F379441
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 274 | 151 | 272 | 367 |
Family's Representative Sequence
| Representative Sequence | 3300003323|rootH1_10005544|rootH1_1000554410 |
| Length | 406 |
| Sequence | MKGNGDIMISSATGRDAPSSKPGPKERAPSRWARAWQRRGGALATLAAFTLLTAWPGAYAQAGTVRMKELVDVQGFRENFLYGYGLVVGLPGTGDTETVFFTSQSISGMLGRLGIRIDPNQVRTRNVAAVMVTARLPTFERTGNKLDIAVASMGNARSLAGGVLLLTPLTGPDGQVYAIAQGPVQAGGFDVAAFGSRMAKNQPTSGSVPAGATVERAVTPNLDKPQLTLGLRRPDFTTAARIADAVNQALGNDAAKALDAAAVEVKVPEEFKGKTVGLMAKLEALEVDADQRAKVVVSERTGTVVAGEKVKIRPVAVAHGSLSVSVAAAPVISQPNAFGRGQTVNRTQAAVNATEKEKPVTALPATATVEDLAKALNTLGVGARDLVSILQAMKAAGALDADLEVL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 3 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 7 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 32 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 48 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 49 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 50 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 53 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 54 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 56 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 71 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 72 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 73 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 74 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 75 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 76 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 77 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 78 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 79 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 80 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 81 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 82 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 83 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 84 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 85 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 86 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 87 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 88 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 89 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 90 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 91 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 92 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 93 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 94 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 95 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 96 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 97 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 98 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 99 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 100 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 101 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 102 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 103 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 104 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 105 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 106 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 107 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 108 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 109 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 110 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 119 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 120 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 121 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 122 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 123 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 124 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 126 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 127 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 129 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 130 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 132 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 135 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 149 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.91 |
| Metatranscriptomes | 0.36 |
| Isolates | 0.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.2 |
| Nodule | 0 |
| Rhizoplane | 1.46 |
| Rhizosphere | 89.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_4592414 | 2162886012 | Bacteria | 1803 |
| 2 | rootH1_10005544 | 3300003323 | Bacteria | 13059 |
| 3 | Ga0055527_1000086 | 3300003760 | Bacteria | 73266 |
| 4 | Ga0055535_1000155 | 3300003761 | Bacteria | 73262 |
| 5 | Ga0055535_1000627 | 3300003761 | Bacteria | 28395 |
| 6 | Ga0055542_1000201 | 3300003762 | Bacteria | 73262 |
| 7 | Ga0055542_1000630 | 3300003762 | Bacteria | 29611 |
| 8 | Ga0055529_1000222 | 3300003763 | Bacteria | 73266 |
| 9 | Ga0055529_1000594 | 3300003763 | Bacteria | 28386 |
| 10 | Ga0065715_10139848 | 3300005293 | Bacteria | 1870 |
| 11 | Ga0070683_100271032 | 3300005329 | Bacteria | 1615 |
| 12 | Ga0070689_100000001 | 3300005340 | Bacteria | 1334580 |
| 13 | Ga0070689_100000986 | 3300005340 | Bacteria | 17822 |
| 14 | Ga0070671_100283135 | 3300005355 | Unclassified | 1410 |
| 15 | Ga0070688_100030196 | 3300005365 | Bacteria | 3251 |
| 16 | Ga0070659_100038674 | 3300005366 | Bacteria | 3722 |
| 17 | Ga0070663_100074784 | 3300005455 | Bacteria | 2474 |
| 18 | Ga0070681_10110338 | 3300005458 | Bacteria | 2691 |
| 19 | Ga0070707_100086151 | 3300005468 | Bacteria | 3037 |
| 20 | Ga0070699_100067235 | 3300005518 | Unclassified | 3112 |
| 21 | Ga0070699_100111549 | 3300005518 | Bacteria | 2402 |
| 22 | Ga0070699_100195941 | 3300005518 | Bacteria | 1796 |
| 23 | Ga0070679_100008208 | 3300005530 | Bacteria | 9816 |
| 24 | Ga0070679_100266618 | 3300005530 | Bacteria | 1667 |
| 25 | Ga0070684_100010098 | 3300005535 | Bacteria | 7466 |
| 26 | Ga0070697_100067823 | 3300005536 | Bacteria | 2919 |
| 27 | Ga0070697_100102643 | 3300005536 | Bacteria | 2376 |
| 28 | Ga0068853_100000624 | 3300005539 | Bacteria | 24300 |
| 29 | Ga0070665_100007157 | 3300005548 | Bacteria | 11345 |
| 30 | Ga0068855_100058733 | 3300005563 | Bacteria | 4503 |
| 31 | Ga0068855_100063325 | 3300005563 | Bacteria | 4315 |
| 32 | Ga0068857_100018073 | 3300005577 | Bacteria | 6186 |
| 33 | Ga0068856_100083409 | 3300005614 | Unclassified | 3174 |
| 34 | Ga0070702_100072444 | 3300005615 | Bacteria | 2039 |
| 35 | Ga0068852_100147519 | 3300005616 | Bacteria | 2184 |
| 36 | Ga0070717_10052152 | 3300006028 | Unclassified | 3369 |
| 37 | Ga0070717_10094852 | 3300006028 | Bacteria | 2525 |
| 38 | Ga0097621_100178432 | 3300006237 | Unclassified | 1834 |
| 39 | Ga0075435_100052068 | 3300007076 | Bacteria | 3299 |
| 40 | Ga0105240_10000049 | 3300009093 | Bacteria | 236718 |
| 41 | Ga0105240_10000766 | 3300009093 | Bacteria | 58387 |
| 42 | Ga0105240_10018290 | 3300009093 | Bacteria | 9419 |
| 43 | Ga0105240_10056525 | 3300009093 | Bacteria | 4910 |
| 44 | Ga0114129_10117442 | 3300009147 | Bacteria | 3666 |
| 45 | Ga0105241_10040373 | 3300009174 | Unclassified | 3523 |
| 46 | Ga0105237_10000155 | 3300009545 | Bacteria | 96466 |
| 47 | Ga0105238_10009442 | 3300009551 | Bacteria | 9765 |
| 48 | Ga0105238_10014275 | 3300009551 | Bacteria | 8028 |
| 49 | Ga0105239_10094977 | 3300010375 | Bacteria | 3294 |
| 50 | Ga0157373_10099583 | 3300013100 | Bacteria | 2045 |
| 51 | Ga0157369_10048226 | 3300013105 | Unclassified | 4622 |
| 52 | Ga0157378_10019335 | 3300013297 | Bacteria | 5989 |
| 53 | Ga0163162_10054774 | 3300013306 | Bacteria | 4013 |
| 54 | Ga0157372_10012189 | 3300013307 | Bacteria | 9157 |
| 55 | Ga0157372_10032358 | 3300013307 | Bacteria | 5734 |
| 56 | Ga0163163_10000284 | 3300014325 | Bacteria | 50589 |
| 57 | Ga0157380_10264507 | 3300014326 | Unclassified | 1564 |
| 58 | Ga0157379_10000024 | 3300014968 | Bacteria | 90098 |
| 59 | Ga0157376_10010446 | 3300014969 | Bacteria | 6791 |
| 60 | Ga0182006_1007701 | 3300015261 | Bacteria | 4918 |
| 61 | Ga0182007_10000070 | 3300015262 | Bacteria | 82063 |
| 62 | Ga0228598_1007165 | 3300024227 | Unclassified | 2281 |
| 63 | Ga0209672_100009 | 3300025228 | Bacteria | 883623 |
| 64 | Ga0209672_100382 | 3300025228 | Bacteria | 26978 |
| 65 | Ga0209258_100011 | 3300025242 | Bacteria | 867542 |
| 66 | Ga0209258_100334 | 3300025242 | Bacteria | 70788 |
| 67 | Ga0209258_105669 | 3300025242 | Bacteria | 2074 |
| 68 | Ga0209646_1002233 | 3300025246 | Bacteria | 4452 |
| 69 | Ga0209026_1001018 | 3300025250 | Bacteria | 13840 |
| 70 | Ga0209148_1000013 | 3300025254 | Bacteria | 956684 |
| 71 | Ga0209148_1000340 | 3300025254 | Bacteria | 62403 |
| 72 | Ga0209759_1000451 | 3300025256 | Bacteria | 47569 |
| 73 | Ga0209455_1000012 | 3300025272 | Bacteria | 867234 |
| 74 | Ga0209455_1000256 | 3300025272 | Bacteria | 62403 |
| 75 | Ga0207705_10001824 | 3300025909 | Bacteria | 16770 |
| 76 | Ga0207707_10104382 | 3300025912 | Bacteria | 2477 |
| 77 | Ga0207695_10000114 | 3300025913 | Bacteria | 242465 |
| 78 | Ga0207695_10002323 | 3300025913 | Bacteria | 28360 |
| 79 | Ga0207695_10010241 | 3300025913 | Bacteria | 11493 |
| 80 | Ga0207695_10072075 | 3300025913 | Unclassified | 3526 |
| 81 | Ga0207671_10002734 | 3300025914 | Bacteria | 18441 |
| 82 | Ga0207693_10201496 | 3300025915 | Bacteria | 1565 |
| 83 | Ga0207652_10000559 | 3300025921 | Bacteria | 37575 |
| 84 | Ga0207652_10066758 | 3300025921 | Bacteria | 3118 |
| 85 | Ga0207694_10013083 | 3300025924 | Bacteria | 6249 |
| 86 | Ga0207694_10015772 | 3300025924 | Bacteria | 5701 |
| 87 | Ga0207694_10055248 | 3300025924 | Bacteria | 3083 |
| 88 | Ga0207690_10024679 | 3300025932 | Bacteria | 3767 |
| 89 | Ga0207670_10000002 | 3300025936 | Bacteria | 783058 |
| 90 | Ga0207670_10000391 | 3300025936 | Bacteria | 25175 |
| 91 | Ga0207667_10115597 | 3300025949 | Bacteria | 2765 |
| 92 | Ga0207639_10005899 | 3300026041 | Bacteria | 8301 |
| 93 | Ga0207674_10030558 | 3300026116 | Bacteria | 5662 |
| 94 | Ga0268266_10148498 | 3300028379 | Bacteria | 2110 |
| 95 | Ga0265337_1003805 | 3300028556 | Bacteria | 6422 |
| 96 | Ga0265319_1000716 | 3300028563 | Bacteria | 21717 |
| 97 | Ga0265319_1034963 | 3300028563 | Bacteria | 1726 |
| 98 | Ga0265319_1045154 | 3300028563 | Bacteria | 1474 |
| 99 | Ga0265334_10020457 | 3300028573 | Unclassified | 2709 |
| 100 | Ga0265318_10000050 | 3300028577 | Bacteria | 118340 |
| 101 | Ga0265318_10000195 | 3300028577 | Bacteria | 53122 |
| 102 | Ga0265318_10000223 | 3300028577 | Bacteria | 48902 |
| 103 | Ga0265323_10001911 | 3300028653 | Bacteria | 9818 |
| 104 | Ga0265323_10002764 | 3300028653 | Bacteria | 7908 |
| 105 | Ga0265323_10004726 | 3300028653 | Bacteria | 5840 |
| 106 | Ga0265323_10006308 | 3300028653 | Bacteria | 4985 |
| 107 | Ga0265323_10022121 | 3300028653 | Unclassified | 2431 |
| 108 | Ga0265322_10009849 | 3300028654 | Bacteria | 2772 |
| 109 | Ga0265338_10005443 | 3300028800 | Bacteria | 16622 |
| 110 | Ga0265338_10006574 | 3300028800 | Bacteria | 14751 |
| 111 | Ga0265338_10017162 | 3300028800 | Bacteria | 7820 |
| 112 | Ga0265338_10018142 | 3300028800 | Bacteria | 7549 |
| 113 | Ga0265338_10074999 | 3300028800 | Bacteria | 2873 |
| 114 | Ga0265338_10233785 | 3300028800 | Unclassified | 1365 |
| 115 | Ga0265324_10000070 | 3300029957 | Bacteria | 82995 |
| 116 | Ga0265762_1006579 | 3300030760 | Unclassified | 2077 |
| 117 | Ga0265330_10000390 | 3300031235 | Bacteria | 30198 |
| 118 | Ga0265330_10000922 | 3300031235 | Bacteria | 18112 |
| 119 | Ga0265330_10003102 | 3300031235 | Bacteria | 8793 |
| 120 | Ga0265330_10003575 | 3300031235 | Bacteria | 8098 |
| 121 | Ga0265330_10005417 | 3300031235 | Bacteria | 6364 |
| 122 | Ga0265330_10007071 | 3300031235 | Bacteria | 5503 |
| 123 | Ga0265330_10011870 | 3300031235 | Bacteria | 4076 |
| 124 | Ga0265330_10053959 | 3300031235 | Unclassified | 1758 |
| 125 | Ga0265332_10000127 | 3300031238 | Bacteria | 63659 |
| 126 | Ga0265332_10000642 | 3300031238 | Bacteria | 22738 |
| 127 | Ga0265332_10016807 | 3300031238 | Unclassified | 3228 |
| 128 | Ga0265332_10025400 | 3300031238 | Bacteria | 2602 |
| 129 | Ga0265332_10035751 | 3300031238 | Unclassified | 2157 |
| 130 | Ga0265328_10001383 | 3300031239 | Bacteria | 11204 |
| 131 | Ga0265328_10002747 | 3300031239 | Bacteria | 7872 |
| 132 | Ga0265328_10003767 | 3300031239 | Bacteria | 6669 |
| 133 | Ga0265320_10000006 | 3300031240 | Bacteria | 333442 |
| 134 | Ga0265320_10000228 | 3300031240 | Bacteria | 45923 |
| 135 | Ga0265320_10000506 | 3300031240 | Bacteria | 30374 |
| 136 | Ga0265320_10003515 | 3300031240 | Bacteria | 10496 |
| 137 | Ga0265320_10072922 | 3300031240 | Bacteria | 1614 |
| 138 | Ga0265325_10002378 | 3300031241 | Bacteria | 12713 |
| 139 | Ga0265325_10043751 | 3300031241 | Bacteria | 2335 |
| 140 | Ga0265325_10045721 | 3300031241 | Bacteria | 2274 |
| 141 | Ga0265329_10000087 | 3300031242 | Bacteria | 42511 |
| 142 | Ga0265329_10001245 | 3300031242 | Bacteria | 12457 |
| 143 | Ga0265329_10001610 | 3300031242 | Bacteria | 10831 |
| 144 | Ga0265329_10002633 | 3300031242 | Bacteria | 8074 |
| 145 | Ga0265329_10003083 | 3300031242 | Bacteria | 7380 |
| 146 | Ga0265340_10007271 | 3300031247 | Bacteria | 6021 |
| 147 | Ga0265340_10019231 | 3300031247 | Bacteria | 3517 |
| 148 | Ga0265340_10111181 | 3300031247 | Bacteria | 1267 |
| 149 | Ga0265339_10000006 | 3300031249 | Bacteria | 259593 |
| 150 | Ga0265339_10002886 | 3300031249 | Bacteria | 12165 |
| 151 | Ga0265339_10005075 | 3300031249 | Bacteria | 8844 |
| 152 | Ga0265339_10007014 | 3300031249 | Bacteria | 7322 |
| 153 | Ga0265339_10009389 | 3300031249 | Bacteria | 6152 |
| 154 | Ga0265339_10011218 | 3300031249 | Bacteria | 5529 |
| 155 | Ga0265339_10028741 | 3300031249 | Unclassified | 3159 |
| 156 | Ga0265339_10043339 | 3300031249 | Bacteria | 2489 |
| 157 | Ga0265331_10000004 | 3300031250 | Bacteria | 476985 |
| 158 | Ga0265331_10000198 | 3300031250 | Bacteria | 73807 |
| 159 | Ga0265331_10000383 | 3300031250 | Bacteria | 46054 |
| 160 | Ga0265331_10001339 | 3300031250 | Bacteria | 18214 |
| 161 | Ga0265331_10015994 | 3300031250 | Unclassified | 3947 |
| 162 | Ga0265331_10022218 | 3300031250 | Bacteria | 3239 |
| 163 | Ga0265316_10000074 | 3300031344 | Bacteria | 102906 |
| 164 | Ga0265316_10000512 | 3300031344 | Bacteria | 43789 |
| 165 | Ga0265316_10000567 | 3300031344 | Bacteria | 41269 |
| 166 | Ga0265316_10001247 | 3300031344 | Bacteria | 27368 |
| 167 | Ga0265316_10005718 | 3300031344 | Bacteria | 12008 |
| 168 | Ga0265316_10009863 | 3300031344 | Bacteria | 8760 |
| 169 | Ga0265316_10017746 | 3300031344 | Bacteria | 6138 |
| 170 | Ga0265316_10034597 | 3300031344 | Bacteria | 4102 |
| 171 | Ga0265316_10041777 | 3300031344 | Bacteria | 3667 |
| 172 | Ga0265316_10059091 | 3300031344 | Bacteria | 2983 |
| 173 | Ga0265316_10069154 | 3300031344 | Bacteria | 2725 |
| 174 | Ga0265313_10001200 | 3300031595 | Bacteria | 24794 |
| 175 | Ga0265313_10004018 | 3300031595 | Bacteria | 11508 |
| 176 | Ga0265313_10008380 | 3300031595 | Bacteria | 6877 |
| 177 | Ga0265313_10025853 | 3300031595 | Bacteria | 3103 |
| 178 | Ga0265314_10000014 | 3300031711 | Bacteria | 400363 |
| 179 | Ga0265314_10000015 | 3300031711 | Bacteria | 397180 |
| 180 | Ga0265314_10009147 | 3300031711 | Bacteria | 8407 |
| 181 | Ga0265314_10009526 | 3300031711 | Bacteria | 8185 |
| 182 | Ga0265314_10014171 | 3300031711 | Bacteria | 6395 |
| 183 | Ga0265314_10056403 | 3300031711 | Bacteria | 2704 |
| 184 | Ga0265342_10000301 | 3300031712 | Bacteria | 56116 |
| 185 | Ga0265342_10000310 | 3300031712 | Bacteria | 55305 |
| 186 | Ga0265342_10000428 | 3300031712 | Bacteria | 46046 |
| 187 | Ga0265342_10001137 | 3300031712 | Bacteria | 25415 |
| 188 | Ga0265342_10003802 | 3300031712 | Bacteria | 12156 |
| 189 | Ga0265342_10009864 | 3300031712 | Bacteria | 6680 |
| 190 | Ga0265342_10013029 | 3300031712 | Bacteria | 5602 |
| 191 | Ga0265342_10016631 | 3300031712 | Unclassified | 4801 |
| 192 | Ga0265342_10021916 | 3300031712 | Bacteria | 4071 |
| 193 | Ga0265342_10040336 | 3300031712 | Bacteria | 2832 |
| 194 | Ga0373950_0000006 | 3300034818 | Bacteria | 395608 |
| 195 | Ga0373957_0066505 | 3300035120 | Bacteria | 1404 |
| 196 | Ga0373955_0016966 | 3300035172 | Bacteria | 3592 |
| 197 | Ga0373933_0024972 | 3300035724 | Bacteria | 3424 |
| 198 | Ga0373937_0003818 | 3300036401 | Bacteria | 12731 |
| 199 | Ga0373937_0181199 | 3300036401 | Bacteria | 1978 |
| 200 | Ga0373925_0086966 | 3300037068 | Bacteria | 2385 |
| 201 | Ga0373925_0176335 | 3300037068 | Unclassified | 1690 |
| 202 | Ga0395899_0000438 | 3300037312 | Bacteria | 47644 |
| 203 | Ga0395898_0000769 | 3300037466 | Bacteria | 55582 |
| 204 | Ga0395901_0000455 | 3300038443 | Bacteria | 47638 |
| 205 | Ga0451577_0104624 | 3300042876 | Unclassified | 2529 |
| 206 | Ga0451577_0212090 | 3300042876 | Bacteria | 1749 |
| 207 | Ga0466969_0000081 | 3300044656 | Bacteria | 50629 |
| 208 | Ga0466961_0000309 | 3300044693 | Bacteria | 32383 |
| 209 | Ga0466961_0000356 | 3300044693 | Bacteria | 29831 |
| 210 | Ga0453684_0000119 | 3300044712 | Bacteria | 345920 |
| 211 | Ga0453684_0001650 | 3300044712 | Bacteria | 60542 |
| 212 | Ga0453684_0001915 | 3300044712 | Bacteria | 53960 |
| 213 | Ga0453684_0043613 | 3300044712 | Bacteria | 6025 |
| 214 | Ga0453684_0069706 | 3300044712 | Bacteria | 4457 |
| 215 | Ga0453684_0085679 | 3300044712 | Bacteria | 3913 |
| 216 | Ga0453684_0103138 | 3300044712 | Bacteria | 3486 |
| 217 | Ga0453684_0172264 | 3300044712 | Bacteria | 2549 |
| 218 | Ga0466970_0001293 | 3300044765 | Bacteria | 12111 |
| 219 | Ga0466957_0035547 | 3300044842 | Bacteria | 2989 |
| 220 | Ga0466959_0002594 | 3300045049 | Bacteria | 11606 |
| 221 | Ga0451576_0018993 | 3300045051 | Bacteria | 7509 |
| 222 | Ga0451576_0178368 | 3300045051 | Bacteria | 2218 |
| 223 | Ga0466967_0032842 | 3300045976 | Bacteria | 4387 |
| 224 | Ga0466967_0099265 | 3300045976 | Bacteria | 2659 |
| 225 | Ga0495638_0000076 | 3300046460 | Bacteria | 158799 |
| 226 | Ga0495650_0000122 | 3300046471 | Bacteria | 182888 |
| 227 | Ga0495580_0004695 | 3300046472 | Bacteria | 11460 |
| 228 | Ga0495580_0052890 | 3300046472 | Bacteria | 2867 |
| 229 | Ga0495580_0129161 | 3300046472 | Unclassified | 1753 |
| 230 | Ga0495606_0000056 | 3300046507 | Bacteria | 198575 |
| 231 | Ga0495668_0039219 | 3300046616 | Bacteria | 2645 |
| 232 | Ga0495649_0001238 | 3300046694 | Bacteria | 19655 |
| 233 | Ga0495680_0051045 | 3300047322 | Bacteria | 3232 |
| 234 | Ga0495602_0120528 | 3300048088 | Bacteria | 2111 |
| 235 | Ga0496101_0032618 | 3300048904 | Bacteria | 3668 |
| 236 | Ga0496104_0177272 | 3300048907 | Bacteria | 2042 |
| 237 | Ga0496115_0001910 | 3300048918 | Bacteria | 14874 |
| 238 | Ga0496115_0061243 | 3300048918 | Bacteria | 3034 |
| 239 | Ga0496118_0002295 | 3300048921 | Bacteria | 25990 |
| 240 | Ga0496121_0002469 | 3300048924 | Bacteria | 28211 |
| 241 | Ga0496126_0000320 | 3300048929 | Bacteria | 102586 |
| 242 | Ga0496126_0003179 | 3300048929 | Bacteria | 21133 |
| 243 | Ga0501033_0005379 | 3300049570 | Bacteria | 10148 |
| 244 | Ga0501036_0007183 | 3300049572 | Bacteria | 9075 |
| 245 | Ga0501037_0020656 | 3300049573 | Bacteria | 4862 |
| 246 | Ga0501038_0005641 | 3300049574 | Bacteria | 11612 |
| 247 | Ga0501039_0000241 | 3300049575 | Bacteria | 39819 |
| 248 | Ga0501040_0000084 | 3300049576 | Bacteria | 46187 |
| 249 | Ga0501041_0000140 | 3300049577 | Bacteria | 31667 |
| 250 | Ga0501042_0000867 | 3300049578 | Bacteria | 16901 |
| 251 | Ga0501043_0033479 | 3300049579 | Bacteria | 4043 |
| 252 | Ga0501046_0012840 | 3300049580 | Bacteria | 7123 |
| 253 | Ga0501048_0001324 | 3300049582 | Bacteria | 18763 |
| 254 | Ga0501067_0000008 | 3300049583 | Bacteria | 123725 |
| 255 | Ga0501071_0000104 | 3300049587 | Bacteria | 32570 |
| 256 | Ga0501072_0000527 | 3300049588 | Bacteria | 27459 |
| 257 | Ga0501073_0000108 | 3300049589 | Bacteria | 53298 |
| 258 | Ga0501073_0071016 | 3300049589 | Bacteria | 2426 |
| 259 | Ga0501075_0000140 | 3300049591 | Bacteria | 36122 |
| 260 | Ga0501076_0000708 | 3300049592 | Bacteria | 21496 |
| 261 | Ga0501077_0000110 | 3300049593 | Bacteria | 43064 |
| 262 | Ga0501077_0012349 | 3300049593 | Bacteria | 5350 |
| 263 | Ga0501079_0000206 | 3300049741 | Bacteria | 34428 |
| 264 | Ga0501080_0002380 | 3300049742 | Bacteria | 16403 |
| 265 | Ga0501081_0000008 | 3300049743 | Bacteria | 72293 |
| 266 | Ga0501035_0014094 | 3300049822 | Bacteria | 7375 |
| 267 | Ga0501045_0000236 | 3300049824 | Bacteria | 32116 |
| 268 | nmdc:mga05p37_50947_c1 | 3300050507 | Bacteria | 5091 |
| 269 | Ga0500643_000014 | 3300053087 | Bacteria | 318249 |
| 270 | Ga0501084_0000250 | 3300054114 | Bacteria | 40635 |
| 271 | Ga0501082_0000097 | 3300060353 | Bacteria | 67879 |
| 272 | Ga0530510_0000392 | 3300061734 | Bacteria | 28515 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031241 | Ga0265325_10043751 | Ga0265325_100437512 | 317 |
| 2 | 3300003761 | Ga0055535_1000627 | Ga0055535_100062719 | 320 |
| 3 | 3300003762 | Ga0055542_1000630 | Ga0055542_100063021 | 320 |
| 4 | 3300003763 | Ga0055529_1000594 | Ga0055529_100059419 | 320 |
| 5 | 3300025228 | Ga0209672_100382 | Ga0209672_10038217 | 320 |
| 6 | 3300025242 | Ga0209258_100334 | Ga0209258_10033431 | 320 |
| 7 | 3300025246 | Ga0209646_1002233 | Ga0209646_10022335 | 320 |
| 8 | 3300025250 | Ga0209026_1001018 | Ga0209026_10010183 | 320 |
| 9 | 3300025254 | Ga0209148_1000340 | Ga0209148_100034018 | 320 |
| 10 | 3300025256 | Ga0209759_1000451 | Ga0209759_100045120 | 320 |
| 11 | 3300025272 | Ga0209455_1000256 | Ga0209455_100025618 | 320 |
| 12 | 3300031250 | Ga0265331_10015994 | Ga0265331_100159946 | 321 |
| 13 | 3300044693 | Ga0466961_0000309 | Ga0466961_0000309_27611_28720 | 323 |
| 14 | 3300044712 | Ga0453684_0001650 | Ga0453684_0001650_5899_7011 | 330 |
| 15 | 3300037312 | Ga0395899_0000438 | Ga0395899_0000438_27267_28382 | 332 |
| 16 | 3300037466 | Ga0395898_0000769 | Ga0395898_0000769_27183_28298 | 332 |
| 17 | 3300038443 | Ga0395901_0000455 | Ga0395901_0000455_18173_19288 | 332 |
| 18 | 3300044656 | Ga0466969_0000081 | Ga0466969_0000081_32746_33861 | 332 |
| 19 | 3300044693 | Ga0466961_0000356 | Ga0466961_0000356_22031_23146 | 332 |
| 20 | 3300044765 | Ga0466970_0001293 | Ga0466970_0001293_6442_7557 | 332 |
| 21 | 3300044842 | Ga0466957_0035547 | Ga0466957_0035547_670_1785 | 332 |
| 22 | 3300045049 | Ga0466959_0002594 | Ga0466959_0002594_7883_8998 | 332 |
| 23 | 3300045051 | Ga0451576_0178368 | Ga0451576_0178368_855_1976 | 336 |
| 24 | 3300031344 | Ga0265316_10069154 | Ga0265316_100691542 | 340 |
| 25 | 3300044712 | Ga0453684_0069706 | Ga0453684_0069706_855_1982 | 340 |
| 26 | 3300048929 | Ga0496126_0003179 | Ga0496126_0003179_11142_12212 | 341 |
| 27 | 3300053087 | Ga0500643_000014 | Ga0500643_000014_39440_40570 | 341 |
| 28 | 3300009093 | Ga0105240_10000049 | Ga0105240_10000049102 | 342 |
| 29 | 3300025913 | Ga0207695_10000114 | Ga0207695_1000011453 | 342 |
| 30 | 3300048904 | Ga0496101_0032618 | Ga0496101_0032618_2329_3441 | 342 |
| 31 | 3300048918 | Ga0496115_0061243 | Ga0496115_0061243_814_1926 | 342 |
| 32 | 3300048921 | Ga0496118_0002295 | Ga0496118_0002295_10930_12042 | 342 |
| 33 | 3300048924 | Ga0496121_0002469 | Ga0496121_0002469_13955_15067 | 342 |
| 34 | 3300048929 | Ga0496126_0000320 | Ga0496126_0000320_87511_88623 | 342 |
| 35 | 3300006028 | Ga0070717_10052152 | Ga0070717_100521524 | 343 |
| 36 | 3300005615 | Ga0070702_100072444 | Ga0070702_1000724442 | 344 |
| 37 | 3300044712 | Ga0453684_0001915 | Ga0453684_0001915_37181_38296 | 344 |
| 38 | 3300013306 | Ga0163162_10054774 | Ga0163162_100547745 | 345 |
| 39 | 3300014325 | Ga0163163_10000284 | Ga0163163_1000028422 | 345 |
| 40 | 3300014968 | Ga0157379_10000024 | Ga0157379_1000002447 | 345 |
| 41 | 3300028800 | Ga0265338_10074999 | Ga0265338_100749994 | 346 |
| 42 | 3300005616 | Ga0068852_100147519 | Ga0068852_1001475192 | 347 |
| 43 | 3300044712 | Ga0453684_0085679 | Ga0453684_0085679_2534_3655 | 347 |
| 44 | 3300015261 | Ga0182006_1007701 | Ga0182006_10077014 | 348 |
| 45 | 3300015262 | Ga0182007_10000070 | Ga0182007_1000007045 | 348 |
| 46 | 3300028563 | Ga0265319_1000716 | Ga0265319_100071618 | 348 |
| 47 | 3300028577 | Ga0265318_10000195 | Ga0265318_100001959 | 348 |
| 48 | 3300028800 | Ga0265338_10005443 | Ga0265338_100054436 | 348 |
| 49 | 3300031238 | Ga0265332_10035751 | Ga0265332_100357512 | 348 |
| 50 | 3300031240 | Ga0265320_10000228 | Ga0265320_100002286 | 348 |
| 51 | 3300031241 | Ga0265325_10045721 | Ga0265325_100457213 | 348 |
| 52 | 3300031242 | Ga0265329_10001610 | Ga0265329_1000161012 | 348 |
| 53 | 3300031247 | Ga0265340_10019231 | Ga0265340_100192316 | 348 |
| 54 | 3300031249 | Ga0265339_10005075 | Ga0265339_1000507512 | 348 |
| 55 | 3300031249 | Ga0265339_10028741 | Ga0265339_100287412 | 348 |
| 56 | 3300031250 | Ga0265331_10000198 | Ga0265331_1000019842 | 348 |
| 57 | 3300031344 | Ga0265316_10059091 | Ga0265316_100590913 | 348 |
| 58 | 3300031595 | Ga0265313_10025853 | Ga0265313_100258532 | 348 |
| 59 | 3300031712 | Ga0265342_10000428 | Ga0265342_1000042842 | 348 |
| 60 | 3300009093 | Ga0105240_10056525 | Ga0105240_100565256 | 349 |
| 61 | 3300013307 | Ga0157372_10032358 | Ga0157372_100323585 | 349 |
| 62 | 3300034818 | Ga0373950_0000006 | Ga0373950_0000006_141786_142886 | 349 |
| 63 | 3300042876 | Ga0451577_0212090 | Ga0451577_0212090_245_1369 | 349 |
| 64 | 3300044712 | Ga0453684_0000119 | Ga0453684_0000119_58557_59651 | 349 |
| 65 | 3300048907 | Ga0496104_0177272 | Ga0496104_0177272_825_1994 | 349 |
| 66 | 3300031235 | Ga0265330_10000390 | Ga0265330_1000039017 | 350 |
| 67 | 3300044712 | Ga0453684_0172264 | Ga0453684_0172264_619_1758 | 350 |
| 68 | iso_pu_bacteria | 2884411467 | 2884413057 | 350 |
| 69 | 3300028654 | Ga0265322_10009849 | Ga0265322_100098494 | 351 |
| 70 | 3300028800 | Ga0265338_10017162 | Ga0265338_100171626 | 351 |
| 71 | 3300031235 | Ga0265330_10011870 | Ga0265330_100118704 | 351 |
| 72 | 3300031238 | Ga0265332_10016807 | Ga0265332_100168073 | 351 |
| 73 | 3300031242 | Ga0265329_10000087 | Ga0265329_1000008734 | 351 |
| 74 | 3300031249 | Ga0265339_10009389 | Ga0265339_100093892 | 351 |
| 75 | 3300031344 | Ga0265316_10000512 | Ga0265316_1000051231 | 351 |
| 76 | 3300031711 | Ga0265314_10056403 | Ga0265314_100564032 | 351 |
| 77 | 3300031712 | Ga0265342_10000301 | Ga0265342_1000030150 | 351 |
| 78 | 3300009093 | Ga0105240_10018290 | Ga0105240_1001829011 | 352 |
| 79 | 3300013105 | Ga0157369_10048226 | Ga0157369_100482263 | 352 |
| 80 | 3300013307 | Ga0157372_10012189 | Ga0157372_100121895 | 352 |
| 81 | 3300025242 | Ga0209258_105669 | Ga0209258_1056692 | 353 |
| 82 | 3300003760 | Ga0055527_1000086 | Ga0055527_100008625 | 354 |
| 83 | 3300003761 | Ga0055535_1000155 | Ga0055535_100015523 | 354 |
| 84 | 3300003762 | Ga0055542_1000201 | Ga0055542_100020123 | 354 |
| 85 | 3300003763 | Ga0055529_1000222 | Ga0055529_100022223 | 354 |
| 86 | 3300005340 | Ga0070689_100000986 | Ga0070689_1000009864 | 354 |
| 87 | 3300005455 | Ga0070663_100074784 | Ga0070663_1000747843 | 354 |
| 88 | 3300005539 | Ga0068853_100000624 | Ga0068853_1000006246 | 354 |
| 89 | 3300005563 | Ga0068855_100058733 | Ga0068855_1000587332 | 354 |
| 90 | 3300009551 | Ga0105238_10014275 | Ga0105238_100142756 | 354 |
| 91 | 3300014969 | Ga0157376_10010446 | Ga0157376_100104466 | 354 |
| 92 | 3300025228 | Ga0209672_100009 | Ga0209672_100009195 | 354 |
| 93 | 3300025242 | Ga0209258_100011 | Ga0209258_100011448 | 354 |
| 94 | 3300025254 | Ga0209148_1000013 | Ga0209148_1000013448 | 354 |
| 95 | 3300025272 | Ga0209455_1000012 | Ga0209455_1000012448 | 354 |
| 96 | 3300025924 | Ga0207694_10013083 | Ga0207694_100130836 | 354 |
| 97 | 3300025924 | Ga0207694_10015772 | Ga0207694_100157722 | 354 |
| 98 | 3300025936 | Ga0207670_10000391 | Ga0207670_1000039117 | 354 |
| 99 | 3300026041 | Ga0207639_10005899 | Ga0207639_100058998 | 354 |
| 100 | 3300046460 | Ga0495638_0000076 | Ga0495638_0000076_118907_120022 | 354 |
| 101 | 3300046471 | Ga0495650_0000122 | Ga0495650_0000122_9511_10623 | 354 |
| 102 | 3300046507 | Ga0495606_0000056 | Ga0495606_0000056_124877_125989 | 354 |
| 103 | 3300046694 | Ga0495649_0001238 | Ga0495649_0001238_6176_7288 | 354 |
| 104 | 3300048918 | Ga0496115_0001910 | Ga0496115_0001910_111_1223 | 354 |
| 105 | 3300005365 | Ga0070688_100030196 | Ga0070688_1000301965 | 355 |
| 106 | 3300042876 | Ga0451577_0104624 | Ga0451577_0104624_179_1255 | 355 |
| 107 | iso_pu_bacteria | 2941485952 | 2941486429 | 356 |
| 108 | 3300028653 | Ga0265323_10002764 | Ga0265323_100027646 | 358 |
| 109 | 3300044712 | Ga0453684_0043613 | Ga0453684_0043613_658_1761 | 358 |
| 110 | 3300045051 | Ga0451576_0018993 | Ga0451576_0018993_2559_3659 | 358 |
| 111 | 3300005340 | Ga0070689_100000001 | Ga0070689_100000001254 | 359 |
| 112 | 3300025936 | Ga0207670_10000002 | Ga0207670_10000002154 | 359 |
| 113 | 3300046472 | Ga0495580_0052890 | Ga0495580_0052890_1600_2730 | 359 |
| 114 | 3300005518 | Ga0070699_100195941 | Ga0070699_1001959413 | 360 |
| 115 | 3300024227 | Ga0228598_1007165 | Ga0228598_10071652 | 360 |
| 116 | 3300031249 | Ga0265339_10043339 | Ga0265339_100433392 | 360 |
| 117 | 3300005614 | Ga0068856_100083409 | Ga0068856_1000834093 | 361 |
| 118 | 3300006028 | Ga0070717_10094852 | Ga0070717_100948523 | 361 |
| 119 | 3300009093 | Ga0105240_10000766 | Ga0105240_1000076643 | 361 |
| 120 | 3300009174 | Ga0105241_10040373 | Ga0105241_100403736 | 361 |
| 121 | 3300013100 | Ga0157373_10099583 | Ga0157373_100995833 | 361 |
| 122 | 3300025913 | Ga0207695_10002323 | Ga0207695_1000232324 | 361 |
| 123 | 3300025913 | Ga0207695_10010241 | Ga0207695_100102419 | 361 |
| 124 | 3300025913 | Ga0207695_10072075 | Ga0207695_100720754 | 361 |
| 125 | 3300037068 | Ga0373925_0086966 | Ga0373925_0086966_362_1471 | 361 |
| 126 | 3300045976 | Ga0466967_0032842 | Ga0466967_0032842_922_2040 | 361 |
| 127 | 3300045976 | Ga0466967_0099265 | Ga0466967_0099265_1152_2258 | 361 |
| 128 | 3300046472 | Ga0495580_0004695 | Ga0495580_0004695_969_2075 | 361 |
| 129 | 3300046472 | Ga0495580_0129161 | Ga0495580_0129161_149_1258 | 361 |
| 130 | 3300048088 | Ga0495602_0120528 | Ga0495602_0120528_932_2035 | 361 |
| 131 | 3300049583 | Ga0501067_0000008 | Ga0501067_0000008_66813_67913 | 361 |
| 132 | 3300049589 | Ga0501073_0000108 | Ga0501073_0000108_35321_36421 | 361 |
| 133 | 3300005329 | Ga0070683_100271032 | Ga0070683_1002710321 | 362 |
| 134 | 3300005458 | Ga0070681_10110338 | Ga0070681_101103382 | 362 |
| 135 | 3300005518 | Ga0070699_100111549 | Ga0070699_1001115492 | 362 |
| 136 | 3300005535 | Ga0070684_100010098 | Ga0070684_1000100989 | 362 |
| 137 | 3300005536 | Ga0070697_100102643 | Ga0070697_1001026433 | 362 |
| 138 | 3300005548 | Ga0070665_100007157 | Ga0070665_10000715710 | 362 |
| 139 | 3300025912 | Ga0207707_10104382 | Ga0207707_101043822 | 362 |
| 140 | 3300025915 | Ga0207693_10201496 | Ga0207693_102014962 | 362 |
| 141 | 3300028379 | Ga0268266_10148498 | Ga0268266_101484982 | 362 |
| 142 | 3300028556 | Ga0265337_1003805 | Ga0265337_10038057 | 362 |
| 143 | 3300028563 | Ga0265319_1034963 | Ga0265319_10349632 | 362 |
| 144 | 3300028573 | Ga0265334_10020457 | Ga0265334_100204573 | 362 |
| 145 | 3300028577 | Ga0265318_10000223 | Ga0265318_1000022327 | 362 |
| 146 | 3300028653 | Ga0265323_10001911 | Ga0265323_100019117 | 362 |
| 147 | 3300028653 | Ga0265323_10004726 | Ga0265323_100047263 | 362 |
| 148 | 3300028653 | Ga0265323_10006308 | Ga0265323_100063086 | 362 |
| 149 | 3300028653 | Ga0265323_10022121 | Ga0265323_100221212 | 362 |
| 150 | 3300028800 | Ga0265338_10006574 | Ga0265338_100065748 | 362 |
| 151 | 3300028800 | Ga0265338_10018142 | Ga0265338_100181427 | 362 |
| 152 | 3300028800 | Ga0265338_10233785 | Ga0265338_102337852 | 362 |
| 153 | 3300029957 | Ga0265324_10000070 | Ga0265324_1000007058 | 362 |
| 154 | 3300031235 | Ga0265330_10003102 | Ga0265330_100031022 | 362 |
| 155 | 3300031235 | Ga0265330_10003575 | Ga0265330_1000357510 | 362 |
| 156 | 3300031235 | Ga0265330_10005417 | Ga0265330_100054176 | 362 |
| 157 | 3300031235 | Ga0265330_10007071 | Ga0265330_100070711 | 362 |
| 158 | 3300031235 | Ga0265330_10053959 | Ga0265330_100539592 | 362 |
| 159 | 3300031238 | Ga0265332_10000642 | Ga0265332_1000064215 | 362 |
| 160 | 3300031238 | Ga0265332_10025400 | Ga0265332_100254002 | 362 |
| 161 | 3300031239 | Ga0265328_10001383 | Ga0265328_1000138310 | 362 |
| 162 | 3300031239 | Ga0265328_10003767 | Ga0265328_100037676 | 362 |
| 163 | 3300031240 | Ga0265320_10000506 | Ga0265320_1000050613 | 362 |
| 164 | 3300031240 | Ga0265320_10003515 | Ga0265320_1000351510 | 362 |
| 165 | 3300031240 | Ga0265320_10072922 | Ga0265320_100729221 | 362 |
| 166 | 3300031241 | Ga0265325_10002378 | Ga0265325_1000237813 | 362 |
| 167 | 3300031242 | Ga0265329_10001245 | Ga0265329_100012452 | 362 |
| 168 | 3300031242 | Ga0265329_10002633 | Ga0265329_1000263310 | 362 |
| 169 | 3300031247 | Ga0265340_10007271 | Ga0265340_100072715 | 362 |
| 170 | 3300031247 | Ga0265340_10111181 | Ga0265340_101111811 | 362 |
| 171 | 3300031249 | Ga0265339_10000006 | Ga0265339_10000006182 | 362 |
| 172 | 3300031249 | Ga0265339_10002886 | Ga0265339_100028867 | 362 |
| 173 | 3300031249 | Ga0265339_10007014 | Ga0265339_100070142 | 362 |
| 174 | 3300031250 | Ga0265331_10000383 | Ga0265331_1000038321 | 362 |
| 175 | 3300031250 | Ga0265331_10001339 | Ga0265331_1000133910 | 362 |
| 176 | 3300031344 | Ga0265316_10000074 | Ga0265316_1000007464 | 362 |
| 177 | 3300031344 | Ga0265316_10000567 | Ga0265316_100005679 | 362 |
| 178 | 3300031344 | Ga0265316_10001247 | Ga0265316_100012475 | 362 |
| 179 | 3300031344 | Ga0265316_10005718 | Ga0265316_1000571810 | 362 |
| 180 | 3300031344 | Ga0265316_10009863 | Ga0265316_100098635 | 362 |
| 181 | 3300031344 | Ga0265316_10041777 | Ga0265316_100417775 | 362 |
| 182 | 3300031595 | Ga0265313_10004018 | Ga0265313_1000401810 | 362 |
| 183 | 3300031595 | Ga0265313_10008380 | Ga0265313_100083802 | 362 |
| 184 | 3300031711 | Ga0265314_10000015 | Ga0265314_10000015153 | 362 |
| 185 | 3300031711 | Ga0265314_10009526 | Ga0265314_100095262 | 362 |
| 186 | 3300031712 | Ga0265342_10000310 | Ga0265342_1000031032 | 362 |
| 187 | 3300031712 | Ga0265342_10001137 | Ga0265342_100011376 | 362 |
| 188 | 3300031712 | Ga0265342_10003802 | Ga0265342_100038028 | 362 |
| 189 | 3300031712 | Ga0265342_10009864 | Ga0265342_100098644 | 362 |
| 190 | 3300031712 | Ga0265342_10013029 | Ga0265342_100130294 | 362 |
| 191 | 3300031712 | Ga0265342_10016631 | Ga0265342_100166316 | 362 |
| 192 | 3300031712 | Ga0265342_10021916 | Ga0265342_100219162 | 362 |
| 193 | 3300035120 | Ga0373957_0066505 | Ga0373957_0066505_40_1146 | 362 |
| 194 | 3300035172 | Ga0373955_0016966 | Ga0373955_0016966_1189_2298 | 362 |
| 195 | 3300035724 | Ga0373933_0024972 | Ga0373933_0024972_2158_3267 | 362 |
| 196 | 3300036401 | Ga0373937_0003818 | Ga0373937_0003818_3945_5054 | 362 |
| 197 | 3300036401 | Ga0373937_0181199 | Ga0373937_0181199_70_1170 | 362 |
| 198 | 3300037068 | Ga0373925_0176335 | Ga0373925_0176335_255_1364 | 362 |
| 199 | 3300044712 | Ga0453684_0103138 | Ga0453684_0103138_1580_2677 | 362 |
| 200 | 3300047322 | Ga0495680_0051045 | Ga0495680_0051045_759_1868 | 362 |
| 201 | 3300031250 | Ga0265331_10022218 | Ga0265331_100222183 | 363 |
| 202 | 3300031344 | Ga0265316_10034597 | Ga0265316_100345973 | 363 |
| 203 | 3300031711 | Ga0265314_10014171 | Ga0265314_100141713 | 363 |
| 204 | 3300005530 | Ga0070679_100008208 | Ga0070679_1000082089 | 364 |
| 205 | 3300005577 | Ga0068857_100018073 | Ga0068857_1000180736 | 364 |
| 206 | 3300009545 | Ga0105237_10000155 | Ga0105237_1000015529 | 364 |
| 207 | 3300009551 | Ga0105238_10009442 | Ga0105238_100094429 | 364 |
| 208 | 3300010375 | Ga0105239_10094977 | Ga0105239_100949772 | 364 |
| 209 | 3300025914 | Ga0207671_10002734 | Ga0207671_1000273417 | 364 |
| 210 | 3300025921 | Ga0207652_10000559 | Ga0207652_1000055922 | 364 |
| 211 | 3300025924 | Ga0207694_10055248 | Ga0207694_100552482 | 364 |
| 212 | 3300026116 | Ga0207674_10030558 | Ga0207674_100305586 | 364 |
| 213 | 3300031249 | Ga0265339_10011218 | Ga0265339_100112182 | 364 |
| 214 | 3300031711 | Ga0265314_10009147 | Ga0265314_100091475 | 364 |
| 215 | 3300005468 | Ga0070707_100086151 | Ga0070707_1000861512 | 365 |
| 216 | 3300005518 | Ga0070699_100067235 | Ga0070699_1000672352 | 365 |
| 217 | 3300028563 | Ga0265319_1045154 | Ga0265319_10451541 | 365 |
| 218 | 3300028577 | Ga0265318_10000050 | Ga0265318_1000005055 | 365 |
| 219 | 3300031235 | Ga0265330_10000922 | Ga0265330_100009222 | 365 |
| 220 | 3300031238 | Ga0265332_10000127 | Ga0265332_1000012734 | 365 |
| 221 | 3300031239 | Ga0265328_10002747 | Ga0265328_100027479 | 365 |
| 222 | 3300031240 | Ga0265320_10000006 | Ga0265320_10000006163 | 365 |
| 223 | 3300031242 | Ga0265329_10003083 | Ga0265329_100030834 | 365 |
| 224 | 3300031250 | Ga0265331_10000004 | Ga0265331_10000004298 | 365 |
| 225 | 3300031344 | Ga0265316_10017746 | Ga0265316_100177468 | 365 |
| 226 | 3300031595 | Ga0265313_10001200 | Ga0265313_1000120020 | 365 |
| 227 | 3300031711 | Ga0265314_10000014 | Ga0265314_10000014129 | 365 |
| 228 | 3300031712 | Ga0265342_10040336 | Ga0265342_100403363 | 365 |
| 229 | 3300005366 | Ga0070659_100038674 | Ga0070659_1000386742 | 367 |
| 230 | 3300005530 | Ga0070679_100266618 | Ga0070679_1002666182 | 367 |
| 231 | 3300005563 | Ga0068855_100063325 | Ga0068855_1000633255 | 367 |
| 232 | 3300025909 | Ga0207705_10001824 | Ga0207705_100018242 | 367 |
| 233 | 3300025921 | Ga0207652_10066758 | Ga0207652_100667582 | 367 |
| 234 | 3300025932 | Ga0207690_10024679 | Ga0207690_100246794 | 367 |
| 235 | 3300025949 | Ga0207667_10115597 | Ga0207667_101155972 | 367 |
| 236 | 3300046616 | Ga0495668_0039219 | Ga0495668_0039219_561_1706 | 367 |
| 237 | 3300030760 | Ga0265762_1006579 | Ga0265762_10065792 | 368 |
| 238 | 3300003323 | rootH1_10005544 | rootH1_1000554410 | 370 |
| 239 | 3300049570 | Ga0501033_0005379 | Ga0501033_0005379_3078_4196 | 370 |
| 240 | 3300049572 | Ga0501036_0007183 | Ga0501036_0007183_4687_5805 | 370 |
| 241 | 3300049573 | Ga0501037_0020656 | Ga0501037_0020656_835_1953 | 370 |
| 242 | 3300049574 | Ga0501038_0005641 | Ga0501038_0005641_8123_9241 | 370 |
| 243 | 3300049575 | Ga0501039_0000241 | Ga0501039_0000241_14015_15133 | 370 |
| 244 | 3300049576 | Ga0501040_0000084 | Ga0501040_0000084_10633_11751 | 370 |
| 245 | 3300049577 | Ga0501041_0000140 | Ga0501041_0000140_22237_23355 | 370 |
| 246 | 3300049578 | Ga0501042_0000867 | Ga0501042_0000867_3553_4671 | 370 |
| 247 | 3300049579 | Ga0501043_0033479 | Ga0501043_0033479_2164_3282 | 370 |
| 248 | 3300049580 | Ga0501046_0012840 | Ga0501046_0012840_1944_3062 | 370 |
| 249 | 3300049582 | Ga0501048_0001324 | Ga0501048_0001324_12076_13194 | 370 |
| 250 | 3300049587 | Ga0501071_0000104 | Ga0501071_0000104_11264_12382 | 370 |
| 251 | 3300049588 | Ga0501072_0000527 | Ga0501072_0000527_22310_23428 | 370 |
| 252 | 3300049589 | Ga0501073_0071016 | Ga0501073_0071016_148_1266 | 370 |
| 253 | 3300049591 | Ga0501075_0000140 | Ga0501075_0000140_7377_8495 | 370 |
| 254 | 3300049592 | Ga0501076_0000708 | Ga0501076_0000708_5673_6791 | 370 |
| 255 | 3300049593 | Ga0501077_0000110 | Ga0501077_0000110_24688_25806 | 370 |
| 256 | 3300049741 | Ga0501079_0000206 | Ga0501079_0000206_14697_15815 | 370 |
| 257 | 3300049742 | Ga0501080_0002380 | Ga0501080_0002380_15222_16340 | 370 |
| 258 | 3300049743 | Ga0501081_0000008 | Ga0501081_0000008_22232_23350 | 370 |
| 259 | 3300049822 | Ga0501035_0014094 | Ga0501035_0014094_4717_5835 | 370 |
| 260 | 3300049824 | Ga0501045_0000236 | Ga0501045_0000236_14912_16030 | 370 |
| 261 | 3300054114 | Ga0501084_0000250 | Ga0501084_0000250_31265_32383 | 370 |
| 262 | 3300060353 | Ga0501082_0000097 | Ga0501082_0000097_6835_7953 | 370 |
| 263 | 3300061734 | Ga0530510_0000392 | Ga0530510_0000392_19098_20216 | 370 |
| 264 | 3300005355 | Ga0070671_100283135 | Ga0070671_1002831352 | 373 |
| 265 | 3300006237 | Ga0097621_100178432 | Ga0097621_1001784322 | 373 |
| 266 | 3300013297 | Ga0157378_10019335 | Ga0157378_100193354 | 373 |
| 267 | 3300014326 | Ga0157380_10264507 | Ga0157380_102645072 | 373 |
| 268 | 3300049593 | Ga0501077_0012349 | Ga0501077_0012349_821_1966 | 375 |
| 269 | 2162886012 | MBSR1b_contig_4592414 | MBSR1b_0796.00006580 | 381 |
| 270 | 3300005293 | Ga0065715_10139848 | Ga0065715_101398482 | 381 |
| 271 | 3300005536 | Ga0070697_100067823 | Ga0070697_1000678232 | 381 |
| 272 | 3300007076 | Ga0075435_100052068 | Ga0075435_1000520685 | 381 |
| 273 | 3300009147 | Ga0114129_10117442 | Ga0114129_101174425 | 381 |
| 274 | 3300050507 | nmdc:mga05p37_50947_c1 | nmdc:mga05p37_50947_c1_31_1179 | 381 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar