006931 Bacteria 2873
41 Ga0105247_10032384 3300009101 Bacteria 3177
42 Ga0105248_10063844 3300009177 Bacteria 4133
43 Ga0105248_10102643 3300009177 Bacteria 3223
44 Ga0105248_10318899 3300009177 Bacteria 1750
45 Ga0105249_10000647 3300009553 Bacteria 31757
46 Ga0105249_11318295 3300009553 Bacteria 794
47 Ga0157374_10158872 3300013296 Bacteria 2201
48 Ga0163162_10073653 3300013306 Bacteria 3472
49 Ga0163162_10101195 3300013306 Bacteria 2973
50 Ga0157375_10188070 3300013308 Bacteria 2219
51 Ga0163163_10277632 3300014325 Bacteria 1727
52 Ga0163163_10422858 3300014325 Bacteria 1391
53 Ga0163163_10436781 3300014325 Bacteria 1368
54 Ga0163163_10624712 3300014325 Bacteria 1141
55 Ga0157379_10010605 3300014968 Bacteria 8032
56 Ga0157379_10078365 3300014968 Bacteria 2959
57 Ga0163161_10179461 3300017792 Bacteria 1623
58 Ga0213876_10000917 3300021384 Bacteria 19493
59 Ga0213875_10234096 3300021388 Bacteria 865
60 Ga0209565_1000192 3300025263 Bacteria 74812
61 Ga0209673_1001713 3300025273 Bacteria 18538
62 Ga0209675_1002802 3300025291 Bacteria 8694
63 Ga0209564_1011716 3300025295 Bacteria 3899
64 Ga0209564_1026208 3300025295 Bacteria 1933
65 Ga0209758_1014823 3300025297 Bacteria 4103
66 Ga0209050_1008468 3300025298 Bacteria 5488
67 Ga0209256_1009549 3300025299 Bacteria 4231
68 Ga0209257_1000554 3300025304 Bacteria 64085
69 Ga0207710_10056272 3300025900 Bacteria 1774
70 Ga0207705_10128182 3300025909 Bacteria 1887
71 Ga0207681_10065962 3300025923 Bacteria 2504
72 Ga0207681_10646871 3300025923 Bacteria 876
73 Ga0207694_10143559 3300025924 Bacteria 1920
74 Ga0207650_10000016 3300025925 Bacteria 361958
75 Ga0207650_10065075 3300025925 Bacteria 2731
76 Ga0207650_10137465 3300025925 Bacteria 1918
77 Ga0207644_10000420 3300025931 Bacteria 27556
78 Ga0207706_10035108 3300025933 Bacteria 4460
79 Ga0207711_10004584 3300025941 Bacteria 11751
80 Ga0207711_10004935 3300025941 Bacteria 11329
81 Ga0207711_10017185 3300025941 Bacteria 6011
82 Ga0207711_10250833 3300025941 Bacteria 1625
83 Ga0207689_10425739 3300025942 Bacteria 1108
84 Ga0207651_10150460 3300025960 Bacteria 1811
85 Ga0207712_10000606 3300025961 Bacteria 28447
86 Ga0207712_10663262 3300025961 Bacteria 907
87 Ga0207668_10000002 3300025972 Bacteria 209163
88 Ga0207668_10000117 3300025972 Bacteria 55600
89 Ga0207668_10024038 3300025972 Bacteria 3927
90 Ga0207668_10128157 3300025972 Bacteria 1933
91 Ga0207668_10246119 3300025972 Bacteria 1449
92 Ga0207658_10000384 3300025986 Bacteria 43187
93 Ga0207658_10030413 3300025986 Bacteria 3822
94 Ga0207658_10161005 3300025986 Bacteria 1839
95 Ga0207703_10000953 3300026035 Bacteria 27985
96 Ga0207639_10647472 3300026041 Bacteria 977
97 Ga0207641_10000910 3300026088 Bacteria 30634
98 Ga0207641_10055854 3300026088 Bacteria 3353
99 Ga0207648_10926135 3300026089 Bacteria 815
100 Ga0207676_10001180 3300026095 Bacteria 19590
101 Ga0207676_10316358 3300026095 Bacteria 1431
102 Ga0207675_100253861 3300026118 Bacteria 1702
103 Ga0207675_100361781 3300026118 Bacteria 1423
104 Ga0207698_10644028 3300026142 Bacteria 1049
105 Ga0268266_10000887 3300028379 Bacteria 38753
106 Ga0268266_10024328 3300028379 Bacteria 5152
107 Ga0268265_10032486 3300028380 Bacteria 3783
108 Ga0268265_10040289 3300028380 Bacteria 3449
109 Ga0268264_10000113 3300028381 Bacteria 203262
110 Ga0268264_10003286 3300028381 Bacteria 13976
111 Ga0268264_10028219 3300028381 Bacteria 4589
112 Ga0265334_10066310 3300028573 Bacteria 1351
113 Ga0307515_10045615 3300028794 Bacteria 6727
114 Ga0307515_10081335 3300028794 Bacteria 4209
115 Ga0265338_10025243 3300028800 Bacteria 6039
116 Ga0265338_10027553 3300028800 Bacteria 5698
117 Ga0265338_10061568 3300028800 Bacteria 3288
118 Ga0265338_10158178 3300028800 Bacteria 1753
119 Ga0265338_10252544 3300028800 Bacteria 1300
120 Ga0307511_10023644 3300030521 Bacteria 5721
121 Ga0265327_10001271 3300031251 Bacteria 33262
122 Ga0265327_10012471 3300031251 Bacteria 5730
123 Ga0265327_10044215 3300031251 Bacteria 2377
124 Ga0265327_10063961 3300031251 Bacteria 1866
125 Ga0307408_100820463 3300031548 Bacteria 846
126 Ga0265314_10017158 3300031711 Bacteria 5689
127 Ga0265314_10117605 3300031711 Bacteria 1679
128 Ga0265342_10212558 3300031712 Bacteria 1045
129 Ga0307510_10046570 3300033180 Bacteria 4660
130 Ga0373933_0160053 3300035724 Bacteria 1429
131 Ga0373937_0429823 3300036401 Bacteria 1254
132 Ga0373937_0769766 3300036401 Bacteria 910
133 Ga0395899_0428525 3300037312 Bacteria 870
134 Ga0436364_1384957 3300037853 Bacteria 1725
135 Ga0436364_1542089 3300037853 Bacteria 1071
136 Ga0436365_0585577 3300039437 Bacteria 67545
137 Ga0436363_0667108 3300039450 Bacteria 2805
138 Ga0439465_0027937 3300041413 Bacteria 1788
139 Ga0439445_0038738 3300042004 Bacteria 1261
140 Ga0439446_0016464 3300042156 Bacteria 2059
141 Ga0439459_0020545 3300042438 Bacteria 1261
142 Ga0495627_000414 3300046453 Bacteria 37690
143 Ga0495638_0002922 3300046460 Bacteria 13650
144 Ga0495638_0006168 3300046460 Bacteria 8755
145 Ga0495638_0036995 3300046460 Bacteria 3106
146 Ga0495638_0107542 3300046460 Bacteria 1660
147 Ga0495596_0057784 3300046500 Bacteria 1513
148 Ga0495606_0003326 3300046507 Bacteria 17163
149 Ga0495610_0000524 3300046512 Bacteria 38586
150 Ga0495610_0026767 3300046512 Bacteria 3075
151 Ga0495616_0000016 3300046513 Bacteria 182686
152 Ga0495616_0131536 3300046513 Bacteria 1146
153 Ga0495620_0019844 3300046515 Bacteria 3293
154 Ga0495631_0054498 3300046518 Bacteria 1743
155 Ga0495632_0026438 3300046519 Bacteria 3055
156 Ga0495632_0185915 3300046519 Bacteria 950
157 Ga0495637_0019003 3300046520 Bacteria 3182
158 Ga0495637_0082968 3300046520 Bacteria 1275
159 Ga0495643_0124044 3300046522 Bacteria 1302
160 Ga0495643_0201396 3300046522 Bacteria 955
161 Ga0495644_0030501 3300046523 Bacteria 2036
162 Ga0495648_0021981 3300046524 Bacteria 4404
163 Ga0495648_0043080 3300046524 Bacteria 2833
164 Ga0495654_0000039 3300046530 Bacteria 185363
165 Ga0495654_0070479 3300046530 Bacteria 1658
166 Ga0495597_0089395 3300046542 Bacteria 1309
167 Ga0495668_0001487 3300046616 Bacteria 22445
168 Ga0495668_0007351 3300046616 Bacteria 7056
169 Ga0495668_0037888 3300046616 Bacteria 2696
170 Ga0495668_0136925 3300046616 Bacteria 1340
171 Ga0495668_0137341 3300046616 Bacteria 1338
172 Ga0495625_0000034 3300046660 Bacteria 225120
173 Ga0495625_0084698 3300046660 Bacteria 2201
174 Ga0495625_0104747 3300046660 Bacteria 1939
175 Ga0495625_0130062 3300046660 Bacteria 1706
176 Ga0495669_0000014 3300046684 Bacteria 140832
177 Ga0495669_0000447 3300046684 Bacteria 19503
178 Ga0495671_0111465 3300046692 Bacteria 1336
179 Ga0495671_0150501 3300046692 Bacteria 1133
180 Ga0495589_0001372 3300046794 Bacteria 14212
181 Ga0495660_0094511 3300046810 Bacteria 1548
182 Ga0495672_0000266 3300047320 Bacteria 72321
183 Ga0495672_0059902 3300047320 Bacteria 2201
184 Ga0495683_0047260 3300047323 Bacteria 2160
185 Ga0495677_0076750 3300047445 Bacteria 1249
186 Ga0495673_0000053 3300047469 Bacteria 254433
187 Ga0495673_0000952 3300047469 Bacteria 26174
188 Ga0495673_0002400 3300047469 Bacteria 13213
189 Ga0495681_0052351 3300047470 Bacteria 1916
190 Ga0495686_0001417 3300047472 Bacteria 26265
191 Ga0495686_0018726 3300047472 Bacteria 4638
192 Ga0495686_0067246 3300047472 Bacteria 2212
193 Ga0495686_0316391 3300047472 Bacteria 857
194 Ga0496101_0016805 3300048904 Bacteria 4953
195 Ga0496106_0025606 3300048909 Bacteria 4392
196 Ga0496107_0001024 3300048910 Bacteria 16692
197 Ga0496109_0005758 3300048912 Bacteria 10367
198 Ga0496112_0056194 3300048915 Bacteria 3873
199 Ga0496113_0250570 3300048916 Bacteria 1414
200 Ga0496115_0000984 3300048918 Bacteria 20664
201 Ga0496115_0001099 3300048918 Bacteria 19590
202 Ga0496115_0753370 3300048918 Bacteria 761
203 Ga0496121_0002729 3300048924 Bacteria 26299
204 Ga0496124_0067528 3300048927 Bacteria 2975
205 Ga0496124_0172038 3300048927 Bacteria 1676
206 Ga0496125_0027065 3300048928 Bacteria 5207
207 Ga0496125_0124223 3300048928 Bacteria 1833
208 Ga0496126_0013838 3300048929 Bacteria 8184
209 Ga0496126_0400657 3300048929 Bacteria 1113
210 Ga0495678_001372 3300049459 Bacteria 19409
211 Ga0501033_0102384 3300049570 Bacteria 2089
212 Ga0501034_0220991 3300049571 Bacteria 1847
213 Ga0501034_0972001 3300049571 Bacteria 734
214 Ga0501037_0301773 3300049573 Bacteria 1112
215 Ga0501038_0271087 3300049574 Bacteria 1338
216 Ga0501043_0287629 3300049579 Bacteria 1259
217 Ga0501043_0409477 3300049579 Bacteria 1024
218 Ga0501047_0191310 3300049581 Bacteria 1909
219 Ga0501047_0203859 3300049581 Bacteria 1838
220 Ga0501068_0582433 3300049584 Bacteria 728
221 Ga0501069_0058047 3300049585 Bacteria 2158
222 Ga0501070_0049987 3300049586 Bacteria 3471
223 Ga0501073_0403622 3300049589 Bacteria 944
224 Ga0501074_0148958 3300049590 Bacteria 1673
225 Ga0501238_000862 3300049671 Bacteria 3454
226 Ga0501257_026512 3300049686 Bacteria 1384
227 Ga0501080_0132512 3300049742 Bacteria 2307
228 Ga0501083_0129204 3300049744 Bacteria 1656
229 Ga0501035_0176016 3300049822 Bacteria 1845
230 Ga0501035_0231141 3300049822 Bacteria 1576
231 Ga0501044_0011027 3300049823 Bacteria 9807
232 Ga0501044_0055708 3300049823 Bacteria 4060
233 nmdc:mga0k408_93167_c1 3300050493 Bacteria 1771
234 nmdc:mga07m45_55557_c1 3300050496 Bacteria 2238
235 nmdc:mga0sz30_4560_c1 3300050516 Bacteria 3659
236 Ga0500578_0000168 3300053086 Bacteria 78140
237 Ga0500644_0000064 3300053088 Bacteria 62621
238 Ga0500646_0087217 3300053090 Bacteria 961
239 Ga0500554_000771 3300053102 Bacteria 6387
240 Ga0500555_001416 3300053103 Bacteria 7391
241 Ga0500555_037118 3300053103 Bacteria 1365
242 Ga0500556_0004292 3300053104 Bacteria 4064
243 Ga0500562_000280 3300053108 Bacteria 12568
244 Ga0500594_0000119 3300053118 Bacteria 22117
245 Ga0500595_018134 3300053119 Bacteria 2580
246 Ga0500614_004037 3300053123 Bacteria 3123
247 Ga0500618_000014 3300053125 Bacteria 177186
248 Ga0500658_0049183 3300053134 Bacteria 1717
249 Ga0500559_0000467 3300053136 Bacteria 28771
250 Ga0500564_000259 3300053138 Bacteria 14789
251 Ga0500577_0001921 3300053142 Bacteria 5320
252 Ga0500588_0046953 3300053146 Bacteria 1330
253 Ga0500622_0001411 3300053156 Bacteria 19363
254 Ga0500627_0063281 3300053158 Bacteria 1630
255 Ga0500634_0058591 3300053161 Bacteria 2052
256 Ga0500611_021477 3300053727 Bacteria 1232
257 Ga0500645_014030 3300053730 Bacteria 2562
258 Ga0501084_0384860 3300054114 Bacteria 1185

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2510917020 2511125370 212
2 iso_pu_bacteria 2582581279 2585149598 212
3 iso_pu_bacteria 2582581280 2585155547 212
4 iso_pu_bacteria 2582581293 2585199390 212
5 iso_pu_bacteria 2643221552 2643781112 212
6 iso_pu_bacteria 2643221583 2643922426 212
7 iso_pu_bacteria 2643221584 2643930445 212
8 iso_pu_bacteria 2643221614 2644087357 212
9 iso_pu_bacteria 2643221661 2644344599 212
10 iso_pu_bacteria 2643221666 2644366717 212
11 iso_pu_bacteria 2818991435 2819540253 212
12 iso_pu_bacteria 2818991454 2819649185 212
13 3300046524 Ga0495648_0021981 Ga0495648_0021981_599_1240 213
14 3300047469 Ga0495673_0000952 Ga0495673_0000952_696_1337 213
15 3300048916 Ga0496113_0250570 Ga0496113_0250570_298_939 213
16 3300048927 Ga0496124_0067528 Ga0496124_0067528_2239_2880 213
17 3300048928 Ga0496125_0027065 Ga0496125_0027065_2034_2675 213
18 3300048929 Ga0496126_0013838 Ga0496126_0013838_1232_1873 213
19 3300050516 nmdc:mga0sz30_4560_c1 nmdc:mga0sz30_4560_c1_1212_1853 213
20 3300053088 Ga0500644_0000064 Ga0500644_0000064_37199_37840 213
21 3300053138 Ga0500564_000259 Ga0500564_000259_10782_11423 213
22 3300005331 Ga0070670_100216659 Ga0070670_1002166592 214
23 3300005347 Ga0070668_100000707 Ga0070668_1000007072 214
24 3300005347 Ga0070668_100004926 Ga0070668_10000492613 214
25 3300005347 Ga0070668_100215707 Ga0070668_1002157072 214
26 3300005353 Ga0070669_100047712 Ga0070669_1000477122 214
27 3300005367 Ga0070667_100222477 Ga0070667_1002224771 214
28 3300005548 Ga0070665_100000674 Ga0070665_10000067442 214
29 3300005617 Ga0068859_100105754 Ga0068859_1001057542 214
30 3300005843 Ga0068860_100000066 Ga0068860_100000066192 214
31 3300005843 Ga0068860_100071853 Ga0068860_1000718533 214
32 3300005844 Ga0068862_100038767 Ga0068862_1000387672 214
33 3300006931 Ga0097620_100105757 Ga0097620_1001057572 214
34 3300009553 Ga0105249_11318295 Ga0105249_113182951 214
35 3300021388 Ga0213875_10234096 Ga0213875_102340961 214
36 3300025923 Ga0207681_10646871 Ga0207681_106468711 214
37 3300025925 Ga0207650_10137465 Ga0207650_101374652 214
38 3300025961 Ga0207712_10663262 Ga0207712_106632621 214
39 3300025972 Ga0207668_10000002 Ga0207668_1000000289 214
40 3300025972 Ga0207668_10128157 Ga0207668_101281572 214
41 3300025972 Ga0207668_10246119 Ga0207668_102461192 214
42 3300025986 Ga0207658_10030413 Ga0207658_100304132 214
43 3300025986 Ga0207658_10161005 Ga0207658_101610052 214
44 3300026089 Ga0207648_10926135 Ga0207648_109261351 214
45 3300028379 Ga0268266_10000887 Ga0268266_100008872 214
46 3300028380 Ga0268265_10032486 Ga0268265_100324862 214
47 3300028380 Ga0268265_10040289 Ga0268265_100402892 214
48 3300028381 Ga0268264_10000113 Ga0268264_100001132 214
49 3300033180 Ga0307510_10046570 Ga0307510_100465703 214
50 3300037312 Ga0395899_0428525 Ga0395899_0428525_177_824 214
51 3300037853 Ga0436364_1542089 Ga0436364_1542089_392_1036 214
52 3300046660 Ga0495625_0104747 Ga0495625_0104747_828_1478 214
53 3300046660 Ga0495625_0130062 Ga0495625_0130062_1007_1657 214
54 3300046684 Ga0495669_0000014 Ga0495669_0000014_85794_86444 214
55 3300046684 Ga0495669_0000447 Ga0495669_0000447_9157_9807 214
56 3300047445 Ga0495677_0076750 Ga0495677_0076750_506_1156 214
57 3300048928 Ga0496125_0124223 Ga0496125_0124223_156_806 214
58 3300049571 Ga0501034_0972001 Ga0501034_0972001_67_711 214
59 3300049573 Ga0501037_0301773 Ga0501037_0301773_24_668 214
60 3300049574 Ga0501038_0271087 Ga0501038_0271087_457_1101 214
61 3300049579 Ga0501043_0287629 Ga0501043_0287629_426_1070 214
62 3300049581 Ga0501047_0191310 Ga0501047_0191310_353_997 214
63 3300049584 Ga0501068_0582433 Ga0501068_0582433_41_685 214
64 3300049585 Ga0501069_0058047 Ga0501069_0058047_1138_1782 214
65 3300049586 Ga0501070_0049987 Ga0501070_0049987_2532_3176 214
66 3300049589 Ga0501073_0403622 Ga0501073_0403622_97_741 214
67 3300049590 Ga0501074_0148958 Ga0501074_0148958_974_1618 214
68 3300049686 Ga0501257_026512 Ga0501257_026512_70_717 214
69 3300049742 Ga0501080_0132512 Ga0501080_0132512_662_1306 214
70 3300049744 Ga0501083_0129204 Ga0501083_0129204_731_1375 214
71 3300049822 Ga0501035_0176016 Ga0501035_0176016_775_1419 214
72 3300049822 Ga0501035_0231141 Ga0501035_0231141_272_922 214
73 3300049823 Ga0501044_0055708 Ga0501044_0055708_763_1407 214
74 3300053090 Ga0500646_0087217 Ga0500646_0087217_17_667 214
75 3300053103 Ga0500555_001416 Ga0500555_001416_5615_6265 214
76 3300054114 Ga0501084_0384860 Ga0501084_0384860_135_779 214
77 iso_pu_bacteria 2643221598 2643998689 214
78 3300005335 Ga0070666_10189557 Ga0070666_101895572 215
79 3300005367 Ga0070667_100000517 Ga0070667_10000051746 215
80 3300005548 Ga0070665_100021633 Ga0070665_1000216337 215
81 3300005563 Ga0068855_100257188 Ga0068855_1002571882 215
82 3300005618 Ga0068864_100000947 Ga0068864_1000009472 215
83 3300005719 Ga0068861_100195282 Ga0068861_1001952822 215
84 3300005841 Ga0068863_100020335 Ga0068863_1000203357 215
85 3300005841 Ga0068863_100090501 Ga0068863_1000905012 215
86 3300005843 Ga0068860_100009126 Ga0068860_10000912612 215
87 3300005844 Ga0068862_100001799 Ga0068862_1000017992 215
88 3300006028 Ga0070717_10014901 Ga0070717_100149015 215
89 3300009177 Ga0105248_10102643 Ga0105248_101026434 215
90 3300009177 Ga0105248_10318899 Ga0105248_103188992 215
91 3300009553 Ga0105249_10000647 Ga0105249_1000064719 215
92 3300013296 Ga0157374_10158872 Ga0157374_101588722 215
93 3300013306 Ga0163162_10101195 Ga0163162_101011952 215
94 3300013308 Ga0157375_10188070 Ga0157375_101880702 215
95 3300014325 Ga0163163_10277632 Ga0163163_102776322 215
96 3300014968 Ga0157379_10078365 Ga0157379_100783652 215
97 3300017792 Ga0163161_10179461 Ga0163161_101794612 215
98 3300025900 Ga0207710_10056272 Ga0207710_100562722 215
99 3300025924 Ga0207694_10143559 Ga0207694_101435592 215
100 3300025925 Ga0207650_10000016 Ga0207650_1000001681 215
101 3300025925 Ga0207650_10065075 Ga0207650_100650752 215
102 3300025933 Ga0207706_10035108 Ga0207706_100351086 215
103 3300025941 Ga0207711_10004935 Ga0207711_100049359 215
104 3300025941 Ga0207711_10017185 Ga0207711_100171857 215
105 3300025941 Ga0207711_10250833 Ga0207711_102508332 215
106 3300025960 Ga0207651_10150460 Ga0207651_101504602 215
107 3300025961 Ga0207712_10000606 Ga0207712_1000060630 215
108 3300025972 Ga0207668_10000117 Ga0207668_1000011759 215
109 3300025986 Ga0207658_10000384 Ga0207658_100003844 215
110 3300026041 Ga0207639_10647472 Ga0207639_106474722 215
111 3300026088 Ga0207641_10000910 Ga0207641_1000091030 215
112 3300026095 Ga0207676_10001180 Ga0207676_100011802 215
113 3300026095 Ga0207676_10316358 Ga0207676_103163582 215
114 3300026118 Ga0207675_100253861 Ga0207675_1002538613 215
115 3300026142 Ga0207698_10644028 Ga0207698_106440281 215
116 3300028379 Ga0268266_10024328 Ga0268266_100243282 215
117 3300028381 Ga0268264_10003286 Ga0268264_1000328616 215
118 3300030521 Ga0307511_10023644 Ga0307511_100236446 215
119 3300036401 Ga0373937_0769766 Ga0373937_0769766_247_897 215
120 3300046500 Ga0495596_0057784 Ga0495596_0057784_19_675 215
121 3300046616 Ga0495668_0136925 Ga0495668_0136925_82_735 215
122 3300046616 Ga0495668_0137341 Ga0495668_0137341_277_927 215
123 3300047320 Ga0495672_0059902 Ga0495672_0059902_562_1227 215
124 3300048904 Ga0496101_0016805 Ga0496101_0016805_650_1336 215
125 3300048912 Ga0496109_0005758 Ga0496109_0005758_8780_9466 215
126 3300048915 Ga0496112_0056194 Ga0496112_0056194_806_1492 215
127 3300048918 Ga0496115_0000984 Ga0496115_0000984_1151_1837 215
128 3300049571 Ga0501034_0220991 Ga0501034_0220991_465_1115 215
129 3300053108 Ga0500562_000280 Ga0500562_000280_7937_8602 215
130 3300003215 JGI25153J46596_10087600 JGI25153J46596_100876001 216
131 3300003771 Ga0055526_1017431 Ga0055526_10174312 216
132 3300003790 Ga0055528_1018751 Ga0055528_10187512 216
133 3300003794 Ga0055531_10010993 Ga0055531_100109932 216
134 3300005262 Ga0065165_1001500 Ga0065165_10015003 216
135 3300005328 Ga0070676_10192560 Ga0070676_101925602 216
136 3300005347 Ga0070668_100005900 Ga0070668_1000059006 216
137 3300005353 Ga0070669_100077694 Ga0070669_1000776942 216
138 3300005436 Ga0070713_100562291 Ga0070713_1005622912 216
139 3300005548 Ga0070665_100093702 Ga0070665_1000937022 216
140 3300005617 Ga0068859_100000230 Ga0068859_10000023059 216
141 3300005719 Ga0068861_100052373 Ga0068861_1000523734 216
142 3300005841 Ga0068863_100045552 Ga0068863_1000455522 216
143 3300005842 Ga0068858_100005435 Ga0068858_10000543511 216
144 3300006195 Ga0075366_10116439 Ga0075366_101164392 216
145 3300006353 Ga0075370_10088319 Ga0075370_100883192 216
146 3300006931 Ga0097620_100000230 Ga0097620_10000023059 216
147 3300009101 Ga0105247_10032384 Ga0105247_100323842 216
148 3300009177 Ga0105248_10063844 Ga0105248_100638445 216
149 3300013306 Ga0163162_10073653 Ga0163162_100736532 216
150 3300014325 Ga0163163_10422858 Ga0163163_104228582 216
151 3300014325 Ga0163163_10436781 Ga0163163_104367812 216
152 3300014325 Ga0163163_10624712 Ga0163163_106247122 216
153 3300014968 Ga0157379_10010605 Ga0157379_100106052 216
154 3300021384 Ga0213876_10000917 Ga0213876_1000091718 216
155 3300025263 Ga0209565_1000192 Ga0209565_100019265 216
156 3300025273 Ga0209673_1001713 Ga0209673_100171313 216
157 3300025291 Ga0209675_1002802 Ga0209675_10028025 216
158 3300025295 Ga0209564_1011716 Ga0209564_10117162 216
159 3300025295 Ga0209564_1026208 Ga0209564_10262082 216
160 3300025297 Ga0209758_1014823 Ga0209758_10148232 216
161 3300025298 Ga0209050_1008468 Ga0209050_10084681 216
162 3300025299 Ga0209256_1009549 Ga0209256_10095493 216
163 3300025304 Ga0209257_1000554 Ga0209257_100055453 216
164 3300025909 Ga0207705_10128182 Ga0207705_101281822 216
165 3300025923 Ga0207681_10065962 Ga0207681_100659622 216
166 3300025931 Ga0207644_10000420 Ga0207644_100004205 216
167 3300025941 Ga0207711_10004584 Ga0207711_1000458410 216
168 3300025942 Ga0207689_10425739 Ga0207689_104257391 216
169 3300025972 Ga0207668_10024038 Ga0207668_100240382 216
170 3300026035 Ga0207703_10000953 Ga0207703_100009538 216
171 3300026088 Ga0207641_10055854 Ga0207641_100558545 216
172 3300026118 Ga0207675_100361781 Ga0207675_1003617812 216
173 3300028381 Ga0268264_10028219 Ga0268264_100282192 216
174 3300028573 Ga0265334_10066310 Ga0265334_100663102 216
175 3300028794 Ga0307515_10045615 Ga0307515_100456152 216
176 3300028794 Ga0307515_10081335 Ga0307515_100813352 216
177 3300028800 Ga0265338_10025243 Ga0265338_100252432 216
178 3300028800 Ga0265338_10027553 Ga0265338_100275531 216
179 3300028800 Ga0265338_10061568 Ga0265338_100615682 216
180 3300028800 Ga0265338_10158178 Ga0265338_101581782 216
181 3300028800 Ga0265338_10252544 Ga0265338_102525442 216
182 3300031251 Ga0265327_10001271 Ga0265327_1000127126 216
183 3300031251 Ga0265327_10012471 Ga0265327_100124711 216
184 3300031251 Ga0265327_10044215 Ga0265327_100442152 216
185 3300031251 Ga0265327_10063961 Ga0265327_100639612 216
186 3300031548 Ga0307408_100820463 Ga0307408_1008204631 216
187 3300031711 Ga0265314_10017158 Ga0265314_100171584 216
188 3300031711 Ga0265314_10117605 Ga0265314_101176051 216
189 3300031712 Ga0265342_10212558 Ga0265342_102125582 216
190 3300035724 Ga0373933_0160053 Ga0373933_0160053_170_829 216
191 3300036401 Ga0373937_0429823 Ga0373937_0429823_280_939 216
192 3300037853 Ga0436364_1384957 Ga0436364_1384957_202_864 216
193 3300039437 Ga0436365_0585577 Ga0436365_0585577_60363_61016 216
194 3300039450 Ga0436363_0667108 Ga0436363_0667108_382_1035 216
195 3300041413 Ga0439465_0027937 Ga0439465_0027937_855_1505 216
196 3300042004 Ga0439445_0038738 Ga0439445_0038738_378_1028 216
197 3300042156 Ga0439446_0016464 Ga0439446_0016464_1153_1803 216
198 3300042438 Ga0439459_0020545 Ga0439459_0020545_491_1141 216
199 3300046453 Ga0495627_000414 Ga0495627_000414_20440_21090 216
200 3300046460 Ga0495638_0002922 Ga0495638_0002922_492_1142 216
201 3300046460 Ga0495638_0006168 Ga0495638_0006168_577_1227 216
202 3300046460 Ga0495638_0036995 Ga0495638_0036995_1671_2321 216
203 3300046460 Ga0495638_0107542 Ga0495638_0107542_283_933 216
204 3300046507 Ga0495606_0003326 Ga0495606_0003326_6319_6969 216
205 3300046512 Ga0495610_0000524 Ga0495610_0000524_1323_1973 216
206 3300046512 Ga0495610_0026767 Ga0495610_0026767_234_884 216
207 3300046513 Ga0495616_0000016 Ga0495616_0000016_135823_136473 216
208 3300046513 Ga0495616_0131536 Ga0495616_0131536_284_934 216
209 3300046515 Ga0495620_0019844 Ga0495620_0019844_992_1657 216
210 3300046518 Ga0495631_0054498 Ga0495631_0054498_892_1542 216
211 3300046519 Ga0495632_0026438 Ga0495632_0026438_527_1177 216
212 3300046519 Ga0495632_0185915 Ga0495632_0185915_199_849 216
213 3300046520 Ga0495637_0019003 Ga0495637_0019003_1575_2225 216
214 3300046520 Ga0495637_0082968 Ga0495637_0082968_609_1259 216
215 3300046522 Ga0495643_0124044 Ga0495643_0124044_509_1159 216
216 3300046522 Ga0495643_0201396 Ga0495643_0201396_212_862 216
217 3300046523 Ga0495644_0030501 Ga0495644_0030501_1222_1887 216
218 3300046524 Ga0495648_0043080 Ga0495648_0043080_1973_2638 216
219 3300046530 Ga0495654_0000039 Ga0495654_0000039_163215_163880 216
220 3300046530 Ga0495654_0070479 Ga0495654_0070479_772_1422 216
221 3300046542 Ga0495597_0089395 Ga0495597_0089395_169_819 216
222 3300046616 Ga0495668_0001487 Ga0495668_0001487_746_1396 216
223 3300046616 Ga0495668_0007351 Ga0495668_0007351_608_1258 216
224 3300046616 Ga0495668_0037888 Ga0495668_0037888_1423_2073 216
225 3300046660 Ga0495625_0000034 Ga0495625_0000034_647_1297 216
226 3300046660 Ga0495625_0084698 Ga0495625_0084698_231_881 216
227 3300046692 Ga0495671_0111465 Ga0495671_0111465_398_1048 216
228 3300046692 Ga0495671_0150501 Ga0495671_0150501_68_718 216
229 3300046794 Ga0495589_0001372 Ga0495589_0001372_794_1444 216
230 3300046810 Ga0495660_0094511 Ga0495660_0094511_749_1399 216
231 3300047320 Ga0495672_0000266 Ga0495672_0000266_13041_13691 216
232 3300047323 Ga0495683_0047260 Ga0495683_0047260_1296_1946 216
233 3300047469 Ga0495673_0000053 Ga0495673_0000053_201386_202036 216
234 3300047469 Ga0495673_0002400 Ga0495673_0002400_46_696 216
235 3300047470 Ga0495681_0052351 Ga0495681_0052351_639_1289 216
236 3300047472 Ga0495686_0001417 Ga0495686_0001417_690_1340 216
237 3300047472 Ga0495686_0018726 Ga0495686_0018726_3762_4412 216
238 3300047472 Ga0495686_0067246 Ga0495686_0067246_1338_1988 216
239 3300047472 Ga0495686_0316391 Ga0495686_0316391_174_824 216
240 3300048909 Ga0496106_0025606 Ga0496106_0025606_2827_3477 216
241 3300048910 Ga0496107_0001024 Ga0496107_0001024_11558_12208 216
242 3300048918 Ga0496115_0001099 Ga0496115_0001099_17551_18201 216
243 3300048918 Ga0496115_0753370 Ga0496115_0753370_27_677 216
244 3300048924 Ga0496121_0002729 Ga0496121_0002729_15228_15878 216
245 3300048927 Ga0496124_0172038 Ga0496124_0172038_423_1073 216
246 3300048929 Ga0496126_0400657 Ga0496126_0400657_365_1015 216
247 3300049459 Ga0495678_001372 Ga0495678_001372_18050_18700 216
248 3300049570 Ga0501033_0102384 Ga0501033_0102384_657_1319 216
249 3300049579 Ga0501043_0409477 Ga0501043_0409477_109_771 216
250 3300049581 Ga0501047_0203859 Ga0501047_0203859_371_1033 216
251 3300049671 Ga0501238_000862 Ga0501238_000862_1916_2581 216
252 3300049823 Ga0501044_0011027 Ga0501044_0011027_252_914 216
253 3300050493 nmdc:mga0k408_93167_c1 nmdc:mga0k408_93167_c1_197_847 216
254 3300050496 nmdc:mga07m45_55557_c1 nmdc:mga07m45_55557_c1_769_1419 216
255 3300053086 Ga0500578_0000168 Ga0500578_0000168_996_1646 216
256 3300053102 Ga0500554_000771 Ga0500554_000771_2222_2872 216
257 3300053103 Ga0500555_037118 Ga0500555_037118_354_1004 216
258 3300053104 Ga0500556_0004292 Ga0500556_0004292_1205_1855 216
259 3300053118 Ga0500594_0000119 Ga0500594_0000119_6617_7267 216
260 3300053119 Ga0500595_018134 Ga0500595_018134_921_1571 216
261 3300053123 Ga0500614_004037 Ga0500614_004037_889_1539 216
262 3300053125 Ga0500618_000014 Ga0500618_000014_22451_23101 216
263 3300053134 Ga0500658_0049183 Ga0500658_0049183_48_698 216
264 3300053136 Ga0500559_0000467 Ga0500559_0000467_8655_9305 216
265 3300053142 Ga0500577_0001921 Ga0500577_0001921_2336_2986 216
266 3300053146 Ga0500588_0046953 Ga0500588_0046953_53_703 216
267 3300053156 Ga0500622_0001411 Ga0500622_0001411_18103_18753 216
268 3300053158 Ga0500627_0063281 Ga0500627_0063281_449_1114 216
269 3300053161 Ga0500634_0058591 Ga0500634_0058591_1075_1725 216
270 3300053727 Ga0500611_021477 Ga0500611_021477_44_694 216
271 3300053730 Ga0500645_014030 Ga0500645_014030_1696_2346 216
272 iso_pu_bacteria 2643221545 2643748144 216
273 iso_pu_bacteria 2643221691 2644506848 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02224

Cytidylate_kin

Cytidylate kinase

3

204

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r20-assembly1.cif.gz_A crystal structure of cytidylate kinase from mycobacterium smegmatis 0.9002 2 202
1kdt-assembly1.cif.gz_A cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate 0.8936 1 207
2feo-assembly1.cif.gz_A mutant r188m of the cytidine monophosphate kinase from e. coli complexed with dcmp 0.8879 1 206
1kdt-assembly1.cif.gz_A cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate 0.8548 1 207
4e22-assembly1.cif.gz_A structure of cytidine monophosphate kinase from yersinia pseudotuberculosis 0.8492 2 204
ID Description Score Start End Superfamily
2femA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8415 1 209 3.40.50.300
af_Q2FYF5_1_183_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8365 37 205 3.40.50.300
2h92C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8359 2 206 3.40.50.300
2femA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8154 1 209 3.40.50.300
4dieB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8094 2 206 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1Q3JMQ5-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.9882 1 163 GO:0004127
GO:0005524
AF-A0A1Q3JMQ5-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.9764 1 163 GO:0004127
GO:0005524
AF-A0A528FLU9-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.9698 2 125 GO:0005524
GO:0036430
GO:0036431
AF-A0A562NTJ0-F1-model_v4 Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) 0.9682 2 213 GO:0005524
GO:0005737
GO:0006220
GO:0036430
GO:0036431
AF-A0A2P7BK29-F1-model_v4 Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) 0.9665 2 210 GO:0005524
GO:0005737
GO:0006220
GO:0016020
GO:0036430
GO:0036431

Feature Viewer

pLDDT pTM Quality
93.41 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map