F379441

General Info

Members Datasets Scaffolds Average Seq Length
274 151 272 367

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10005544|rootH1_1000554410
Length 406
Sequence MKGNGDIMISSATGRDAPSSKPGPKERAPSRWARAWQRRGGALATLAAFTLLTAWPGAYAQAGTVRMKELVDVQGFRENFLYGYGLVVGLPGTGDTETVFFTSQSISGMLGRLGIRIDPNQVRTRNVAAVMVTARLPTFERTGNKLDIAVASMGNARSLAGGVLLLTPLTGPDGQVYAIAQGPVQAGGFDVAAFGSRMAKNQPTSGSVPAGATVERAVTPNLDKPQLTLGLRRPDFTTAARIADAVNQALGNDAAKALDAAAVEVKVPEEFKGKTVGLMAKLEALEVDADQRAKVVVSERTGTVVAGEKVKIRPVAVAHGSLSVSVAAAPVISQPNAFGRGQTVNRTQAAVNATEKEKPVTALPATATVEDLAKALNTLGVGARDLVSILQAMKAAGALDADLEVL

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2884411467 Dyella sp. AD56 Isolate Rhizosphere
3 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
6 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
48 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
49 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
50 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
53 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
54 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
56 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
71 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
72 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
73 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
74 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
75 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
78 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
80 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
81 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
82 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
92 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
93 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
94 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
95 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
122 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
123 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
124 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
151 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 0.36
Isolates 0.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.2
Nodule 0
Rhizoplane 1.46
Rhizosphere 89.42
Stem 0
Stem Tuber 0
Unclassified 2.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_4592414 2162886012 Bacteria 1803
2 rootH1_10005544 3300003323 Bacteria 13059
3 Ga0055527_1000086 3300003760 Bacteria 73266
4 Ga0055535_1000155 3300003761 Bacteria 73262
5 Ga0055535_1000627 3300003761 Bacteria 28395
6 Ga0055542_1000201 3300003762 Bacteria 73262
7 Ga0055542_1000630 3300003762 Bacteria 29611
8 Ga0055529_1000222 3300003763 Bacteria 73266
9 Ga0055529_1000594 3300003763 Bacteria 28386
10 Ga0065715_10139848 3300005293 Bacteria 1870
11 Ga0070683_100271032 3300005329 Bacteria 1615
12 Ga0070689_100000001 3300005340 Bacteria 1334580
13 Ga0070689_100000986 3300005340 Bacteria 17822
14 Ga0070671_100283135 3300005355 Unclassified 1410
15 Ga0070688_100030196 3300005365 Bacteria 3251
16 Ga0070659_100038674 3300005366 Bacteria 3722
17 Ga0070663_100074784 3300005455 Bacteria 2474
18 Ga0070681_10110338 3300005458 Bacteria 2691
19 Ga0070707_100086151 3300005468 Bacteria 3037
20 Ga0070699_100067235 3300005518 Unclassified 3112
21 Ga0070699_100111549 3300005518 Bacteria 2402
22 Ga0070699_100195941 3300005518 Bacteria 1796
23 Ga0070679_100008208 3300005530 Bacteria 9816
24 Ga0070679_100266618 3300005530 Bacteria 1667
25 Ga0070684_100010098 3300005535 Bacteria 7466
26 Ga0070697_100067823 3300005536 Bacteria 2919
27 Ga0070697_100102643 3300005536 Bacteria 2376
28 Ga0068853_100000624 3300005539 Bacteria 24300
29 Ga0070665_100007157 3300005548 Bacteria 11345
30 Ga0068855_100058733 3300005563 Bacteria 4503
31 Ga0068855_100063325 3300005563 Bacteria 4315
32 Ga0068857_100018073 3300005577 Bacteria 6186
33 Ga0068856_100083409 3300005614 Unclassified 3174
34 Ga0070702_100072444 3300005615 Bacteria 2039
35 Ga0068852_100147519 3300005616 Bacteria 2184
36 Ga0070717_10052152 3300006028 Unclassified 3369
37 Ga0070717_10094852 3300006028 Bacteria 2525
38 Ga0097621_100178432 3300006237 Unclassified 1834
39 Ga0075435_100052068 3300007076 Bacteria 3299
40 Ga0105240_10000049 3300009093 Bacteria 236718
41 Ga0105240_10000766 3300009093 Bacteria 58387
42 Ga0105240_10018290 3300009093 Bacteria 9419
43 Ga0105240_10056525 3300009093 Bacteria 4910
44 Ga0114129_10117442 3300009147 Bacteria 3666
45 Ga0105241_10040373 3300009174 Unclassified 3523
46 Ga0105237_10000155 3300009545 Bacteria 96466
47 Ga0105238_10009442 3300009551 Bacteria 9765
48 Ga0105238_10014275 3300009551 Bacteria 8028
49 Ga0105239_10094977 3300010375 Bacteria 3294
50 Ga0157373_10099583 3300013100 Bacteria 2045
51 Ga0157369_10048226 3300013105 Unclassified 4622
52 Ga0157378_10019335 3300013297 Bacteria 5989
53 Ga0163162_10054774 3300013306 Bacteria 4013
54 Ga0157372_10012189 3300013307 Bacteria 9157
55 Ga0157372_10032358 3300013307 Bacteria 5734
56 Ga0163163_10000284 3300014325 Bacteria 50589
57 Ga0157380_10264507 3300014326 Unclassified 1564
58 Ga0157379_10000024 3300014968 Bacteria 90098
59 Ga0157376_10010446 3300014969 Bacteria 6791
60 Ga0182006_1007701 3300015261 Bacteria 4918
61 Ga0182007_10000070 3300015262 Bacteria 82063
62 Ga0228598_1007165 3300024227 Unclassified 2281
63 Ga0209672_100009 3300025228 Bacteria 883623
64 Ga0209672_100382 3300025228 Bacteria 26978
65 Ga0209258_100011 3300025242 Bacteria 867542
66 Ga0209258_100334 3300025242 Bacteria 70788
67 Ga0209258_105669 3300025242 Bacteria 2074
68 Ga0209646_1002233 3300025246 Bacteria 4452
69 Ga0209026_1001018 3300025250 Bacteria 13840
70 Ga0209148_1000013 3300025254 Bacteria 956684
71 Ga0209148_1000340 3300025254 Bacteria 62403
72 Ga0209759_1000451 3300025256 Bacteria 47569
73 Ga0209455_1000012 3300025272 Bacteria 867234
74 Ga0209455_1000256 3300025272 Bacteria 62403
75 Ga0207705_10001824 3300025909 Bacteria 16770
76 Ga0207707_10104382 3300025912 Bacteria 2477
77 Ga0207695_10000114 3300025913 Bacteria 242465
78 Ga0207695_10002323 3300025913 Bacteria 28360
79 Ga0207695_10010241 3300025913 Bacteria 11493
80 Ga0207695_10072075 3300025913 Unclassified 3526
81 Ga0207671_10002734 3300025914 Bacteria 18441
82 Ga0207693_10201496 3300025915 Bacteria 1565
83 Ga0207652_10000559 3300025921 Bacteria 37575
84 Ga0207652_10066758 3300025921 Bacteria 3118
85 Ga0207694_10013083 3300025924 Bacteria 6249
86 Ga0207694_10015772 3300025924 Bacteria 5701
87 Ga0207694_10055248 3300025924 Bacteria 3083
88 Ga0207690_10024679 3300025932 Bacteria 3767
89 Ga0207670_10000002 3300025936 Bacteria 783058
90 Ga0207670_10000391 3300025936 Bacteria 25175
91 Ga0207667_10115597 3300025949 Bacteria 2765
92 Ga0207639_10005899 3300026041 Bacteria 8301
93 Ga0207674_10030558 3300026116 Bacteria 5662
94 Ga0268266_10148498 3300028379 Bacteria 2110
95 Ga0265337_1003805 3300028556 Bacteria 6422
96 Ga0265319_1000716 3300028563 Bacteria 21717
97 Ga0265319_1034963 3300028563 Bacteria 1726
98 Ga0265319_1045154 3300028563 Bacteria 1474
99 Ga0265334_10020457 3300028573 Unclassified 2709
100 Ga0265318_10000050 3300028577 Bacteria 118340
101 Ga0265318_10000195 3300028577 Bacteria 53122
102 Ga0265318_10000223 3300028577 Bacteria 48902
103 Ga0265323_10001911 3300028653 Bacteria 9818
104 Ga0265323_10002764 3300028653 Bacteria 7908
105 Ga0265323_10004726 3300028653 Bacteria 5840
106 Ga0265323_10006308 3300028653 Bacteria 4985
107 Ga0265323_10022121 3300028653 Unclassified 2431
108 Ga0265322_10009849 3300028654 Bacteria 2772
109 Ga0265338_10005443 3300028800 Bacteria 16622
110 Ga0265338_10006574 3300028800 Bacteria 14751
111 Ga0265338_10017162 3300028800 Bacteria 7820
112 Ga0265338_10018142 3300028800 Bacteria 7549
113 Ga0265338_10074999 3300028800 Bacteria 2873
114 Ga0265338_10233785 3300028800 Unclassified 1365
115 Ga0265324_10000070 3300029957 Bacteria 82995
116 Ga0265762_1006579 3300030760 Unclassified 2077
117 Ga0265330_10000390 3300031235 Bacteria 30198
118 Ga0265330_10000922 3300031235 Bacteria 18112
119 Ga0265330_10003102 3300031235 Bacteria 8793
120 Ga0265330_10003575 3300031235 Bacteria 8098
121 Ga0265330_10005417 3300031235 Bacteria 6364
122 Ga0265330_10007071 3300031235 Bacteria 5503
123 Ga0265330_10011870 3300031235 Bacteria 4076
124 Ga0265330_10053959 3300031235 Unclassified 1758
125 Ga0265332_10000127 3300031238 Bacteria 63659
126 Ga0265332_10000642 3300031238 Bacteria 22738
127 Ga0265332_10016807 3300031238 Unclassified 3228
128 Ga0265332_10025400 3300031238 Bacteria 2602
129 Ga0265332_10035751 3300031238 Unclassified 2157
130 Ga0265328_10001383 3300031239 Bacteria 11204
131 Ga0265328_10002747 3300031239 Bacteria 7872
132 Ga0265328_10003767 3300031239 Bacteria 6669
133 Ga0265320_10000006 3300031240 Bacteria 333442
134 Ga0265320_10000228 3300031240 Bacteria 45923
135 Ga0265320_10000506 3300031240 Bacteria 30374
136 Ga0265320_10003515 3300031240 Bacteria 10496
137 Ga0265320_10072922 3300031240 Bacteria 1614
138 Ga0265325_10002378 3300031241 Bacteria 12713
139 Ga0265325_10043751 3300031241 Bacteria 2335
140 Ga0265325_10045721 3300031241 Bacteria 2274
141 Ga0265329_10000087 3300031242 Bacteria 42511
142 Ga0265329_10001245 3300031242 Bacteria 12457
143 Ga0265329_10001610 3300031242 Bacteria 10831
144 Ga0265329_10002633 3300031242 Bacteria 8074
145 Ga0265329_10003083 3300031242 Bacteria 7380
146 Ga0265340_10007271 3300031247 Bacteria 6021
147 Ga0265340_10019231 3300031247 Bacteria 3517
148 Ga0265340_10111181 3300031247 Bacteria 1267
149 Ga0265339_10000006 3300031249 Bacteria 259593
150 Ga0265339_10002886 3300031249 Bacteria 12165
151 Ga0265339_10005075 3300031249 Bacteria 8844
152 Ga0265339_10007014 3300031249 Bacteria 7322
153 Ga0265339_10009389 3300031249 Bacteria 6152
154 Ga0265339_10011218 3300031249 Bacteria 5529
155 Ga0265339_10028741 3300031249 Unclassified 3159
156 Ga0265339_10043339 3300031249 Bacteria 2489
157 Ga0265331_10000004 3300031250 Bacteria 476985
158 Ga0265331_10000198 3300031250 Bacteria 73807
159 Ga0265331_10000383 3300031250 Bacteria 46054
160 Ga0265331_10001339 3300031250 Bacteria 18214
161 Ga0265331_10015994 3300031250 Unclassified 3947
162 Ga0265331_10022218 3300031250 Bacteria 3239
163 Ga0265316_10000074 3300031344 Bacteria 102906
164 Ga0265316_10000512 3300031344 Bacteria 43789
165 Ga0265316_10000567 3300031344 Bacteria 41269
166 Ga0265316_10001247 3300031344 Bacteria 27368
167 Ga0265316_10005718 3300031344 Bacteria 12008
168 Ga0265316_10009863 3300031344 Bacteria 8760
169 Ga0265316_10017746 3300031344 Bacteria 6138
170 Ga0265316_10034597 3300031344 Bacteria 4102
171 Ga0265316_10041777 3300031344 Bacteria 3667
172 Ga0265316_10059091 3300031344 Bacteria 2983
173 Ga0265316_10069154 3300031344 Bacteria 2725
174 Ga0265313_10001200 3300031595 Bacteria 24794
175 Ga0265313_10004018 3300031595 Bacteria 11508
176 Ga0265313_10008380 3300031595 Bacteria 6877
177 Ga0265313_10025853 3300031595 Bacteria 3103
178 Ga0265314_10000014 3300031711 Bacteria 400363
179 Ga0265314_10000015 3300031711 Bacteria 397180
180 Ga0265314_10009147 3300031711 Bacteria 8407
181 Ga0265314_10009526 3300031711 Bacteria 8185
182 Ga0265314_10014171 3300031711 Bacteria 6395
183 Ga0265314_10056403 3300031711 Bacteria 2704
184 Ga0265342_10000301 3300031712 Bacteria 56116
185 Ga0265342_10000310 3300031712 Bacteria 55305
186 Ga0265342_10000428 3300031712 Bacteria 46046
187 Ga0265342_10001137 3300031712 Bacteria 25415
188 Ga0265342_10003802 3300031712 Bacteria 12156
189 Ga0265342_10009864 3300031712 Bacteria 6680
190 Ga0265342_10013029 3300031712 Bacteria 5602
191 Ga0265342_10016631 3300031712 Unclassified 4801
192 Ga0265342_10021916 3300031712 Bacteria 4071
193 Ga0265342_10040336 3300031712 Bacteria 2832
194 Ga0373950_0000006 3300034818 Bacteria 395608
195 Ga0373957_0066505 3300035120 Bacteria 1404
196 Ga0373955_0016966 3300035172 Bacteria 3592
197 Ga0373933_0024972 3300035724 Bacteria 3424
198 Ga0373937_0003818 3300036401 Bacteria 12731
199 Ga0373937_0181199 3300036401 Bacteria 1978
200 Ga0373925_0086966 3300037068 Bacteria 2385
201 Ga0373925_0176335 3300037068 Unclassified 1690
202 Ga0395899_0000438 3300037312 Bacteria 47644
203 Ga0395898_0000769 3300037466 Bacteria 55582
204 Ga0395901_0000455 3300038443 Bacteria 47638
205 Ga0451577_0104624 3300042876 Unclassified 2529
206 Ga0451577_0212090 3300042876 Bacteria 1749
207 Ga0466969_0000081 3300044656 Bacteria 50629
208 Ga0466961_0000309 3300044693 Bacteria 32383
209 Ga0466961_0000356 3300044693 Bacteria 29831
210 Ga0453684_0000119 3300044712 Bacteria 345920
211 Ga0453684_0001650 3300044712 Bacteria 60542
212 Ga0453684_0001915 3300044712 Bacteria 53960
213 Ga0453684_0043613 3300044712 Bacteria 6025
214 Ga0453684_0069706 3300044712 Bacteria 4457
215 Ga0453684_0085679 3300044712 Bacteria 3913
216 Ga0453684_0103138 3300044712 Bacteria 3486
217 Ga0453684_0172264 3300044712 Bacteria 2549
218 Ga0466970_0001293 3300044765 Bacteria 12111
219 Ga0466957_0035547 3300044842 Bacteria 2989
220 Ga0466959_0002594 3300045049 Bacteria 11606
221 Ga0451576_0018993 3300045051 Bacteria 7509
222 Ga0451576_0178368 3300045051 Bacteria 2218
223 Ga0466967_0032842 3300045976 Bacteria 4387
224 Ga0466967_0099265 3300045976 Bacteria 2659
225 Ga0495638_0000076 3300046460 Bacteria 158799
226 Ga0495650_0000122 3300046471 Bacteria 182888
227 Ga0495580_0004695 3300046472 Bacteria 11460
228 Ga0495580_0052890 3300046472 Bacteria 2867
229 Ga0495580_0129161 3300046472 Unclassified 1753
230 Ga0495606_0000056 3300046507 Bacteria 198575
231 Ga0495668_0039219 3300046616 Bacteria 2645
232 Ga0495649_0001238 3300046694 Bacteria 19655
233 Ga0495680_0051045 3300047322 Bacteria 3232
234 Ga0495602_0120528 3300048088 Bacteria 2111
235 Ga0496101_0032618 3300048904 Bacteria 3668
236 Ga0496104_0177272 3300048907 Bacteria 2042
237 Ga0496115_0001910 3300048918 Bacteria 14874
238 Ga0496115_0061243 3300048918 Bacteria 3034
239 Ga0496118_0002295 3300048921 Bacteria 25990
240 Ga0496121_0002469 3300048924 Bacteria 28211
241 Ga0496126_0000320 3300048929 Bacteria 102586
242 Ga0496126_0003179 3300048929 Bacteria 21133
243 Ga0501033_0005379 3300049570 Bacteria 10148
244 Ga0501036_0007183 3300049572 Bacteria 9075
245 Ga0501037_0020656 3300049573 Bacteria 4862
246 Ga0501038_0005641 3300049574 Bacteria 11612
247 Ga0501039_0000241 3300049575 Bacteria 39819
248 Ga0501040_0000084 3300049576 Bacteria 46187
249 Ga0501041_0000140 3300049577 Bacteria 31667
250 Ga0501042_0000867 3300049578 Bacteria 16901
251 Ga0501043_0033479 3300049579 Bacteria 4043
252 Ga0501046_0012840 3300049580 Bacteria 7123
253 Ga0501048_0001324 3300049582 Bacteria 18763
254 Ga0501067_0000008 3300049583 Bacteria 123725
255 Ga0501071_0000104 3300049587 Bacteria 32570
256 Ga0501072_0000527 3300049588 Bacteria 27459
257 Ga0501073_0000108 3300049589 Bacteria 53298
258 Ga0501073_0071016 3300049589 Bacteria 2426
259 Ga0501075_0000140 3300049591 Bacteria 36122
260 Ga0501076_0000708 3300049592 Bacteria 21496
261 Ga0501077_0000110 3300049593 Bacteria 43064
262 Ga0501077_0012349 3300049593 Bacteria 5350
263 Ga0501079_0000206 3300049741 Bacteria 34428
264 Ga0501080_0002380 3300049742 Bacteria 16403
265 Ga0501081_0000008 3300049743 Bacteria 72293
266 Ga0501035_0014094 3300049822 Bacteria 7375
267 Ga0501045_0000236 3300049824 Bacteria 32116
268 nmdc:mga05p37_50947_c1 3300050507 Bacteria 5091
269 Ga0500643_000014 3300053087 Bacteria 318249
270 Ga0501084_0000250 3300054114 Bacteria 40635
271 Ga0501082_0000097 3300060353 Bacteria 67879
272 Ga0530510_0000392 3300061734 Bacteria 28515

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031241 Ga0265325_10043751 Ga0265325_100437512 317
2 3300003761 Ga0055535_1000627 Ga0055535_100062719 320
3 3300003762 Ga0055542_1000630 Ga0055542_100063021 320
4 3300003763 Ga0055529_1000594 Ga0055529_100059419 320
5 3300025228 Ga0209672_100382 Ga0209672_10038217 320
6 3300025242 Ga0209258_100334 Ga0209258_10033431 320
7 3300025246 Ga0209646_1002233 Ga0209646_10022335 320
8 3300025250 Ga0209026_1001018 Ga0209026_10010183 320
9 3300025254 Ga0209148_1000340 Ga0209148_100034018 320
10 3300025256 Ga0209759_1000451 Ga0209759_100045120 320
11 3300025272 Ga0209455_1000256 Ga0209455_100025618 320
12 3300031250 Ga0265331_10015994 Ga0265331_100159946 321
13 3300044693 Ga0466961_0000309 Ga0466961_0000309_27611_28720 323
14 3300044712 Ga0453684_0001650 Ga0453684_0001650_5899_7011 330
15 3300037312 Ga0395899_0000438 Ga0395899_0000438_27267_28382 332
16 3300037466 Ga0395898_0000769 Ga0395898_0000769_27183_28298 332
17 3300038443 Ga0395901_0000455 Ga0395901_0000455_18173_19288 332
18 3300044656 Ga0466969_0000081 Ga0466969_0000081_32746_33861 332
19 3300044693 Ga0466961_0000356 Ga0466961_0000356_22031_23146 332
20 3300044765 Ga0466970_0001293 Ga0466970_0001293_6442_7557 332
21 3300044842 Ga0466957_0035547 Ga0466957_0035547_670_1785 332
22 3300045049 Ga0466959_0002594 Ga0466959_0002594_7883_8998 332
23 3300045051 Ga0451576_0178368 Ga0451576_0178368_855_1976 336
24 3300031344 Ga0265316_10069154 Ga0265316_100691542 340
25 3300044712 Ga0453684_0069706 Ga0453684_0069706_855_1982 340
26 3300048929 Ga0496126_0003179 Ga0496126_0003179_11142_12212 341
27 3300053087 Ga0500643_000014 Ga0500643_000014_39440_40570 341
28 3300009093 Ga0105240_10000049 Ga0105240_10000049102 342
29 3300025913 Ga0207695_10000114 Ga0207695_1000011453 342
30 3300048904 Ga0496101_0032618 Ga0496101_0032618_2329_3441 342
31 3300048918 Ga0496115_0061243 Ga0496115_0061243_814_1926 342
32 3300048921 Ga0496118_0002295 Ga0496118_0002295_10930_12042 342
33 3300048924 Ga0496121_0002469 Ga0496121_0002469_13955_15067 342
34 3300048929 Ga0496126_0000320 Ga0496126_0000320_87511_88623 342
35 3300006028 Ga0070717_10052152 Ga0070717_100521524 343
36 3300005615 Ga0070702_100072444 Ga0070702_1000724442 344
37 3300044712 Ga0453684_0001915 Ga0453684_0001915_37181_38296 344
38 3300013306 Ga0163162_10054774 Ga0163162_100547745 345
39 3300014325 Ga0163163_10000284 Ga0163163_1000028422 345
40 3300014968 Ga0157379_10000024 Ga0157379_1000002447 345
41 3300028800 Ga0265338_10074999 Ga0265338_100749994 346
42 3300005616 Ga0068852_100147519 Ga0068852_1001475192 347
43 3300044712 Ga0453684_0085679 Ga0453684_0085679_2534_3655 347
44 3300015261 Ga0182006_1007701 Ga0182006_10077014 348
45 3300015262 Ga0182007_10000070 Ga0182007_1000007045 348
46 3300028563 Ga0265319_1000716 Ga0265319_100071618 348
47 3300028577 Ga0265318_10000195 Ga0265318_100001959 348
48 3300028800 Ga0265338_10005443 Ga0265338_100054436 348
49 3300031238 Ga0265332_10035751 Ga0265332_100357512 348
50 3300031240 Ga0265320_10000228 Ga0265320_100002286 348
51 3300031241 Ga0265325_10045721 Ga0265325_100457213 348
52 3300031242 Ga0265329_10001610 Ga0265329_1000161012 348
53 3300031247 Ga0265340_10019231 Ga0265340_100192316 348
54 3300031249 Ga0265339_10005075 Ga0265339_1000507512 348
55 3300031249 Ga0265339_10028741 Ga0265339_100287412 348
56 3300031250 Ga0265331_10000198 Ga0265331_1000019842 348
57 3300031344 Ga0265316_10059091 Ga0265316_100590913 348
58 3300031595 Ga0265313_10025853 Ga0265313_100258532 348
59 3300031712 Ga0265342_10000428 Ga0265342_1000042842 348
60 3300009093 Ga0105240_10056525 Ga0105240_100565256 349
61 3300013307 Ga0157372_10032358 Ga0157372_100323585 349
62 3300034818 Ga0373950_0000006 Ga0373950_0000006_141786_142886 349
63 3300042876 Ga0451577_0212090 Ga0451577_0212090_245_1369 349
64 3300044712 Ga0453684_0000119 Ga0453684_0000119_58557_59651 349
65 3300048907 Ga0496104_0177272 Ga0496104_0177272_825_1994 349
66 3300031235 Ga0265330_10000390 Ga0265330_1000039017 350
67 3300044712 Ga0453684_0172264 Ga0453684_0172264_619_1758 350
68 iso_pu_bacteria 2884411467 2884413057 350
69 3300028654 Ga0265322_10009849 Ga0265322_100098494 351
70 3300028800 Ga0265338_10017162 Ga0265338_100171626 351
71 3300031235 Ga0265330_10011870 Ga0265330_100118704 351
72 3300031238 Ga0265332_10016807 Ga0265332_100168073 351
73 3300031242 Ga0265329_10000087 Ga0265329_1000008734 351
74 3300031249 Ga0265339_10009389 Ga0265339_100093892 351
75 3300031344 Ga0265316_10000512 Ga0265316_1000051231 351
76 3300031711 Ga0265314_10056403 Ga0265314_100564032 351
77 3300031712 Ga0265342_10000301 Ga0265342_1000030150 351
78 3300009093 Ga0105240_10018290 Ga0105240_1001829011 352
79 3300013105 Ga0157369_10048226 Ga0157369_100482263 352
80 3300013307 Ga0157372_10012189 Ga0157372_100121895 352
81 3300025242 Ga0209258_105669 Ga0209258_1056692 353
82 3300003760 Ga0055527_1000086 Ga0055527_100008625 354
83 3300003761 Ga0055535_1000155 Ga0055535_100015523 354
84 3300003762 Ga0055542_1000201 Ga0055542_100020123 354
85 3300003763 Ga0055529_1000222 Ga0055529_100022223 354
86 3300005340 Ga0070689_100000986 Ga0070689_1000009864 354
87 3300005455 Ga0070663_100074784 Ga0070663_1000747843 354
88 3300005539 Ga0068853_100000624 Ga0068853_1000006246 354
89 3300005563 Ga0068855_100058733 Ga0068855_1000587332 354
90 3300009551 Ga0105238_10014275 Ga0105238_100142756 354
91 3300014969 Ga0157376_10010446 Ga0157376_100104466 354
92 3300025228 Ga0209672_100009 Ga0209672_100009195 354
93 3300025242 Ga0209258_100011 Ga0209258_100011448 354
94 3300025254 Ga0209148_1000013 Ga0209148_1000013448 354
95 3300025272 Ga0209455_1000012 Ga0209455_1000012448 354
96 3300025924 Ga0207694_10013083 Ga0207694_100130836 354
97 3300025924 Ga0207694_10015772 Ga0207694_100157722 354
98 3300025936 Ga0207670_10000391 Ga0207670_1000039117 354
99 3300026041 Ga0207639_10005899 Ga0207639_100058998 354
100 3300046460 Ga0495638_0000076 Ga0495638_0000076_118907_120022 354
101 3300046471 Ga0495650_0000122 Ga0495650_0000122_9511_10623 354
102 3300046507 Ga0495606_0000056 Ga0495606_0000056_124877_125989 354
103 3300046694 Ga0495649_0001238 Ga0495649_0001238_6176_7288 354
104 3300048918 Ga0496115_0001910 Ga0496115_0001910_111_1223 354
105 3300005365 Ga0070688_100030196 Ga0070688_1000301965 355
106 3300042876 Ga0451577_0104624 Ga0451577_0104624_179_1255 355
107 iso_pu_bacteria 2941485952 2941486429 356
108 3300028653 Ga0265323_10002764 Ga0265323_100027646 358
109 3300044712 Ga0453684_0043613 Ga0453684_0043613_658_1761 358
110 3300045051 Ga0451576_0018993 Ga0451576_0018993_2559_3659 358
111 3300005340 Ga0070689_100000001 Ga0070689_100000001254 359
112 3300025936 Ga0207670_10000002 Ga0207670_10000002154 359
113 3300046472 Ga0495580_0052890 Ga0495580_0052890_1600_2730 359
114 3300005518 Ga0070699_100195941 Ga0070699_1001959413 360
115 3300024227 Ga0228598_1007165 Ga0228598_10071652 360
116 3300031249 Ga0265339_10043339 Ga0265339_100433392 360
117 3300005614 Ga0068856_100083409 Ga0068856_1000834093 361
118 3300006028 Ga0070717_10094852 Ga0070717_100948523 361
119 3300009093 Ga0105240_10000766 Ga0105240_1000076643 361
120 3300009174 Ga0105241_10040373 Ga0105241_100403736 361
121 3300013100 Ga0157373_10099583 Ga0157373_100995833 361
122 3300025913 Ga0207695_10002323 Ga0207695_1000232324 361
123 3300025913 Ga0207695_10010241 Ga0207695_100102419 361
124 3300025913 Ga0207695_10072075 Ga0207695_100720754 361
125 3300037068 Ga0373925_0086966 Ga0373925_0086966_362_1471 361
126 3300045976 Ga0466967_0032842 Ga0466967_0032842_922_2040 361
127 3300045976 Ga0466967_0099265 Ga0466967_0099265_1152_2258 361
128 3300046472 Ga0495580_0004695 Ga0495580_0004695_969_2075 361
129 3300046472 Ga0495580_0129161 Ga0495580_0129161_149_1258 361
130 3300048088 Ga0495602_0120528 Ga0495602_0120528_932_2035 361
131 3300049583 Ga0501067_0000008 Ga0501067_0000008_66813_67913 361
132 3300049589 Ga0501073_0000108 Ga0501073_0000108_35321_36421 361
133 3300005329 Ga0070683_100271032 Ga0070683_1002710321 362
134 3300005458 Ga0070681_10110338 Ga0070681_101103382 362
135 3300005518 Ga0070699_100111549 Ga0070699_1001115492 362
136 3300005535 Ga0070684_100010098 Ga0070684_1000100989 362
137 3300005536 Ga0070697_100102643 Ga0070697_1001026433 362
138 3300005548 Ga0070665_100007157 Ga0070665_10000715710 362
139 3300025912 Ga0207707_10104382 Ga0207707_101043822 362
140 3300025915 Ga0207693_10201496 Ga0207693_102014962 362
141 3300028379 Ga0268266_10148498 Ga0268266_101484982 362
142 3300028556 Ga0265337_1003805 Ga0265337_10038057 362
143 3300028563 Ga0265319_1034963 Ga0265319_10349632 362
144 3300028573 Ga0265334_10020457 Ga0265334_100204573 362
145 3300028577 Ga0265318_10000223 Ga0265318_1000022327 362
146 3300028653 Ga0265323_10001911 Ga0265323_100019117 362
147 3300028653 Ga0265323_10004726 Ga0265323_100047263 362
148 3300028653 Ga0265323_10006308 Ga0265323_100063086 362
149 3300028653 Ga0265323_10022121 Ga0265323_100221212 362
150 3300028800 Ga0265338_10006574 Ga0265338_100065748 362
151 3300028800 Ga0265338_10018142 Ga0265338_100181427 362
152 3300028800 Ga0265338_10233785 Ga0265338_102337852 362
153 3300029957 Ga0265324_10000070 Ga0265324_1000007058 362
154 3300031235 Ga0265330_10003102 Ga0265330_100031022 362
155 3300031235 Ga0265330_10003575 Ga0265330_1000357510 362
156 3300031235 Ga0265330_10005417 Ga0265330_100054176 362
157 3300031235 Ga0265330_10007071 Ga0265330_100070711 362
158 3300031235 Ga0265330_10053959 Ga0265330_100539592 362
159 3300031238 Ga0265332_10000642 Ga0265332_1000064215 362
160 3300031238 Ga0265332_10025400 Ga0265332_100254002 362
161 3300031239 Ga0265328_10001383 Ga0265328_1000138310 362
162 3300031239 Ga0265328_10003767 Ga0265328_100037676 362
163 3300031240 Ga0265320_10000506 Ga0265320_1000050613 362
164 3300031240 Ga0265320_10003515 Ga0265320_1000351510 362
165 3300031240 Ga0265320_10072922 Ga0265320_100729221 362
166 3300031241 Ga0265325_10002378 Ga0265325_1000237813 362
167 3300031242 Ga0265329_10001245 Ga0265329_100012452 362
168 3300031242 Ga0265329_10002633 Ga0265329_1000263310 362
169 3300031247 Ga0265340_10007271 Ga0265340_100072715 362
170 3300031247 Ga0265340_10111181 Ga0265340_101111811 362
171 3300031249 Ga0265339_10000006 Ga0265339_10000006182 362
172 3300031249 Ga0265339_10002886 Ga0265339_100028867 362
173 3300031249 Ga0265339_10007014 Ga0265339_100070142 362
174 3300031250 Ga0265331_10000383 Ga0265331_1000038321 362
175 3300031250 Ga0265331_10001339 Ga0265331_1000133910 362
176 3300031344 Ga0265316_10000074 Ga0265316_1000007464 362
177 3300031344 Ga0265316_10000567 Ga0265316_100005679 362
178 3300031344 Ga0265316_10001247 Ga0265316_100012475 362
179 3300031344 Ga0265316_10005718 Ga0265316_1000571810 362
180 3300031344 Ga0265316_10009863 Ga0265316_100098635 362
181 3300031344 Ga0265316_10041777 Ga0265316_100417775 362
182 3300031595 Ga0265313_10004018 Ga0265313_1000401810 362
183 3300031595 Ga0265313_10008380 Ga0265313_100083802 362
184 3300031711 Ga0265314_10000015 Ga0265314_10000015153 362
185 3300031711 Ga0265314_10009526 Ga0265314_100095262 362
186 3300031712 Ga0265342_10000310 Ga0265342_1000031032 362
187 3300031712 Ga0265342_10001137 Ga0265342_100011376 362
188 3300031712 Ga0265342_10003802 Ga0265342_100038028 362
189 3300031712 Ga0265342_10009864 Ga0265342_100098644 362
190 3300031712 Ga0265342_10013029 Ga0265342_100130294 362
191 3300031712 Ga0265342_10016631 Ga0265342_100166316 362
192 3300031712 Ga0265342_10021916 Ga0265342_100219162 362
193 3300035120 Ga0373957_0066505 Ga0373957_0066505_40_1146 362
194 3300035172 Ga0373955_0016966 Ga0373955_0016966_1189_2298 362
195 3300035724 Ga0373933_0024972 Ga0373933_0024972_2158_3267 362
196 3300036401 Ga0373937_0003818 Ga0373937_0003818_3945_5054 362
197 3300036401 Ga0373937_0181199 Ga0373937_0181199_70_1170 362
198 3300037068 Ga0373925_0176335 Ga0373925_0176335_255_1364 362
199 3300044712 Ga0453684_0103138 Ga0453684_0103138_1580_2677 362
200 3300047322 Ga0495680_0051045 Ga0495680_0051045_759_1868 362
201 3300031250 Ga0265331_10022218 Ga0265331_100222183 363
202 3300031344 Ga0265316_10034597 Ga0265316_100345973 363
203 3300031711 Ga0265314_10014171 Ga0265314_100141713 363
204 3300005530 Ga0070679_100008208 Ga0070679_1000082089 364
205 3300005577 Ga0068857_100018073 Ga0068857_1000180736 364
206 3300009545 Ga0105237_10000155 Ga0105237_1000015529 364
207 3300009551 Ga0105238_10009442 Ga0105238_100094429 364
208 3300010375 Ga0105239_10094977 Ga0105239_100949772 364
209 3300025914 Ga0207671_10002734 Ga0207671_1000273417 364
210 3300025921 Ga0207652_10000559 Ga0207652_1000055922 364
211 3300025924 Ga0207694_10055248 Ga0207694_100552482 364
212 3300026116 Ga0207674_10030558 Ga0207674_100305586 364
213 3300031249 Ga0265339_10011218 Ga0265339_100112182 364
214 3300031711 Ga0265314_10009147 Ga0265314_100091475 364
215 3300005468 Ga0070707_100086151 Ga0070707_1000861512 365
216 3300005518 Ga0070699_100067235 Ga0070699_1000672352 365
217 3300028563 Ga0265319_1045154 Ga0265319_10451541 365
218 3300028577 Ga0265318_10000050 Ga0265318_1000005055 365
219 3300031235 Ga0265330_10000922 Ga0265330_100009222 365
220 3300031238 Ga0265332_10000127 Ga0265332_1000012734 365
221 3300031239 Ga0265328_10002747 Ga0265328_100027479 365
222 3300031240 Ga0265320_10000006 Ga0265320_10000006163 365
223 3300031242 Ga0265329_10003083 Ga0265329_100030834 365
224 3300031250 Ga0265331_10000004 Ga0265331_10000004298 365
225 3300031344 Ga0265316_10017746 Ga0265316_100177468 365
226 3300031595 Ga0265313_10001200 Ga0265313_1000120020 365
227 3300031711 Ga0265314_10000014 Ga0265314_10000014129 365
228 3300031712 Ga0265342_10040336 Ga0265342_100403363 365
229 3300005366 Ga0070659_100038674 Ga0070659_1000386742 367
230 3300005530 Ga0070679_100266618 Ga0070679_1002666182 367
231 3300005563 Ga0068855_100063325 Ga0068855_1000633255 367
232 3300025909 Ga0207705_10001824 Ga0207705_100018242 367
233 3300025921 Ga0207652_10066758 Ga0207652_100667582 367
234 3300025932 Ga0207690_10024679 Ga0207690_100246794 367
235 3300025949 Ga0207667_10115597 Ga0207667_101155972 367
236 3300046616 Ga0495668_0039219 Ga0495668_0039219_561_1706 367
237 3300030760 Ga0265762_1006579 Ga0265762_10065792 368
238 3300003323 rootH1_10005544 rootH1_1000554410 370
239 3300049570 Ga0501033_0005379 Ga0501033_0005379_3078_4196 370
240 3300049572 Ga0501036_0007183 Ga0501036_0007183_4687_5805 370
241 3300049573 Ga0501037_0020656 Ga0501037_0020656_835_1953 370
242 3300049574 Ga0501038_0005641 Ga0501038_0005641_8123_9241 370
243 3300049575 Ga0501039_0000241 Ga0501039_0000241_14015_15133 370
244 3300049576 Ga0501040_0000084 Ga0501040_0000084_10633_11751 370
245 3300049577 Ga0501041_0000140 Ga0501041_0000140_22237_23355 370
246 3300049578 Ga0501042_0000867 Ga0501042_0000867_3553_4671 370
247 3300049579 Ga0501043_0033479 Ga0501043_0033479_2164_3282 370
248 3300049580 Ga0501046_0012840 Ga0501046_0012840_1944_3062 370
249 3300049582 Ga0501048_0001324 Ga0501048_0001324_12076_13194 370
250 3300049587 Ga0501071_0000104 Ga0501071_0000104_11264_12382 370
251 3300049588 Ga0501072_0000527 Ga0501072_0000527_22310_23428 370
252 3300049589 Ga0501073_0071016 Ga0501073_0071016_148_1266 370
253 3300049591 Ga0501075_0000140 Ga0501075_0000140_7377_8495 370
254 3300049592 Ga0501076_0000708 Ga0501076_0000708_5673_6791 370
255 3300049593 Ga0501077_0000110 Ga0501077_0000110_24688_25806 370
256 3300049741 Ga0501079_0000206 Ga0501079_0000206_14697_15815 370
257 3300049742 Ga0501080_0002380 Ga0501080_0002380_15222_16340 370
258 3300049743 Ga0501081_0000008 Ga0501081_0000008_22232_23350 370
259 3300049822 Ga0501035_0014094 Ga0501035_0014094_4717_5835 370
260 3300049824 Ga0501045_0000236 Ga0501045_0000236_14912_16030 370
261 3300054114 Ga0501084_0000250 Ga0501084_0000250_31265_32383 370
262 3300060353 Ga0501082_0000097 Ga0501082_0000097_6835_7953 370
263 3300061734 Ga0530510_0000392 Ga0530510_0000392_19098_20216 370
264 3300005355 Ga0070671_100283135 Ga0070671_1002831352 373
265 3300006237 Ga0097621_100178432 Ga0097621_1001784322 373
266 3300013297 Ga0157378_10019335 Ga0157378_100193354 373
267 3300014326 Ga0157380_10264507 Ga0157380_102645072 373
268 3300049593 Ga0501077_0012349 Ga0501077_0012349_821_1966 375
269 2162886012 MBSR1b_contig_4592414 MBSR1b_0796.00006580 381
270 3300005293 Ga0065715_10139848 Ga0065715_101398482 381
271 3300005536 Ga0070697_100067823 Ga0070697_1000678232 381
272 3300007076 Ga0075435_100052068 Ga0075435_1000520685 381
273 3300009147 Ga0114129_10117442 Ga0114129_101174425 381
274 3300050507 nmdc:mga05p37_50947_c1 nmdc:mga05p37_50947_c1_31_1179 381

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02119

FlgI

Flagellar P-ring protein

66

405

0.99

Feature Viewer

pLDDT pTM Quality
75.66 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map