F379732

General Info

Members Datasets Scaffolds Average Seq Length
274 185 548 484

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10008093|Ga0163162_100080935
Length 549
Sequence VNLQWADLGLTSYQLPANPQPAQSRQSTNINLLSNLKFQISNSNLSFFFAFPMKHILLFGAGKSATCLIDYLKQQCSEKDWKFTVCDTNIEALRAKLGNARNTEGISINVEDETQRKDLVKQADVVISLLPAHLHYLVAQDCLEFGKHLLTASYVDEKISNLRSKISDKNILFLCEMGLDPGIDHMSAMKIIHEIKDKGGKITSFKSHCGGLVAPESDDNPWHYKISWNPRNVVMAGKAGAIYKENGKEVHEEYKDLFKPERALEMEELGHLSYYPNRDSLSYIDTYQLHETDTFIRTTLRFPEFCYGWKNIIELHLTDEEVEYDTDRMTLKDFFKEWLSKQMTDRLKFSNDLLAKLLALQEQEEELKHEAELVGKEPELEHFMMVDEKGDLKDIGLDEVKNSAANAVMTKLHEANLAMKQLMFLGLDSEEMINKGKCSAADVLQFVLERKLALKEGDKDMIVMLHEFEVEEGNKKYEVKSSLIVLGEDNVRTAMAKTVGLPLGIAAKLILEGTMNVTGLHIPVIPEIYEPVLKELEQNGIKFKETTTN

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
117 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
118 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
123 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
128 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
129 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
136 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
154 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
155 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
156 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
157 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
158 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
159 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
160 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
161 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
162 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
168 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
169 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
170 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
171 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
172 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
173 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
174 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
175 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
176 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
177 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
178 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
179 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
180 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
181 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
182 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
183 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
184 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
185 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.35
Metatranscriptomes 0
Isolates 3.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.3
Nodule 0
Rhizoplane 1.09
Rhizosphere 86.86
Stem 0
Stem Tuber 0
Unclassified 8.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10008093 3300013306 Bacteria 10261
2 JGI24740J21852_10010043 3300001979 Unclassified 3667
3 JGI25406J46586_10037135 3300003203 Bacteria 1760
4 rootL2_10010780 3300003322 Bacteria 3646
5 rootH1_10031561 3300003323 Bacteria 10584
6 JGI25160J50197_1000790 3300003354 Bacteria 17009
7 JGI25160J50197_1010001 3300003354 Bacteria 3466
8 Ga0055535_1003520 3300003761 Bacteria 4374
9 Ga0055531_10000023 3300003794 Bacteria 165025
10 Ga0065715_10005922 3300005293 Bacteria 3697
11 Ga0070683_100003881 3300005329 Bacteria 12229
12 Ga0070683_100024807 3300005329 Bacteria 5376
13 Ga0070690_100001158 3300005330 Bacteria 13568
14 Ga0070670_100042783 3300005331 Bacteria 3895
15 Ga0070670_100043497 3300005331 Bacteria 3860
16 Ga0068869_100031774 3300005334 Bacteria 3716
17 Ga0068869_100066547 3300005334 Bacteria 2655
18 Ga0070666_10013922 3300005335 Bacteria 5111
19 Ga0070666_10069292 3300005335 Bacteria 2398
20 Ga0068868_100027504 3300005338 Bacteria 4339
21 Ga0070660_100057014 3300005339 Bacteria 3024
22 Ga0070689_100126623 3300005340 Unclassified 2045
23 Ga0070661_100003179 3300005344 Bacteria 11317
24 Ga0070661_100019630 3300005344 Bacteria 4816
25 Ga0070668_100008497 3300005347 Bacteria 7627
26 Ga0070669_100061790 3300005353 Bacteria 2753
27 Ga0070675_100028523 3300005354 Bacteria 4492
28 Ga0070675_100068555 3300005354 Bacteria 2937
29 Ga0070675_100159016 3300005354 Bacteria 1942
30 Ga0070675_100201221 3300005354 Bacteria 1729
31 Ga0070671_100049800 3300005355 Bacteria 3485
32 Ga0070671_100059407 3300005355 Bacteria 3182
33 Ga0070673_100012979 3300005364 Bacteria 5744
34 Ga0070673_100049784 3300005364 Bacteria 3272
35 Ga0070688_100079130 3300005365 Bacteria 2123
36 Ga0070659_100001835 3300005366 Bacteria 15262
37 Ga0070659_100088833 3300005366 Bacteria 2475
38 Ga0070667_100015793 3300005367 Bacteria 6246
39 Ga0070667_100111526 3300005367 Bacteria 2372
40 Ga0070678_100020299 3300005456 Bacteria 4356
41 Ga0070662_100047273 3300005457 Unclassified 3095
42 Ga0070662_100049517 3300005457 Bacteria 3030
43 Ga0068867_100036663 3300005459 Bacteria 3562
44 Ga0068867_100117232 3300005459 Bacteria 2053
45 Ga0068867_100144568 3300005459 Unclassified 1862
46 Ga0070685_10046380 3300005466 Bacteria 2494
47 Ga0070698_100004621 3300005471 Bacteria 15125
48 Ga0070679_100018398 3300005530 Bacteria 6781
49 Ga0070684_100000285 3300005535 Bacteria 35210
50 Ga0070684_100083519 3300005535 Bacteria 2830
51 Ga0068853_100004573 3300005539 Bacteria 10729
52 Ga0068853_100004633 3300005539 Bacteria 10659
53 Ga0068853_100105078 3300005539 Bacteria 2501
54 Ga0070672_100092160 3300005543 Bacteria 2446
55 Ga0070665_100051321 3300005548 Bacteria 4137
56 Ga0068855_100018440 3300005563 Bacteria 8386
57 Ga0070664_100000423 3300005564 Bacteria 31649
58 Ga0070664_100005995 3300005564 Bacteria 9824
59 Ga0070664_100160968 3300005564 Unclassified 1986
60 Ga0068857_100001120 3300005577 Bacteria 20847
61 Ga0068857_100131288 3300005577 Bacteria 2259
62 Ga0068854_100061144 3300005578 Bacteria 2727
63 Ga0068856_100023625 3300005614 Bacteria 5978
64 Ga0068852_100005821 3300005616 Bacteria 8851
65 Ga0068859_100145810 3300005617 Bacteria 2442
66 Ga0068859_100322990 3300005617 Bacteria 1637
67 Ga0068864_100039178 3300005618 Bacteria 4050
68 Ga0068864_100057425 3300005618 Bacteria 3362
69 Ga0068864_100106418 3300005618 Unclassified 2494
70 Ga0068861_100029967 3300005719 Unclassified 3984
71 Ga0068863_100041058 3300005841 Unclassified 4398
72 Ga0068863_100062056 3300005841 Bacteria 3535
73 Ga0068863_100095882 3300005841 Bacteria 2816
74 Ga0068858_100025824 3300005842 Bacteria 5464
75 Ga0068862_100049218 3300005844 Bacteria 3599
76 Ga0081539_10000899 3300005985 Bacteria 56635
77 Ga0097621_100000122 3300006237 Bacteria 44726
78 Ga0068871_100000412 3300006358 Bacteria 29568
79 Ga0068871_100052238 3300006358 Unclassified 3309
80 Ga0075428_100087239 3300006844 Unclassified 3403
81 Ga0075431_100017748 3300006847 Bacteria 7235
82 Ga0068865_100082044 3300006881 Unclassified 2317
83 Ga0097620_100145794 3300006931 Bacteria 2442
84 Ga0097620_100322987 3300006931 Bacteria 1637
85 Ga0111539_10001798 3300009094 Bacteria 28539
86 Ga0105242_10010261 3300009176 Bacteria 7181
87 Ga0105242_10137433 3300009176 Unclassified 2116
88 Ga0105248_10046755 3300009177 Bacteria 4852
89 Ga0105237_10003754 3300009545 Bacteria 17897
90 Ga0105249_10015068 3300009553 Bacteria 6840
91 Ga0105249_10050935 3300009553 Bacteria 3776
92 Ga0105249_10059626 3300009553 Bacteria 3500
93 Ga0105249_10080308 3300009553 Bacteria 3029
94 Ga0105239_10113216 3300010375 Bacteria 3009
95 Ga0157369_10033782 3300013105 Bacteria 5617
96 Ga0157369_10076189 3300013105 Bacteria 3595
97 Ga0157374_10027330 3300013296 Bacteria 5144
98 Ga0157378_10021429 3300013297 Bacteria 5683
99 Ga0157378_10033031 3300013297 Bacteria 4573
100 Ga0157378_10248826 3300013297 Bacteria 1701
101 Ga0163162_10000703 3300013306 Bacteria 30932
102 Ga0163162_10012776 3300013306 Bacteria 8202
103 Ga0163162_10023195 3300013306 Bacteria 6122
104 Ga0163162_10051666 3300013306 Bacteria 4124
105 Ga0163162_10338760 3300013306 Bacteria 1636
106 Ga0157372_10006938 3300013307 Bacteria 12055
107 Ga0157372_10176283 3300013307 Unclassified 2474
108 Ga0157372_10224273 3300013307 Bacteria 2179
109 Ga0157375_10000162 3300013308 Bacteria 63098
110 Ga0157375_10194362 3300013308 Bacteria 2184
111 Ga0163163_10005940 3300014325 Bacteria 10625
112 Ga0163163_10021454 3300014325 Bacteria 6095
113 Ga0163163_10184022 3300014325 Bacteria 2137
114 Ga0157380_10007340 3300014326 Bacteria 7827
115 Ga0157380_10062697 3300014326 Bacteria 2979
116 Ga0157380_10310645 3300014326 Bacteria 1457
117 Ga0157377_10022614 3300014745 Bacteria 3322
118 Ga0157377_10041185 3300014745 Bacteria 2561
119 Ga0157379_10173805 3300014968 Bacteria 1944
120 Ga0157379_10216239 3300014968 Unclassified 1736
121 Ga0157376_10001595 3300014969 Bacteria 15011
122 Ga0157376_10038996 3300014969 Unclassified 3870
123 Ga0157376_10045398 3300014969 Bacteria 3617
124 Ga0182005_1000126 3300015265 Bacteria 53914
125 Ga0163161_10001382 3300017792 Bacteria 17961
126 Ga0163161_10005549 3300017792 Bacteria 8739
127 Ga0163161_10032488 3300017792 Unclassified 3727
128 Ga0209258_100098 3300025242 Bacteria 215216
129 Ga0209148_1000120 3300025254 Bacteria 186836
130 Ga0207426_1000019 3300025302 Bacteria 558579
131 Ga0207426_1000137 3300025302 Bacteria 199010
132 Ga0207426_1010725 3300025302 Bacteria 3539
133 Ga0209257_1000013 3300025304 Bacteria 1047305
134 Ga0207680_10041943 3300025903 Bacteria 2673
135 Ga0207647_10041551 3300025904 Bacteria 2890
136 Ga0207643_10017742 3300025908 Bacteria 3896
137 Ga0207643_10029828 3300025908 Bacteria 3034
138 Ga0207657_10002233 3300025919 Bacteria 20999
139 Ga0207649_10005070 3300025920 Bacteria 7123
140 Ga0207649_10051897 3300025920 Bacteria 2541
141 Ga0207652_10049511 3300025921 Bacteria 3597
142 Ga0207681_10032049 3300025923 Bacteria 3438
143 Ga0207681_10037132 3300025923 Bacteria 3219
144 Ga0207650_10020115 3300025925 Bacteria 4702
145 Ga0207659_10060794 3300025926 Bacteria 2721
146 Ga0207644_10036396 3300025931 Bacteria 3455
147 Ga0207644_10040764 3300025931 Bacteria 3282
148 Ga0207644_10092296 3300025931 Unclassified 2259
149 Ga0207690_10003834 3300025932 Bacteria 8898
150 Ga0207706_10013177 3300025933 Bacteria 7524
151 Ga0207706_10014897 3300025933 Bacteria 7041
152 Ga0207706_10066835 3300025933 Bacteria 3164
153 Ga0207686_10006459 3300025934 Bacteria 6311
154 Ga0207691_10069432 3300025940 Bacteria 3183
155 Ga0207711_10071646 3300025941 Bacteria 3008
156 Ga0207689_10007269 3300025942 Bacteria 9722
157 Ga0207689_10011302 3300025942 Bacteria 7662
158 Ga0207689_10032672 3300025942 Bacteria 4326
159 Ga0207661_10001045 3300025944 Bacteria 18375
160 Ga0207679_10000550 3300025945 Bacteria 25168
161 Ga0207651_10012852 3300025960 Bacteria 4760
162 Ga0207651_10060383 3300025960 Bacteria 2632
163 Ga0207712_10017273 3300025961 Bacteria 4684
164 Ga0207712_10085710 3300025961 Bacteria 2306
165 Ga0207640_10070994 3300025981 Bacteria 2344
166 Ga0207658_10015914 3300025986 Bacteria 5165
167 Ga0207677_10028264 3300026023 Bacteria 3543
168 Ga0207677_10065216 3300026023 Bacteria 2540
169 Ga0207703_10014111 3300026035 Bacteria 6228
170 Ga0207639_10079158 3300026041 Bacteria 2597
171 Ga0207678_10019607 3300026067 Bacteria 5945
172 Ga0207708_10112543 3300026075 Bacteria 2114
173 Ga0207641_10007205 3300026088 Bacteria 9271
174 Ga0207641_10016765 3300026088 Bacteria 6000
175 Ga0207641_10065654 3300026088 Bacteria 3105
176 Ga0207648_10069019 3300026089 Bacteria 3080
177 Ga0207648_10111825 3300026089 Unclassified 2398
178 Ga0207648_10193298 3300026089 Bacteria 1804
179 Ga0207676_10047521 3300026095 Bacteria 3327
180 Ga0207676_10086947 3300026095 Bacteria 2555
181 Ga0207674_10005455 3300026116 Bacteria 15106
182 Ga0207674_10016092 3300026116 Bacteria 8193
183 Ga0207674_10051356 3300026116 Bacteria 4208
184 Ga0207675_100019396 3300026118 Bacteria 6345
185 Ga0207675_100210630 3300026118 Bacteria 1869
186 Ga0207683_10031050 3300026121 Bacteria 4635
187 Ga0207683_10067950 3300026121 Bacteria 3144
188 Ga0207698_10094196 3300026142 Bacteria 2462
189 Ga0268265_10303091 3300028380 Bacteria 1439
190 Ga0265327_10000385 3300031251 Bacteria 83048
191 Ga0265327_10000644 3300031251 Bacteria 56620
192 Ga0307509_10023686 3300031507 Bacteria 6885
193 Ga0307509_10036873 3300031507 Bacteria 5349
194 Ga0307408_100083874 3300031548 Unclassified 2389
195 Ga0307508_10000354 3300031616 Bacteria 55733
196 Ga0316576_10004324 3300031727 Bacteria 8498
197 Ga0316576_10049018 3300031727 Bacteria 3065
198 Ga0316577_10000274 3300031733 Bacteria 18332
199 Ga0307407_10045298 3300031903 Unclassified 2485
200 Ga0307416_100067115 3300032002 Unclassified 2957
201 Ga0307415_100067985 3300032126 Unclassified 2492
202 Ga0316580_10005260 3300032139 Bacteria 3772
203 Ga0316574_0018408 3300035398 Bacteria 4104
204 Ga0373937_0098493 3300036401 Bacteria 2712
205 Ga0316582_0004741 3300036647 Bacteria 6922
206 Ga0316582_0037742 3300036647 Bacteria 2997
207 Ga0395905_0010691 3300037471 Bacteria 8901
208 Ga0439431_0000202 3300041997 Bacteria 11736
209 Ga0439445_0004952 3300042004 Bacteria 3026
210 Ga0439449_0041245 3300042007 Bacteria 1716
211 Ga0451577_0210125 3300042876 Bacteria 1758
212 Ga0453684_0071217 3300044712 Unclassified 4397
213 Ga0466959_0085523 3300045049 Bacteria 2269
214 Ga0495643_0020778 3300046522 Bacteria 3778
215 Ga0495668_0000624 3300046616 Bacteria 42812
216 Ga0495668_0025693 3300046616 Unclassified 3345
217 Ga0495636_0000020 3300047318 Bacteria 75085
218 Ga0495672_0046713 3300047320 Bacteria 2581
219 Ga0495686_0000102 3300047472 Bacteria 177525
220 Ga0495686_0004760 3300047472 Bacteria 10981
221 Ga0496100_0054737 3300048903 Bacteria 2604
222 Ga0496101_0115021 3300048904 Bacteria 2029
223 Ga0496110_0147378 3300048913 Bacteria 2130
224 Ga0496121_0000007 3300048924 Bacteria 942516
225 Ga0501032_0000933 3300049569 Bacteria 23653
226 Ga0501034_0011063 3300049571 Bacteria 9371
227 Ga0501034_0061385 3300049571 Bacteria 3774
228 Ga0501036_0015551 3300049572 Bacteria 6358
229 Ga0501038_0079407 3300049574 Bacteria 2767
230 Ga0501039_0055675 3300049575 Bacteria 3064
231 Ga0501043_0022801 3300049579 Bacteria 4909
232 Ga0501043_0327188 3300049579 Bacteria 1168
233 Ga0501046_0006430 3300049580 Bacteria 10409
234 Ga0501047_0042058 3300049581 Bacteria 4416
235 Ga0501048_0006411 3300049582 Bacteria 8943
236 Ga0501073_0097618 3300049589 Bacteria 2040
237 Ga0501074_0000668 3300049590 Bacteria 21402
238 Ga0501201_001107 3300049651 Bacteria 2532
239 Ga0501217_000220 3300049661 Bacteria 8651
240 Ga0501223_000584 3300049663 Bacteria 8796
241 Ga0501235_002702 3300049669 Bacteria 3813
242 Ga0501238_003928 3300049671 Bacteria 1843
243 Ga0501261_001591 3300049690 Bacteria 2789
244 Ga0501221_001138 3300049704 Bacteria 4386
245 Ga0501225_0003821 3300049705 Bacteria 4523
246 Ga0501234_013239 3300049707 Bacteria 1294
247 Ga0501241_007506 3300049758 Bacteria 1996
248 Ga0501035_0011988 3300049822 Bacteria 8018
249 Ga0501035_0013893 3300049822 Bacteria 7429
250 Ga0501035_0056323 3300049822 Bacteria 3508
251 Ga0501044_0026200 3300049823 Bacteria 6175
252 Ga0501044_0078605 3300049823 Bacteria 3343
253 nmdc:mga0qj67_3636_c1 3300050509 Bacteria 11125
254 nmdc:mga08y16_93925_c1 3300050511 Bacteria 3125
255 Ga0500644_0000040 3300053088 Bacteria 77696
256 Ga0500641_0067867 3300053096 Bacteria 1496
257 Ga0500569_000087 3300053109 Bacteria 14743
258 Ga0500642_0010781 3300053130 Bacteria 3239
259 Ga0500658_0002246 3300053134 Bacteria 7491
260 Ga0500616_0001400 3300053153 Bacteria 23227
261 Ga0500616_0008423 3300053153 Bacteria 6406
262 Ga0500622_0000110 3300053156 Bacteria 83911
263 Ga0500627_0002682 3300053158 Bacteria 5330
264 Ga0500633_0000573 3300053160 Bacteria 6012
265 2819575670 2818991442 Bacteria 8318214
266 2819678327 2818991460 Bacteria 7595395
267 2821138219 2821136567 Bacteria 8080116
268 2884793226 2884791551 Bacteria 8511252
269 2904469015 2904467357 Bacteria 8057758
270 2910247105 2910245624 Bacteria 6935613
271 2929180960 2929177148 Bacteria 7883697
272 2929242897 2929239360 Bacteria 7745570
273 2945983359 2945977869 Bacteria 7777518
274 2946017251 2946013367 Bacteria 7766675
275 Ga0163162_10008093
276 JGI24740J21852_10010043
277 JGI25406J46586_10037135
278 rootL2_10010780
279 rootH1_10031561
280 JGI25160J50197_1000790
281 JGI25160J50197_1010001
282 Ga0055535_1003520
283 Ga0055531_10000023
284 Ga0065715_10005922
285 Ga0070683_100003881
286 Ga0070683_100024807
287 Ga0070690_100001158
288 Ga0070670_100042783
289 Ga0070670_100043497
290 Ga0068869_100031774
291 Ga0068869_100066547
292 Ga0070666_10013922
293 Ga0070666_10069292
294 Ga0068868_100027504
295 Ga0070660_100057014
296 Ga0070689_100126623
297 Ga0070661_100003179
298 Ga0070661_100019630
299 Ga0070668_100008497
300 Ga0070669_100061790
301 Ga0070675_100028523
302 Ga0070675_100068555
303 Ga0070675_100159016
304 Ga0070675_100201221
305 Ga0070671_100049800
306 Ga0070671_100059407
307 Ga0070673_100012979
308 Ga0070673_100049784
309 Ga0070688_100079130
310 Ga0070659_100001835
311 Ga0070659_100088833
312 Ga0070667_100015793
313 Ga0070667_100111526
314 Ga0070678_100020299
315 Ga0070662_100047273
316 Ga0070662_100049517
317 Ga0068867_100036663
318 Ga0068867_100117232
319 Ga0068867_100144568
320 Ga0070685_10046380
321 Ga0070698_100004621
322 Ga0070679_100018398
323 Ga0070684_100000285
324 Ga0070684_100083519
325 Ga0068853_100004573
326 Ga0068853_100004633
327 Ga0068853_100105078
328 Ga0070672_100092160
329 Ga0070665_100051321
330 Ga0068855_100018440
331 Ga0070664_100000423
332 Ga0070664_100005995
333 Ga0070664_100160968
334 Ga0068857_100001120
335 Ga0068857_100131288
336 Ga0068854_100061144
337 Ga0068856_100023625
338 Ga0068852_100005821
339 Ga0068859_100145810
340 Ga0068859_100322990
341 Ga0068864_100039178
342 Ga0068864_100057425
343 Ga0068864_100106418
344 Ga0068861_100029967
345 Ga0068863_100041058
346 Ga0068863_100062056
347 Ga0068863_100095882
348 Ga0068858_100025824
349 Ga0068862_100049218
350 Ga0081539_10000899
351 Ga0097621_100000122
352 Ga0068871_100000412
353 Ga0068871_100052238
354 Ga0075428_100087239
355 Ga0075431_100017748
356 Ga0068865_100082044
357 Ga0097620_100145794
358 Ga0097620_100322987
359 Ga0111539_10001798
360 Ga0105242_10010261
361 Ga0105242_10137433
362 Ga0105248_10046755
363 Ga0105237_10003754
364 Ga0105249_10015068
365 Ga0105249_10050935
366 Ga0105249_10059626
367 Ga0105249_10080308
368 Ga0105239_10113216
369 Ga0157369_10033782
370 Ga0157369_10076189
371 Ga0157374_10027330
372 Ga0157378_10021429
373 Ga0157378_10033031
374 Ga0157378_10248826
375 Ga0163162_10000703
376 Ga0163162_10012776
377 Ga0163162_10023195
378 Ga0163162_10051666
379 Ga0163162_10338760
380 Ga0157372_10006938
381 Ga0157372_10176283
382 Ga0157372_10224273
383 Ga0157375_10000162
384 Ga0157375_10194362
385 Ga0163163_10005940
386 Ga0163163_10021454
387 Ga0163163_10184022
388 Ga0157380_10007340
389 Ga0157380_10062697
390 Ga0157380_10310645
391 Ga0157377_10022614
392 Ga0157377_10041185
393 Ga0157379_10173805
394 Ga0157379_10216239
395 Ga0157376_10001595
396 Ga0157376_10038996
397 Ga0157376_10045398
398 Ga0182005_1000126
399 Ga0163161_10001382
400 Ga0163161_10005549
401 Ga0163161_10032488
402 Ga0209258_100098
403 Ga0209148_1000120
404 Ga0207426_1000019
405 Ga0207426_1000137
406 Ga0207426_1010725
407 Ga0209257_1000013
408 Ga0207680_10041943
409 Ga0207647_10041551
410 Ga0207643_10017742
411 Ga0207643_10029828
412 Ga0207657_10002233
413 Ga0207649_10005070
414 Ga0207649_10051897
415 Ga0207652_10049511
416 Ga0207681_10032049
417 Ga0207681_10037132
418 Ga0207650_10020115
419 Ga0207659_10060794
420 Ga0207644_10036396
421 Ga0207644_10040764
422 Ga0207644_10092296
423 Ga0207690_10003834
424 Ga0207706_10013177
425 Ga0207706_10014897
426 Ga0207706_10066835
427 Ga0207686_10006459
428 Ga0207691_10069432
429 Ga0207711_10071646
430 Ga0207689_10007269
431 Ga0207689_10011302
432 Ga0207689_10032672
433 Ga0207661_10001045
434 Ga0207679_10000550
435 Ga0207651_10012852
436 Ga0207651_10060383
437 Ga0207712_10017273
438 Ga0207712_10085710
439 Ga0207640_10070994
440 Ga0207658_10015914
441 Ga0207677_10028264
442 Ga0207677_10065216
443 Ga0207703_10014111
444 Ga0207639_10079158
445 Ga0207678_10019607
446 Ga0207708_10112543
447 Ga0207641_10007205
448 Ga0207641_10016765
449 Ga0207641_10065654
450 Ga0207648_10069019
451 Ga0207648_10111825
452 Ga0207648_10193298
453 Ga0207676_10047521
454 Ga0207676_10086947
455 Ga0207674_10005455
456 Ga0207674_10016092
457 Ga0207674_10051356
458 Ga0207675_100019396
459 Ga0207675_100210630
460 Ga0207683_10031050
461 Ga0207683_10067950
462 Ga0207698_10094196
463 Ga0268265_10303091
464 Ga0265327_10000385
465 Ga0265327_10000644
466 Ga0307509_10023686
467 Ga0307509_10036873
468 Ga0307408_100083874
469 Ga0307508_10000354
470 Ga0316576_10004324
471 Ga0316576_10049018
472 Ga0316577_10000274
473 Ga0307407_10045298
474 Ga0307416_100067115
475 Ga0307415_100067985
476 Ga0316580_10005260
477 Ga0316574_0018408
478 Ga0373937_0098493
479 Ga0316582_0004741
480 Ga0316582_0037742
481 Ga0395905_0010691
482 Ga0439431_0000202
483 Ga0439445_0004952
484 Ga0439449_0041245
485 Ga0451577_0210125
486 Ga0453684_0071217
487 Ga0466959_0085523
488 Ga0495643_0020778
489 Ga0495668_0000624
490 Ga0495668_0025693
491 Ga0495636_0000020
492 Ga0495672_0046713
493 Ga0495686_0000102
494 Ga0495686_0004760
495 Ga0496100_0054737
496 Ga0496101_0115021
497 Ga0496110_0147378
498 Ga0496121_0000007
499 Ga0501032_0000933
500 Ga0501034_0011063
501 Ga0501034_0061385
502 Ga0501036_0015551
503 Ga0501038_0079407
504 Ga0501039_0055675
505 Ga0501043_0022801
506 Ga0501043_0327188
507 Ga0501046_0006430
508 Ga0501047_0042058
509 Ga0501048_0006411
510 Ga0501073_0097618
511 Ga0501074_0000668
512 Ga0501201_001107
513 Ga0501217_000220
514 Ga0501223_000584
515 Ga0501235_002702
516 Ga0501238_003928
517 Ga0501261_001591
518 Ga0501221_001138
519 Ga0501225_0003821
520 Ga0501234_013239
521 Ga0501241_007506
522 Ga0501035_0011988
523 Ga0501035_0013893
524 Ga0501035_0056323
525 Ga0501044_0026200
526 Ga0501044_0078605
527 nmdc:mga0qj67_3636_c1
528 nmdc:mga08y16_93925_c1
529 Ga0500644_0000040
530 Ga0500641_0067867
531 Ga0500569_000087
532 Ga0500642_0010781
533 Ga0500658_0002246
534 Ga0500616_0001400
535 Ga0500616_0008423
536 Ga0500622_0000110
537 Ga0500627_0002682
538 Ga0500633_0000573
539 2819575670
540 2819678327
541 2821138219
542 2884793226
543 2904469015
544 2910247105
545 2929180960
546 2929242897
547 2945983359
548 2946017251

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03435

Sacchrp_dh_NADP

Saccharopine dehydrogenase NADP binding domain

56

174

0.95

PF16653

Sacchrp_dh_C

Saccharopine dehydrogenase C-terminal domain

178

410

0.85

PF16653

Sacchrp_dh_C

Saccharopine dehydrogenase C-terminal domain

390

541

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o1p-assembly1.cif.gz_A-2 crystal structure of human aminoadipate semialdehyde synthase, saccharopine dehydrogenase. 0.8901 2 500
5l78-assembly1.cif.gz_A crystal structure of human aminoadipate semialdehyde synthase, saccharopine dehydrogenase domain (in nad+ bound form) 0.8898 2 500
5l78-assembly1.cif.gz_A crystal structure of human aminoadipate semialdehyde synthase, saccharopine dehydrogenase domain (in nad+ bound form) 0.8858 2 500
5l78-assembly1.cif.gz_B crystal structure of human aminoadipate semialdehyde synthase, saccharopine dehydrogenase domain (in nad+ bound form) 0.8857 2 500
5o1p-assembly1.cif.gz_A-2 crystal structure of human aminoadipate semialdehyde synthase, saccharopine dehydrogenase. 0.8824 2 500
ID Description Score Start End Superfamily
af_A0A1D8PKJ4_3_122_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9496 2 126 3.40.50.720
af_A0A1D8PKJ4_3_122_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.942 2 126 3.40.50.720
af_A0A0P0VQF9_62_202_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.929 2 131 3.40.50.720
1e5lB02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9285 127 441 3.30.360.10
af_Q54NG9_2_127_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9025 2 127 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q5ZT01-F1-model_v4 Saccharopine dehydrogenase 0.9848 1 113 GO:0004753
GO:0005737
GO:0019878
AF-A0A090Q8W3-F1-model_v4 deleted 0.9835 406 500
AF-A0A662A8G3-F1-model_v4 Saccharopine dehydrogenase 0.9814 1 136 GO:0004753
GO:0005737
GO:0019878
AF-A0A7Y2C2Q8-F1-model_v4 Saccharopine dehydrogenase 0.9797 1 131 GO:0004753
GO:0005737
GO:0019878
AF-A0A4Q3S4V4-F1-model_v4 Saccharopine dehydrogenase 0.9777 1 284 GO:0004753
GO:0005737
GO:0019878

Map