F379380
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 273 | 182 | 258 | 218 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221598|2643998689 |
| Length | 263 |
| Sequence | FVIAVDGPAASGKGTIASRLAGAYDMPMLDSGLLYRAVGVLLARHGGDFDDVAAATQVARDLTAEMLTDPAFRTREAGEAASRVAIHPSVRLALRDMQQAFALRPDGAVIDGRDIGTVIAPAAPAKLYVTATPEVRAERRWKQLQGQGEAVSYEDILDDIRKRDARDGGRADSPMRPADDAVLLDTTEMTIDQATDAARRIVEAARAXRTAAGKSPAQVSALSVATLNPTPRLRLNAMARWRGHSPFQGRRHLKTKEHQWLTI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 2 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 3 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 4 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 5 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 6 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 7 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 8 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 9 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 10 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 11 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 12 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 13 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 14 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 15 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 39 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 40 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 51 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 52 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 53 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 54 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 55 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 56 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 59 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 84 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 85 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 86 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 87 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 88 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 89 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 90 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 91 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 92 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 93 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 94 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 95 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 96 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 97 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 98 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 99 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 100 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 101 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 102 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 131 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 132 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 134 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 135 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 136 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 137 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 138 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 139 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 140 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 153 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 154 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 159 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 160 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 161 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 162 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 163 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 164 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 165 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 166 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 167 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 168 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 169 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 170 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 171 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 172 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 173 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 174 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 175 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 176 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 177 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 178 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 179 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 180 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 181 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 182 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.51 |
| Metatranscriptomes | 0 |
| Isolates | 5.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.02 |
| Nodule | 0 |
| Rhizoplane | 3.3 |
| Rhizosphere | 71.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10087600 | 3300003215 | Bacteria | 760 |
| 2 | Ga0055526_1017431 | 3300003771 | Bacteria | 2742 |
| 3 | Ga0055528_1018751 | 3300003790 | Bacteria | 2331 |
| 4 | Ga0055531_10010993 | 3300003794 | Bacteria | 4427 |
| 5 | Ga0065165_1001500 | 3300005262 | Bacteria | 24692 |
| 6 | Ga0070676_10192560 | 3300005328 | Bacteria | 1332 |
| 7 | Ga0070670_100216659 | 3300005331 | Bacteria | 1665 |
| 8 | Ga0070666_10189557 | 3300005335 | Bacteria | 1444 |
| 9 | Ga0070668_100000707 | 3300005347 | Bacteria | 22821 |
| 10 | Ga0070668_100004926 | 3300005347 | Bacteria | 9890 |
| 11 | Ga0070668_100005900 | 3300005347 | Bacteria | 9079 |
| 12 | Ga0070668_100215707 | 3300005347 | Bacteria | 1580 |
| 13 | Ga0070669_100047712 | 3300005353 | Bacteria | 3124 |
| 14 | Ga0070669_100077694 | 3300005353 | Bacteria | 2466 |
| 15 | Ga0070667_100000517 | 3300005367 | Bacteria | 38882 |
| 16 | Ga0070667_100222477 | 3300005367 | Bacteria | 1680 |
| 17 | Ga0070713_100562291 | 3300005436 | Bacteria | 1081 |
| 18 | Ga0070665_100000674 | 3300005548 | Bacteria | 45861 |
| 19 | Ga0070665_100021633 | 3300005548 | Bacteria | 6468 |
| 20 | Ga0070665_100093702 | 3300005548 | Bacteria | 3008 |
| 21 | Ga0068855_100257188 | 3300005563 | Bacteria | 1946 |
| 22 | Ga0068859_100000230 | 3300005617 | Bacteria | 55064 |
| 23 | Ga0068859_100105754 | 3300005617 | Bacteria | 2873 |
| 24 | Ga0068864_100000947 | 3300005618 | Bacteria | 24277 |
| 25 | Ga0068861_100052373 | 3300005719 | Bacteria | 3101 |
| 26 | Ga0068861_100195282 | 3300005719 | Bacteria | 1695 |
| 27 | Ga0068863_100020335 | 3300005841 | Bacteria | 6347 |
| 28 | Ga0068863_100045552 | 3300005841 | Bacteria | 4162 |
| 29 | Ga0068863_100090501 | 3300005841 | Bacteria | 2901 |
| 30 | Ga0068858_100005435 | 3300005842 | Bacteria | 12484 |
| 31 | Ga0068860_100000066 | 3300005843 | Bacteria | 182836 |
| 32 | Ga0068860_100009126 | 3300005843 | Bacteria | 9864 |
| 33 | Ga0068860_100071853 | 3300005843 | Bacteria | 3287 |
| 34 | Ga0068862_100001799 | 3300005844 | Bacteria | 19402 |
| 35 | Ga0068862_100038767 | 3300005844 | Bacteria | 4043 |
| 36 | Ga0070717_10014901 | 3300006028 | Bacteria | 5986 |
| 37 | Ga0075366_10116439 | 3300006195 | Bacteria | 1609 |
| 38 | Ga0075370_10088319 | 3300006353 | Bacteria | 1787 |
| 39 | Ga0097620_100000230 | 3300006931 | Bacteria | 55064 |
| 40 | Ga0097620_100105757 | 3300006931 | Bacteria | 2873 |
| 41 | Ga0105247_10032384 | 3300009101 | Bacteria | 3177 |
| 42 | Ga0105248_10063844 | 3300009177 | Bacteria | 4133 |
| 43 | Ga0105248_10102643 | 3300009177 | Bacteria | 3223 |
| 44 | Ga0105248_10318899 | 3300009177 | Bacteria | 1750 |
| 45 | Ga0105249_10000647 | 3300009553 | Bacteria | 31757 |
| 46 | Ga0105249_11318295 | 3300009553 | Bacteria | 794 |
| 47 | Ga0157374_10158872 | 3300013296 | Bacteria | 2201 |
| 48 | Ga0163162_10073653 | 3300013306 | Bacteria | 3472 |
| 49 | Ga0163162_10101195 | 3300013306 | Bacteria | 2973 |
| 50 | Ga0157375_10188070 | 3300013308 | Bacteria | 2219 |
| 51 | Ga0163163_10277632 | 3300014325 | Bacteria | 1727 |
| 52 | Ga0163163_10422858 | 3300014325 | Bacteria | 1391 |
| 53 | Ga0163163_10436781 | 3300014325 | Bacteria | 1368 |
| 54 | Ga0163163_10624712 | 3300014325 | Bacteria | 1141 |
| 55 | Ga0157379_10010605 | 3300014968 | Bacteria | 8032 |
| 56 | Ga0157379_10078365 | 3300014968 | Bacteria | 2959 |
| 57 | Ga0163161_10179461 | 3300017792 | Bacteria | 1623 |
| 58 | Ga0213876_10000917 | 3300021384 | Bacteria | 19493 |
| 59 | Ga0213875_10234096 | 3300021388 | Bacteria | 865 |
| 60 | Ga0209565_1000192 | 3300025263 | Bacteria | 74812 |
| 61 | Ga0209673_1001713 | 3300025273 | Bacteria | 18538 |
| 62 | Ga0209675_1002802 | 3300025291 | Bacteria | 8694 |
| 63 | Ga0209564_1011716 | 3300025295 | Bacteria | 3899 |
| 64 | Ga0209564_1026208 | 3300025295 | Bacteria | 1933 |
| 65 | Ga0209758_1014823 | 3300025297 | Bacteria | 4103 |
| 66 | Ga0209050_1008468 | 3300025298 | Bacteria | 5488 |
| 67 | Ga0209256_1009549 | 3300025299 | Bacteria | 4231 |
| 68 | Ga0209257_1000554 | 3300025304 | Bacteria | 64085 |
| 69 | Ga0207710_10056272 | 3300025900 | Bacteria | 1774 |
| 70 | Ga0207705_10128182 | 3300025909 | Bacteria | 1887 |
| 71 | Ga0207681_10065962 | 3300025923 | Bacteria | 2504 |
| 72 | Ga0207681_10646871 | 3300025923 | Bacteria | 876 |
| 73 | Ga0207694_10143559 | 3300025924 | Bacteria | 1920 |
| 74 | Ga0207650_10000016 | 3300025925 | Bacteria | 361958 |
| 75 | Ga0207650_10065075 | 3300025925 | Bacteria | 2731 |
| 76 | Ga0207650_10137465 | 3300025925 | Bacteria | 1918 |
| 77 | Ga0207644_10000420 | 3300025931 | Bacteria | 27556 |
| 78 | Ga0207706_10035108 | 3300025933 | Bacteria | 4460 |
| 79 | Ga0207711_10004584 | 3300025941 | Bacteria | 11751 |
| 80 | Ga0207711_10004935 | 3300025941 | Bacteria | 11329 |
| 81 | Ga0207711_10017185 | 3300025941 | Bacteria | 6011 |
| 82 | Ga0207711_10250833 | 3300025941 | Bacteria | 1625 |
| 83 | Ga0207689_10425739 | 3300025942 | Bacteria | 1108 |
| 84 | Ga0207651_10150460 | 3300025960 | Bacteria | 1811 |
| 85 | Ga0207712_10000606 | 3300025961 | Bacteria | 28447 |
| 86 | Ga0207712_10663262 | 3300025961 | Bacteria | 907 |
| 87 | Ga0207668_10000002 | 3300025972 | Bacteria | 209163 |
| 88 | Ga0207668_10000117 | 3300025972 | Bacteria | 55600 |
| 89 | Ga0207668_10024038 | 3300025972 | Bacteria | 3927 |
| 90 | Ga0207668_10128157 | 3300025972 | Bacteria | 1933 |
| 91 | Ga0207668_10246119 | 3300025972 | Bacteria | 1449 |
| 92 | Ga0207658_10000384 | 3300025986 | Bacteria | 43187 |
| 93 | Ga0207658_10030413 | 3300025986 | Bacteria | 3822 |
| 94 | Ga0207658_10161005 | 3300025986 | Bacteria | 1839 |
| 95 | Ga0207703_10000953 | 3300026035 | Bacteria | 27985 |
| 96 | Ga0207639_10647472 | 3300026041 | Bacteria | 977 |
| 97 | Ga0207641_10000910 | 3300026088 | Bacteria | 30634 |
| 98 | Ga0207641_10055854 | 3300026088 | Bacteria | 3353 |
| 99 | Ga0207648_10926135 | 3300026089 | Bacteria | 815 |
| 100 | Ga0207676_10001180 | 3300026095 | Bacteria | 19590 |
| 101 | Ga0207676_10316358 | 3300026095 | Bacteria | 1431 |
| 102 | Ga0207675_100253861 | 3300026118 | Bacteria | 1702 |
| 103 | Ga0207675_100361781 | 3300026118 | Bacteria | 1423 |
| 104 | Ga0207698_10644028 | 3300026142 | Bacteria | 1049 |
| 105 | Ga0268266_10000887 | 3300028379 | Bacteria | 38753 |
| 106 | Ga0268266_10024328 | 3300028379 | Bacteria | 5152 |
| 107 | Ga0268265_10032486 | 3300028380 | Bacteria | 3783 |
| 108 | Ga0268265_10040289 | 3300028380 | Bacteria | 3449 |
| 109 | Ga0268264_10000113 | 3300028381 | Bacteria | 203262 |
| 110 | Ga0268264_10003286 | 3300028381 | Bacteria | 13976 |
| 111 | Ga0268264_10028219 | 3300028381 | Bacteria | 4589 |
| 112 | Ga0265334_10066310 | 3300028573 | Bacteria | 1351 |
| 113 | Ga0307515_10045615 | 3300028794 | Bacteria | 6727 |
| 114 | Ga0307515_10081335 | 3300028794 | Bacteria | 4209 |
| 115 | Ga0265338_10025243 | 3300028800 | Bacteria | 6039 |
| 116 | Ga0265338_10027553 | 3300028800 | Bacteria | 5698 |
| 117 | Ga0265338_10061568 | 3300028800 | Bacteria | 3288 |
| 118 | Ga0265338_10158178 | 3300028800 | Bacteria | 1753 |
| 119 | Ga0265338_10252544 | 3300028800 | Bacteria | 1300 |
| 120 | Ga0307511_10023644 | 3300030521 | Bacteria | 5721 |
| 121 | Ga0265327_10001271 | 3300031251 | Bacteria | 33262 |
| 122 | Ga0265327_10012471 | 3300031251 | Bacteria | 5730 |
| 123 | Ga0265327_10044215 | 3300031251 | Bacteria | 2377 |
| 124 | Ga0265327_10063961 | 3300031251 | Bacteria | 1866 |
| 125 | Ga0307408_100820463 | 3300031548 | Bacteria | 846 |
| 126 | Ga0265314_10017158 | 3300031711 | Bacteria | 5689 |
| 127 | Ga0265314_10117605 | 3300031711 | Bacteria | 1679 |
| 128 | Ga0265342_10212558 | 3300031712 | Bacteria | 1045 |
| 129 | Ga0307510_10046570 | 3300033180 | Bacteria | 4660 |
| 130 | Ga0373933_0160053 | 3300035724 | Bacteria | 1429 |
| 131 | Ga0373937_0429823 | 3300036401 | Bacteria | 1254 |
| 132 | Ga0373937_0769766 | 3300036401 | Bacteria | 910 |
| 133 | Ga0395899_0428525 | 3300037312 | Bacteria | 870 |
| 134 | Ga0436364_1384957 | 3300037853 | Bacteria | 1725 |
| 135 | Ga0436364_1542089 | 3300037853 | Bacteria | 1071 |
| 136 | Ga0436365_0585577 | 3300039437 | Bacteria | 67545 |
| 137 | Ga0436363_0667108 | 3300039450 | Bacteria | 2805 |
| 138 | Ga0439465_0027937 | 3300041413 | Bacteria | 1788 |
| 139 | Ga0439445_0038738 | 3300042004 | Bacteria | 1261 |
| 140 | Ga0439446_0016464 | 3300042156 | Bacteria | 2059 |
| 141 | Ga0439459_0020545 | 3300042438 | Bacteria | 1261 |
| 142 | Ga0495627_000414 | 3300046453 | Bacteria | 37690 |
| 143 | Ga0495638_0002922 | 3300046460 | Bacteria | 13650 |
| 144 | Ga0495638_0006168 | 3300046460 | Bacteria | 8755 |
| 145 | Ga0495638_0036995 | 3300046460 | Bacteria | 3106 |
| 146 | Ga0495638_0107542 | 3300046460 | Bacteria | 1660 |
| 147 | Ga0495596_0057784 | 3300046500 | Bacteria | 1513 |
| 148 | Ga0495606_0003326 | 3300046507 | Bacteria | 17163 |
| 149 | Ga0495610_0000524 | 3300046512 | Bacteria | 38586 |
| 150 | Ga0495610_0026767 | 3300046512 | Bacteria | 3075 |
| 151 | Ga0495616_0000016 | 3300046513 | Bacteria | 182686 |
| 152 | Ga0495616_0131536 | 3300046513 | Bacteria | 1146 |
| 153 | Ga0495620_0019844 | 3300046515 | Bacteria | 3293 |
| 154 | Ga0495631_0054498 | 3300046518 | Bacteria | 1743 |
| 155 | Ga0495632_0026438 | 3300046519 | Bacteria | 3055 |
| 156 | Ga0495632_0185915 | 3300046519 | Bacteria | 950 |
| 157 | Ga0495637_0019003 | 3300046520 | Bacteria | 3182 |
| 158 | Ga0495637_0082968 | 3300046520 | Bacteria | 1275 |
| 159 | Ga0495643_0124044 | 3300046522 | Bacteria | 1302 |
| 160 | Ga0495643_0201396 | 3300046522 | Bacteria | 955 |
| 161 | Ga0495644_0030501 | 3300046523 | Bacteria | 2036 |
| 162 | Ga0495648_0021981 | 3300046524 | Bacteria | 4404 |
| 163 | Ga0495648_0043080 | 3300046524 | Bacteria | 2833 |
| 164 | Ga0495654_0000039 | 3300046530 | Bacteria | 185363 |
| 165 | Ga0495654_0070479 | 3300046530 | Bacteria | 1658 |
| 166 | Ga0495597_0089395 | 3300046542 | Bacteria | 1309 |
| 167 | Ga0495668_0001487 | 3300046616 | Bacteria | 22445 |
| 168 | Ga0495668_0007351 | 3300046616 | Bacteria | 7056 |
| 169 | Ga0495668_0037888 | 3300046616 | Bacteria | 2696 |
| 170 | Ga0495668_0136925 | 3300046616 | Bacteria | 1340 |
| 171 | Ga0495668_0137341 | 3300046616 | Bacteria | 1338 |
| 172 | Ga0495625_0000034 | 3300046660 | Bacteria | 225120 |
| 173 | Ga0495625_0084698 | 3300046660 | Bacteria | 2201 |
| 174 | Ga0495625_0104747 | 3300046660 | Bacteria | 1939 |
| 175 | Ga0495625_0130062 | 3300046660 | Bacteria | 1706 |
| 176 | Ga0495669_0000014 | 3300046684 | Bacteria | 140832 |
| 177 | Ga0495669_0000447 | 3300046684 | Bacteria | 19503 |
| 178 | Ga0495671_0111465 | 3300046692 | Bacteria | 1336 |
| 179 | Ga0495671_0150501 | 3300046692 | Bacteria | 1133 |
| 180 | Ga0495589_0001372 | 3300046794 | Bacteria | 14212 |
| 181 | Ga0495660_0094511 | 3300046810 | Bacteria | 1548 |
| 182 | Ga0495672_0000266 | 3300047320 | Bacteria | 72321 |
| 183 | Ga0495672_0059902 | 3300047320 | Bacteria | 2201 |
| 184 | Ga0495683_0047260 | 3300047323 | Bacteria | 2160 |
| 185 | Ga0495677_0076750 | 3300047445 | Bacteria | 1249 |
| 186 | Ga0495673_0000053 | 3300047469 | Bacteria | 254433 |
| 187 | Ga0495673_0000952 | 3300047469 | Bacteria | 26174 |
| 188 | Ga0495673_0002400 | 3300047469 | Bacteria | 13213 |
| 189 | Ga0495681_0052351 | 3300047470 | Bacteria | 1916 |
| 190 | Ga0495686_0001417 | 3300047472 | Bacteria | 26265 |
| 191 | Ga0495686_0018726 | 3300047472 | Bacteria | 4638 |
| 192 | Ga0495686_0067246 | 3300047472 | Bacteria | 2212 |
| 193 | Ga0495686_0316391 | 3300047472 | Bacteria | 857 |
| 194 | Ga0496101_0016805 | 3300048904 | Bacteria | 4953 |
| 195 | Ga0496106_0025606 | 3300048909 | Bacteria | 4392 |
| 196 | Ga0496107_0001024 | 3300048910 | Bacteria | 16692 |
| 197 | Ga0496109_0005758 | 3300048912 | Bacteria | 10367 |
| 198 | Ga0496112_0056194 | 3300048915 | Bacteria | 3873 |
| 199 | Ga0496113_0250570 | 3300048916 | Bacteria | 1414 |
| 200 | Ga0496115_0000984 | 3300048918 | Bacteria | 20664 |
| 201 | Ga0496115_0001099 | 3300048918 | Bacteria | 19590 |
| 202 | Ga0496115_0753370 | 3300048918 | Bacteria | 761 |
| 203 | Ga0496121_0002729 | 3300048924 | Bacteria | 26299 |
| 204 | Ga0496124_0067528 | 3300048927 | Bacteria | 2975 |
| 205 | Ga0496124_0172038 | 3300048927 | Bacteria | 1676 |
| 206 | Ga0496125_0027065 | 3300048928 | Bacteria | 5207 |
| 207 | Ga0496125_0124223 | 3300048928 | Bacteria | 1833 |
| 208 | Ga0496126_0013838 | 3300048929 | Bacteria | 8184 |
| 209 | Ga0496126_0400657 | 3300048929 | Bacteria | 1113 |
| 210 | Ga0495678_001372 | 3300049459 | Bacteria | 19409 |
| 211 | Ga0501033_0102384 | 3300049570 | Bacteria | 2089 |
| 212 | Ga0501034_0220991 | 3300049571 | Bacteria | 1847 |
| 213 | Ga0501034_0972001 | 3300049571 | Bacteria | 734 |
| 214 | Ga0501037_0301773 | 3300049573 | Bacteria | 1112 |
| 215 | Ga0501038_0271087 | 3300049574 | Bacteria | 1338 |
| 216 | Ga0501043_0287629 | 3300049579 | Bacteria | 1259 |
| 217 | Ga0501043_0409477 | 3300049579 | Bacteria | 1024 |
| 218 | Ga0501047_0191310 | 3300049581 | Bacteria | 1909 |
| 219 | Ga0501047_0203859 | 3300049581 | Bacteria | 1838 |
| 220 | Ga0501068_0582433 | 3300049584 | Bacteria | 728 |
| 221 | Ga0501069_0058047 | 3300049585 | Bacteria | 2158 |
| 222 | Ga0501070_0049987 | 3300049586 | Bacteria | 3471 |
| 223 | Ga0501073_0403622 | 3300049589 | Bacteria | 944 |
| 224 | Ga0501074_0148958 | 3300049590 | Bacteria | 1673 |
| 225 | Ga0501238_000862 | 3300049671 | Bacteria | 3454 |
| 226 | Ga0501257_026512 | 3300049686 | Bacteria | 1384 |
| 227 | Ga0501080_0132512 | 3300049742 | Bacteria | 2307 |
| 228 | Ga0501083_0129204 | 3300049744 | Bacteria | 1656 |
| 229 | Ga0501035_0176016 | 3300049822 | Bacteria | 1845 |
| 230 | Ga0501035_0231141 | 3300049822 | Bacteria | 1576 |
| 231 | Ga0501044_0011027 | 3300049823 | Bacteria | 9807 |
| 232 | Ga0501044_0055708 | 3300049823 | Bacteria | 4060 |
| 233 | nmdc:mga0k408_93167_c1 | 3300050493 | Bacteria | 1771 |
| 234 | nmdc:mga07m45_55557_c1 | 3300050496 | Bacteria | 2238 |
| 235 | nmdc:mga0sz30_4560_c1 | 3300050516 | Bacteria | 3659 |
| 236 | Ga0500578_0000168 | 3300053086 | Bacteria | 78140 |
| 237 | Ga0500644_0000064 | 3300053088 | Bacteria | 62621 |
| 238 | Ga0500646_0087217 | 3300053090 | Bacteria | 961 |
| 239 | Ga0500554_000771 | 3300053102 | Bacteria | 6387 |
| 240 | Ga0500555_001416 | 3300053103 | Bacteria | 7391 |
| 241 | Ga0500555_037118 | 3300053103 | Bacteria | 1365 |
| 242 | Ga0500556_0004292 | 3300053104 | Bacteria | 4064 |
| 243 | Ga0500562_000280 | 3300053108 | Bacteria | 12568 |
| 244 | Ga0500594_0000119 | 3300053118 | Bacteria | 22117 |
| 245 | Ga0500595_018134 | 3300053119 | Bacteria | 2580 |
| 246 | Ga0500614_004037 | 3300053123 | Bacteria | 3123 |
| 247 | Ga0500618_000014 | 3300053125 | Bacteria | 177186 |
| 248 | Ga0500658_0049183 | 3300053134 | Bacteria | 1717 |
| 249 | Ga0500559_0000467 | 3300053136 | Bacteria | 28771 |
| 250 | Ga0500564_000259 | 3300053138 | Bacteria | 14789 |
| 251 | Ga0500577_0001921 | 3300053142 | Bacteria | 5320 |
| 252 | Ga0500588_0046953 | 3300053146 | Bacteria | 1330 |
| 253 | Ga0500622_0001411 | 3300053156 | Bacteria | 19363 |
| 254 | Ga0500627_0063281 | 3300053158 | Bacteria | 1630 |
| 255 | Ga0500634_0058591 | 3300053161 | Bacteria | 2052 |
| 256 | Ga0500611_021477 | 3300053727 | Bacteria | 1232 |
| 257 | Ga0500645_014030 | 3300053730 | Bacteria | 2562 |
| 258 | Ga0501084_0384860 | 3300054114 | Bacteria | 1185 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2510917020 | 2511125370 | 212 |
| 2 | iso_pu_bacteria | 2582581279 | 2585149598 | 212 |
| 3 | iso_pu_bacteria | 2582581280 | 2585155547 | 212 |
| 4 | iso_pu_bacteria | 2582581293 | 2585199390 | 212 |
| 5 | iso_pu_bacteria | 2643221552 | 2643781112 | 212 |
| 6 | iso_pu_bacteria | 2643221583 | 2643922426 | 212 |
| 7 | iso_pu_bacteria | 2643221584 | 2643930445 | 212 |
| 8 | iso_pu_bacteria | 2643221614 | 2644087357 | 212 |
| 9 | iso_pu_bacteria | 2643221661 | 2644344599 | 212 |
| 10 | iso_pu_bacteria | 2643221666 | 2644366717 | 212 |
| 11 | iso_pu_bacteria | 2818991435 | 2819540253 | 212 |
| 12 | iso_pu_bacteria | 2818991454 | 2819649185 | 212 |
| 13 | 3300046524 | Ga0495648_0021981 | Ga0495648_0021981_599_1240 | 213 |
| 14 | 3300047469 | Ga0495673_0000952 | Ga0495673_0000952_696_1337 | 213 |
| 15 | 3300048916 | Ga0496113_0250570 | Ga0496113_0250570_298_939 | 213 |
| 16 | 3300048927 | Ga0496124_0067528 | Ga0496124_0067528_2239_2880 | 213 |
| 17 | 3300048928 | Ga0496125_0027065 | Ga0496125_0027065_2034_2675 | 213 |
| 18 | 3300048929 | Ga0496126_0013838 | Ga0496126_0013838_1232_1873 | 213 |
| 19 | 3300050516 | nmdc:mga0sz30_4560_c1 | nmdc:mga0sz30_4560_c1_1212_1853 | 213 |
| 20 | 3300053088 | Ga0500644_0000064 | Ga0500644_0000064_37199_37840 | 213 |
| 21 | 3300053138 | Ga0500564_000259 | Ga0500564_000259_10782_11423 | 213 |
| 22 | 3300005331 | Ga0070670_100216659 | Ga0070670_1002166592 | 214 |
| 23 | 3300005347 | Ga0070668_100000707 | Ga0070668_1000007072 | 214 |
| 24 | 3300005347 | Ga0070668_100004926 | Ga0070668_10000492613 | 214 |
| 25 | 3300005347 | Ga0070668_100215707 | Ga0070668_1002157072 | 214 |
| 26 | 3300005353 | Ga0070669_100047712 | Ga0070669_1000477122 | 214 |
| 27 | 3300005367 | Ga0070667_100222477 | Ga0070667_1002224771 | 214 |
| 28 | 3300005548 | Ga0070665_100000674 | Ga0070665_10000067442 | 214 |
| 29 | 3300005617 | Ga0068859_100105754 | Ga0068859_1001057542 | 214 |
| 30 | 3300005843 | Ga0068860_100000066 | Ga0068860_100000066192 | 214 |
| 31 | 3300005843 | Ga0068860_100071853 | Ga0068860_1000718533 | 214 |
| 32 | 3300005844 | Ga0068862_100038767 | Ga0068862_1000387672 | 214 |
| 33 | 3300006931 | Ga0097620_100105757 | Ga0097620_1001057572 | 214 |
| 34 | 3300009553 | Ga0105249_11318295 | Ga0105249_113182951 | 214 |
| 35 | 3300021388 | Ga0213875_10234096 | Ga0213875_102340961 | 214 |
| 36 | 3300025923 | Ga0207681_10646871 | Ga0207681_106468711 | 214 |
| 37 | 3300025925 | Ga0207650_10137465 | Ga0207650_101374652 | 214 |
| 38 | 3300025961 | Ga0207712_10663262 | Ga0207712_106632621 | 214 |
| 39 | 3300025972 | Ga0207668_10000002 | Ga0207668_1000000289 | 214 |
| 40 | 3300025972 | Ga0207668_10128157 | Ga0207668_101281572 | 214 |
| 41 | 3300025972 | Ga0207668_10246119 | Ga0207668_102461192 | 214 |
| 42 | 3300025986 | Ga0207658_10030413 | Ga0207658_100304132 | 214 |
| 43 | 3300025986 | Ga0207658_10161005 | Ga0207658_101610052 | 214 |
| 44 | 3300026089 | Ga0207648_10926135 | Ga0207648_109261351 | 214 |
| 45 | 3300028379 | Ga0268266_10000887 | Ga0268266_100008872 | 214 |
| 46 | 3300028380 | Ga0268265_10032486 | Ga0268265_100324862 | 214 |
| 47 | 3300028380 | Ga0268265_10040289 | Ga0268265_100402892 | 214 |
| 48 | 3300028381 | Ga0268264_10000113 | Ga0268264_100001132 | 214 |
| 49 | 3300033180 | Ga0307510_10046570 | Ga0307510_100465703 | 214 |
| 50 | 3300037312 | Ga0395899_0428525 | Ga0395899_0428525_177_824 | 214 |
| 51 | 3300037853 | Ga0436364_1542089 | Ga0436364_1542089_392_1036 | 214 |
| 52 | 3300046660 | Ga0495625_0104747 | Ga0495625_0104747_828_1478 | 214 |
| 53 | 3300046660 | Ga0495625_0130062 | Ga0495625_0130062_1007_1657 | 214 |
| 54 | 3300046684 | Ga0495669_0000014 | Ga0495669_0000014_85794_86444 | 214 |
| 55 | 3300046684 | Ga0495669_0000447 | Ga0495669_0000447_9157_9807 | 214 |
| 56 | 3300047445 | Ga0495677_0076750 | Ga0495677_0076750_506_1156 | 214 |
| 57 | 3300048928 | Ga0496125_0124223 | Ga0496125_0124223_156_806 | 214 |
| 58 | 3300049571 | Ga0501034_0972001 | Ga0501034_0972001_67_711 | 214 |
| 59 | 3300049573 | Ga0501037_0301773 | Ga0501037_0301773_24_668 | 214 |
| 60 | 3300049574 | Ga0501038_0271087 | Ga0501038_0271087_457_1101 | 214 |
| 61 | 3300049579 | Ga0501043_0287629 | Ga0501043_0287629_426_1070 | 214 |
| 62 | 3300049581 | Ga0501047_0191310 | Ga0501047_0191310_353_997 | 214 |
| 63 | 3300049584 | Ga0501068_0582433 | Ga0501068_0582433_41_685 | 214 |
| 64 | 3300049585 | Ga0501069_0058047 | Ga0501069_0058047_1138_1782 | 214 |
| 65 | 3300049586 | Ga0501070_0049987 | Ga0501070_0049987_2532_3176 | 214 |
| 66 | 3300049589 | Ga0501073_0403622 | Ga0501073_0403622_97_741 | 214 |
| 67 | 3300049590 | Ga0501074_0148958 | Ga0501074_0148958_974_1618 | 214 |
| 68 | 3300049686 | Ga0501257_026512 | Ga0501257_026512_70_717 | 214 |
| 69 | 3300049742 | Ga0501080_0132512 | Ga0501080_0132512_662_1306 | 214 |
| 70 | 3300049744 | Ga0501083_0129204 | Ga0501083_0129204_731_1375 | 214 |
| 71 | 3300049822 | Ga0501035_0176016 | Ga0501035_0176016_775_1419 | 214 |
| 72 | 3300049822 | Ga0501035_0231141 | Ga0501035_0231141_272_922 | 214 |
| 73 | 3300049823 | Ga0501044_0055708 | Ga0501044_0055708_763_1407 | 214 |
| 74 | 3300053090 | Ga0500646_0087217 | Ga0500646_0087217_17_667 | 214 |
| 75 | 3300053103 | Ga0500555_001416 | Ga0500555_001416_5615_6265 | 214 |
| 76 | 3300054114 | Ga0501084_0384860 | Ga0501084_0384860_135_779 | 214 |
| 77 | iso_pu_bacteria | 2643221598 | 2643998689 | 214 |
| 78 | 3300005335 | Ga0070666_10189557 | Ga0070666_101895572 | 215 |
| 79 | 3300005367 | Ga0070667_100000517 | Ga0070667_10000051746 | 215 |
| 80 | 3300005548 | Ga0070665_100021633 | Ga0070665_1000216337 | 215 |
| 81 | 3300005563 | Ga0068855_100257188 | Ga0068855_1002571882 | 215 |
| 82 | 3300005618 | Ga0068864_100000947 | Ga0068864_1000009472 | 215 |
| 83 | 3300005719 | Ga0068861_100195282 | Ga0068861_1001952822 | 215 |
| 84 | 3300005841 | Ga0068863_100020335 | Ga0068863_1000203357 | 215 |
| 85 | 3300005841 | Ga0068863_100090501 | Ga0068863_1000905012 | 215 |
| 86 | 3300005843 | Ga0068860_100009126 | Ga0068860_10000912612 | 215 |
| 87 | 3300005844 | Ga0068862_100001799 | Ga0068862_1000017992 | 215 |
| 88 | 3300006028 | Ga0070717_10014901 | Ga0070717_100149015 | 215 |
| 89 | 3300009177 | Ga0105248_10102643 | Ga0105248_101026434 | 215 |
| 90 | 3300009177 | Ga0105248_10318899 | Ga0105248_103188992 | 215 |
| 91 | 3300009553 | Ga0105249_10000647 | Ga0105249_1000064719 | 215 |
| 92 | 3300013296 | Ga0157374_10158872 | Ga0157374_101588722 | 215 |
| 93 | 3300013306 | Ga0163162_10101195 | Ga0163162_101011952 | 215 |
| 94 | 3300013308 | Ga0157375_10188070 | Ga0157375_101880702 | 215 |
| 95 | 3300014325 | Ga0163163_10277632 | Ga0163163_102776322 | 215 |
| 96 | 3300014968 | Ga0157379_10078365 | Ga0157379_100783652 | 215 |
| 97 | 3300017792 | Ga0163161_10179461 | Ga0163161_101794612 | 215 |
| 98 | 3300025900 | Ga0207710_10056272 | Ga0207710_100562722 | 215 |
| 99 | 3300025924 | Ga0207694_10143559 | Ga0207694_101435592 | 215 |
| 100 | 3300025925 | Ga0207650_10000016 | Ga0207650_1000001681 | 215 |
| 101 | 3300025925 | Ga0207650_10065075 | Ga0207650_100650752 | 215 |
| 102 | 3300025933 | Ga0207706_10035108 | Ga0207706_100351086 | 215 |
| 103 | 3300025941 | Ga0207711_10004935 | Ga0207711_100049359 | 215 |
| 104 | 3300025941 | Ga0207711_10017185 | Ga0207711_100171857 | 215 |
| 105 | 3300025941 | Ga0207711_10250833 | Ga0207711_102508332 | 215 |
| 106 | 3300025960 | Ga0207651_10150460 | Ga0207651_101504602 | 215 |
| 107 | 3300025961 | Ga0207712_10000606 | Ga0207712_1000060630 | 215 |
| 108 | 3300025972 | Ga0207668_10000117 | Ga0207668_1000011759 | 215 |
| 109 | 3300025986 | Ga0207658_10000384 | Ga0207658_100003844 | 215 |
| 110 | 3300026041 | Ga0207639_10647472 | Ga0207639_106474722 | 215 |
| 111 | 3300026088 | Ga0207641_10000910 | Ga0207641_1000091030 | 215 |
| 112 | 3300026095 | Ga0207676_10001180 | Ga0207676_100011802 | 215 |
| 113 | 3300026095 | Ga0207676_10316358 | Ga0207676_103163582 | 215 |
| 114 | 3300026118 | Ga0207675_100253861 | Ga0207675_1002538613 | 215 |
| 115 | 3300026142 | Ga0207698_10644028 | Ga0207698_106440281 | 215 |
| 116 | 3300028379 | Ga0268266_10024328 | Ga0268266_100243282 | 215 |
| 117 | 3300028381 | Ga0268264_10003286 | Ga0268264_1000328616 | 215 |
| 118 | 3300030521 | Ga0307511_10023644 | Ga0307511_100236446 | 215 |
| 119 | 3300036401 | Ga0373937_0769766 | Ga0373937_0769766_247_897 | 215 |
| 120 | 3300046500 | Ga0495596_0057784 | Ga0495596_0057784_19_675 | 215 |
| 121 | 3300046616 | Ga0495668_0136925 | Ga0495668_0136925_82_735 | 215 |
| 122 | 3300046616 | Ga0495668_0137341 | Ga0495668_0137341_277_927 | 215 |
| 123 | 3300047320 | Ga0495672_0059902 | Ga0495672_0059902_562_1227 | 215 |
| 124 | 3300048904 | Ga0496101_0016805 | Ga0496101_0016805_650_1336 | 215 |
| 125 | 3300048912 | Ga0496109_0005758 | Ga0496109_0005758_8780_9466 | 215 |
| 126 | 3300048915 | Ga0496112_0056194 | Ga0496112_0056194_806_1492 | 215 |
| 127 | 3300048918 | Ga0496115_0000984 | Ga0496115_0000984_1151_1837 | 215 |
| 128 | 3300049571 | Ga0501034_0220991 | Ga0501034_0220991_465_1115 | 215 |
| 129 | 3300053108 | Ga0500562_000280 | Ga0500562_000280_7937_8602 | 215 |
| 130 | 3300003215 | JGI25153J46596_10087600 | JGI25153J46596_100876001 | 216 |
| 131 | 3300003771 | Ga0055526_1017431 | Ga0055526_10174312 | 216 |
| 132 | 3300003790 | Ga0055528_1018751 | Ga0055528_10187512 | 216 |
| 133 | 3300003794 | Ga0055531_10010993 | Ga0055531_100109932 | 216 |
| 134 | 3300005262 | Ga0065165_1001500 | Ga0065165_10015003 | 216 |
| 135 | 3300005328 | Ga0070676_10192560 | Ga0070676_101925602 | 216 |
| 136 | 3300005347 | Ga0070668_100005900 | Ga0070668_1000059006 | 216 |
| 137 | 3300005353 | Ga0070669_100077694 | Ga0070669_1000776942 | 216 |
| 138 | 3300005436 | Ga0070713_100562291 | Ga0070713_1005622912 | 216 |
| 139 | 3300005548 | Ga0070665_100093702 | Ga0070665_1000937022 | 216 |
| 140 | 3300005617 | Ga0068859_100000230 | Ga0068859_10000023059 | 216 |
| 141 | 3300005719 | Ga0068861_100052373 | Ga0068861_1000523734 | 216 |
| 142 | 3300005841 | Ga0068863_100045552 | Ga0068863_1000455522 | 216 |
| 143 | 3300005842 | Ga0068858_100005435 | Ga0068858_10000543511 | 216 |
| 144 | 3300006195 | Ga0075366_10116439 | Ga0075366_101164392 | 216 |
| 145 | 3300006353 | Ga0075370_10088319 | Ga0075370_100883192 | 216 |
| 146 | 3300006931 | Ga0097620_100000230 | Ga0097620_10000023059 | 216 |
| 147 | 3300009101 | Ga0105247_10032384 | Ga0105247_100323842 | 216 |
| 148 | 3300009177 | Ga0105248_10063844 | Ga0105248_100638445 | 216 |
| 149 | 3300013306 | Ga0163162_10073653 | Ga0163162_100736532 | 216 |
| 150 | 3300014325 | Ga0163163_10422858 | Ga0163163_104228582 | 216 |
| 151 | 3300014325 | Ga0163163_10436781 | Ga0163163_104367812 | 216 |
| 152 | 3300014325 | Ga0163163_10624712 | Ga0163163_106247122 | 216 |
| 153 | 3300014968 | Ga0157379_10010605 | Ga0157379_100106052 | 216 |
| 154 | 3300021384 | Ga0213876_10000917 | Ga0213876_1000091718 | 216 |
| 155 | 3300025263 | Ga0209565_1000192 | Ga0209565_100019265 | 216 |
| 156 | 3300025273 | Ga0209673_1001713 | Ga0209673_100171313 | 216 |
| 157 | 3300025291 | Ga0209675_1002802 | Ga0209675_10028025 | 216 |
| 158 | 3300025295 | Ga0209564_1011716 | Ga0209564_10117162 | 216 |
| 159 | 3300025295 | Ga0209564_1026208 | Ga0209564_10262082 | 216 |
| 160 | 3300025297 | Ga0209758_1014823 | Ga0209758_10148232 | 216 |
| 161 | 3300025298 | Ga0209050_1008468 | Ga0209050_10084681 | 216 |
| 162 | 3300025299 | Ga0209256_1009549 | Ga0209256_10095493 | 216 |
| 163 | 3300025304 | Ga0209257_1000554 | Ga0209257_100055453 | 216 |
| 164 | 3300025909 | Ga0207705_10128182 | Ga0207705_101281822 | 216 |
| 165 | 3300025923 | Ga0207681_10065962 | Ga0207681_100659622 | 216 |
| 166 | 3300025931 | Ga0207644_10000420 | Ga0207644_100004205 | 216 |
| 167 | 3300025941 | Ga0207711_10004584 | Ga0207711_1000458410 | 216 |
| 168 | 3300025942 | Ga0207689_10425739 | Ga0207689_104257391 | 216 |
| 169 | 3300025972 | Ga0207668_10024038 | Ga0207668_100240382 | 216 |
| 170 | 3300026035 | Ga0207703_10000953 | Ga0207703_100009538 | 216 |
| 171 | 3300026088 | Ga0207641_10055854 | Ga0207641_100558545 | 216 |
| 172 | 3300026118 | Ga0207675_100361781 | Ga0207675_1003617812 | 216 |
| 173 | 3300028381 | Ga0268264_10028219 | Ga0268264_100282192 | 216 |
| 174 | 3300028573 | Ga0265334_10066310 | Ga0265334_100663102 | 216 |
| 175 | 3300028794 | Ga0307515_10045615 | Ga0307515_100456152 | 216 |
| 176 | 3300028794 | Ga0307515_10081335 | Ga0307515_100813352 | 216 |
| 177 | 3300028800 | Ga0265338_10025243 | Ga0265338_100252432 | 216 |
| 178 | 3300028800 | Ga0265338_10027553 | Ga0265338_100275531 | 216 |
| 179 | 3300028800 | Ga0265338_10061568 | Ga0265338_100615682 | 216 |
| 180 | 3300028800 | Ga0265338_10158178 | Ga0265338_101581782 | 216 |
| 181 | 3300028800 | Ga0265338_10252544 | Ga0265338_102525442 | 216 |
| 182 | 3300031251 | Ga0265327_10001271 | Ga0265327_1000127126 | 216 |
| 183 | 3300031251 | Ga0265327_10012471 | Ga0265327_100124711 | 216 |
| 184 | 3300031251 | Ga0265327_10044215 | Ga0265327_100442152 | 216 |
| 185 | 3300031251 | Ga0265327_10063961 | Ga0265327_100639612 | 216 |
| 186 | 3300031548 | Ga0307408_100820463 | Ga0307408_1008204631 | 216 |
| 187 | 3300031711 | Ga0265314_10017158 | Ga0265314_100171584 | 216 |
| 188 | 3300031711 | Ga0265314_10117605 | Ga0265314_101176051 | 216 |
| 189 | 3300031712 | Ga0265342_10212558 | Ga0265342_102125582 | 216 |
| 190 | 3300035724 | Ga0373933_0160053 | Ga0373933_0160053_170_829 | 216 |
| 191 | 3300036401 | Ga0373937_0429823 | Ga0373937_0429823_280_939 | 216 |
| 192 | 3300037853 | Ga0436364_1384957 | Ga0436364_1384957_202_864 | 216 |
| 193 | 3300039437 | Ga0436365_0585577 | Ga0436365_0585577_60363_61016 | 216 |
| 194 | 3300039450 | Ga0436363_0667108 | Ga0436363_0667108_382_1035 | 216 |
| 195 | 3300041413 | Ga0439465_0027937 | Ga0439465_0027937_855_1505 | 216 |
| 196 | 3300042004 | Ga0439445_0038738 | Ga0439445_0038738_378_1028 | 216 |
| 197 | 3300042156 | Ga0439446_0016464 | Ga0439446_0016464_1153_1803 | 216 |
| 198 | 3300042438 | Ga0439459_0020545 | Ga0439459_0020545_491_1141 | 216 |
| 199 | 3300046453 | Ga0495627_000414 | Ga0495627_000414_20440_21090 | 216 |
| 200 | 3300046460 | Ga0495638_0002922 | Ga0495638_0002922_492_1142 | 216 |
| 201 | 3300046460 | Ga0495638_0006168 | Ga0495638_0006168_577_1227 | 216 |
| 202 | 3300046460 | Ga0495638_0036995 | Ga0495638_0036995_1671_2321 | 216 |
| 203 | 3300046460 | Ga0495638_0107542 | Ga0495638_0107542_283_933 | 216 |
| 204 | 3300046507 | Ga0495606_0003326 | Ga0495606_0003326_6319_6969 | 216 |
| 205 | 3300046512 | Ga0495610_0000524 | Ga0495610_0000524_1323_1973 | 216 |
| 206 | 3300046512 | Ga0495610_0026767 | Ga0495610_0026767_234_884 | 216 |
| 207 | 3300046513 | Ga0495616_0000016 | Ga0495616_0000016_135823_136473 | 216 |
| 208 | 3300046513 | Ga0495616_0131536 | Ga0495616_0131536_284_934 | 216 |
| 209 | 3300046515 | Ga0495620_0019844 | Ga0495620_0019844_992_1657 | 216 |
| 210 | 3300046518 | Ga0495631_0054498 | Ga0495631_0054498_892_1542 | 216 |
| 211 | 3300046519 | Ga0495632_0026438 | Ga0495632_0026438_527_1177 | 216 |
| 212 | 3300046519 | Ga0495632_0185915 | Ga0495632_0185915_199_849 | 216 |
| 213 | 3300046520 | Ga0495637_0019003 | Ga0495637_0019003_1575_2225 | 216 |
| 214 | 3300046520 | Ga0495637_0082968 | Ga0495637_0082968_609_1259 | 216 |
| 215 | 3300046522 | Ga0495643_0124044 | Ga0495643_0124044_509_1159 | 216 |
| 216 | 3300046522 | Ga0495643_0201396 | Ga0495643_0201396_212_862 | 216 |
| 217 | 3300046523 | Ga0495644_0030501 | Ga0495644_0030501_1222_1887 | 216 |
| 218 | 3300046524 | Ga0495648_0043080 | Ga0495648_0043080_1973_2638 | 216 |
| 219 | 3300046530 | Ga0495654_0000039 | Ga0495654_0000039_163215_163880 | 216 |
| 220 | 3300046530 | Ga0495654_0070479 | Ga0495654_0070479_772_1422 | 216 |
| 221 | 3300046542 | Ga0495597_0089395 | Ga0495597_0089395_169_819 | 216 |
| 222 | 3300046616 | Ga0495668_0001487 | Ga0495668_0001487_746_1396 | 216 |
| 223 | 3300046616 | Ga0495668_0007351 | Ga0495668_0007351_608_1258 | 216 |
| 224 | 3300046616 | Ga0495668_0037888 | Ga0495668_0037888_1423_2073 | 216 |
| 225 | 3300046660 | Ga0495625_0000034 | Ga0495625_0000034_647_1297 | 216 |
| 226 | 3300046660 | Ga0495625_0084698 | Ga0495625_0084698_231_881 | 216 |
| 227 | 3300046692 | Ga0495671_0111465 | Ga0495671_0111465_398_1048 | 216 |
| 228 | 3300046692 | Ga0495671_0150501 | Ga0495671_0150501_68_718 | 216 |
| 229 | 3300046794 | Ga0495589_0001372 | Ga0495589_0001372_794_1444 | 216 |
| 230 | 3300046810 | Ga0495660_0094511 | Ga0495660_0094511_749_1399 | 216 |
| 231 | 3300047320 | Ga0495672_0000266 | Ga0495672_0000266_13041_13691 | 216 |
| 232 | 3300047323 | Ga0495683_0047260 | Ga0495683_0047260_1296_1946 | 216 |
| 233 | 3300047469 | Ga0495673_0000053 | Ga0495673_0000053_201386_202036 | 216 |
| 234 | 3300047469 | Ga0495673_0002400 | Ga0495673_0002400_46_696 | 216 |
| 235 | 3300047470 | Ga0495681_0052351 | Ga0495681_0052351_639_1289 | 216 |
| 236 | 3300047472 | Ga0495686_0001417 | Ga0495686_0001417_690_1340 | 216 |
| 237 | 3300047472 | Ga0495686_0018726 | Ga0495686_0018726_3762_4412 | 216 |
| 238 | 3300047472 | Ga0495686_0067246 | Ga0495686_0067246_1338_1988 | 216 |
| 239 | 3300047472 | Ga0495686_0316391 | Ga0495686_0316391_174_824 | 216 |
| 240 | 3300048909 | Ga0496106_0025606 | Ga0496106_0025606_2827_3477 | 216 |
| 241 | 3300048910 | Ga0496107_0001024 | Ga0496107_0001024_11558_12208 | 216 |
| 242 | 3300048918 | Ga0496115_0001099 | Ga0496115_0001099_17551_18201 | 216 |
| 243 | 3300048918 | Ga0496115_0753370 | Ga0496115_0753370_27_677 | 216 |
| 244 | 3300048924 | Ga0496121_0002729 | Ga0496121_0002729_15228_15878 | 216 |
| 245 | 3300048927 | Ga0496124_0172038 | Ga0496124_0172038_423_1073 | 216 |
| 246 | 3300048929 | Ga0496126_0400657 | Ga0496126_0400657_365_1015 | 216 |
| 247 | 3300049459 | Ga0495678_001372 | Ga0495678_001372_18050_18700 | 216 |
| 248 | 3300049570 | Ga0501033_0102384 | Ga0501033_0102384_657_1319 | 216 |
| 249 | 3300049579 | Ga0501043_0409477 | Ga0501043_0409477_109_771 | 216 |
| 250 | 3300049581 | Ga0501047_0203859 | Ga0501047_0203859_371_1033 | 216 |
| 251 | 3300049671 | Ga0501238_000862 | Ga0501238_000862_1916_2581 | 216 |
| 252 | 3300049823 | Ga0501044_0011027 | Ga0501044_0011027_252_914 | 216 |
| 253 | 3300050493 | nmdc:mga0k408_93167_c1 | nmdc:mga0k408_93167_c1_197_847 | 216 |
| 254 | 3300050496 | nmdc:mga07m45_55557_c1 | nmdc:mga07m45_55557_c1_769_1419 | 216 |
| 255 | 3300053086 | Ga0500578_0000168 | Ga0500578_0000168_996_1646 | 216 |
| 256 | 3300053102 | Ga0500554_000771 | Ga0500554_000771_2222_2872 | 216 |
| 257 | 3300053103 | Ga0500555_037118 | Ga0500555_037118_354_1004 | 216 |
| 258 | 3300053104 | Ga0500556_0004292 | Ga0500556_0004292_1205_1855 | 216 |
| 259 | 3300053118 | Ga0500594_0000119 | Ga0500594_0000119_6617_7267 | 216 |
| 260 | 3300053119 | Ga0500595_018134 | Ga0500595_018134_921_1571 | 216 |
| 261 | 3300053123 | Ga0500614_004037 | Ga0500614_004037_889_1539 | 216 |
| 262 | 3300053125 | Ga0500618_000014 | Ga0500618_000014_22451_23101 | 216 |
| 263 | 3300053134 | Ga0500658_0049183 | Ga0500658_0049183_48_698 | 216 |
| 264 | 3300053136 | Ga0500559_0000467 | Ga0500559_0000467_8655_9305 | 216 |
| 265 | 3300053142 | Ga0500577_0001921 | Ga0500577_0001921_2336_2986 | 216 |
| 266 | 3300053146 | Ga0500588_0046953 | Ga0500588_0046953_53_703 | 216 |
| 267 | 3300053156 | Ga0500622_0001411 | Ga0500622_0001411_18103_18753 | 216 |
| 268 | 3300053158 | Ga0500627_0063281 | Ga0500627_0063281_449_1114 | 216 |
| 269 | 3300053161 | Ga0500634_0058591 | Ga0500634_0058591_1075_1725 | 216 |
| 270 | 3300053727 | Ga0500611_021477 | Ga0500611_021477_44_694 | 216 |
| 271 | 3300053730 | Ga0500645_014030 | Ga0500645_014030_1696_2346 | 216 |
| 272 | iso_pu_bacteria | 2643221545 | 2643748144 | 216 |
| 273 | iso_pu_bacteria | 2643221691 | 2644506848 | 216 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3r20-assembly1.cif.gz_A | crystal structure of cytidylate kinase from mycobacterium smegmatis | 0.9002 | 2 | 202 |
| 1kdt-assembly1.cif.gz_A | cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate | 0.8936 | 1 | 207 |
| 2feo-assembly1.cif.gz_A | mutant r188m of the cytidine monophosphate kinase from e. coli complexed with dcmp | 0.8879 | 1 | 206 |
| 1kdt-assembly1.cif.gz_A | cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate | 0.8548 | 1 | 207 |
| 4e22-assembly1.cif.gz_A | structure of cytidine monophosphate kinase from yersinia pseudotuberculosis | 0.8492 | 2 | 204 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2femA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8415 | 1 | 209 | 3.40.50.300 |
| af_Q2FYF5_1_183_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8365 | 37 | 205 | 3.40.50.300 |
| 2h92C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8359 | 2 | 206 | 3.40.50.300 |
| 2femA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8154 | 1 | 209 | 3.40.50.300 |
| 4dieB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8094 | 2 | 206 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q3JMQ5-F1-model_v4 | (d)CMP kinase (EC 2.7.4.25) | 0.9882 | 1 | 163 |
GO:0004127
GO:0005524 |
| AF-A0A1Q3JMQ5-F1-model_v4 | (d)CMP kinase (EC 2.7.4.25) | 0.9764 | 1 | 163 |
GO:0004127
GO:0005524 |
| AF-A0A528FLU9-F1-model_v4 | (d)CMP kinase (EC 2.7.4.25) | 0.9698 | 2 | 125 |
GO:0005524
GO:0036430 GO:0036431 |
| AF-A0A562NTJ0-F1-model_v4 | Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) | 0.9682 | 2 | 213 |
GO:0005524
GO:0005737 GO:0006220 GO:0036430 GO:0036431 |
| AF-A0A2P7BK29-F1-model_v4 | Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) | 0.9665 | 2 | 210 |
GO:0005524
GO:0005737 GO:0006220 GO:0016020 GO:0036430 GO:0036431 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar