F379934

General Info

Members Datasets Scaffolds Average Seq Length
274 197 548 329

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0079195|Ga0495603_0079195_205_1353
Length 382
Sequence MDQVSASLTCLSKKNGFLGAFDAKGKCIPTTRNRSNLPDARSKFEEETMQHNIASGCRKITRRTMLGAAAAIAAVPAMAEECRVGPPPHHKGPLVFMDYDQVELDASYDQEVYEPLIGQVVKRLASNSEAVRARIGAPQRFAYGPTEIEKLDVYRTNRAKAPIFVFIHGGNWLVGSAKDSGYPAEMFVNAGAHYVALDFTSVKEAGGDLSVMAAQVRRGIAWVYKNAASFGGDPDRVYIGGFSSGGHLCGVALVTDWQGQFSLPDNVVKGGLCMSGMYEMVPVQLSWRRTYVNFTEAMADAMSSQRHIDKLSAPIMVTYGTFETPDFQRQSRDFAAAIKAAGKPVQLIETPNYAHVEMAESLGNPYGPNGRASLALMKLSPS

Samples

Sample ID Description Type Environment
1 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
83 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
84 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
86 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
88 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
89 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
90 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
91 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
92 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
93 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
94 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
95 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
96 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
132 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
139 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
191 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
194 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.82
Nodule 0
Rhizoplane 6.93
Rhizosphere 89.78
Stem 0
Stem Tuber 0
Unclassified 4.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495603_0079195 3300046455 Bacteria 1926
2 Ga0070690_100073912 3300005330 Bacteria 2219
3 Ga0070670_100285404 3300005331 Bacteria 1442
4 Ga0070660_100299050 3300005339 Bacteria 1319
5 Ga0070689_100117454 3300005340 Bacteria 2122
6 Ga0070669_100336174 3300005353 Bacteria 1223
7 Ga0070674_100201890 3300005356 Bacteria 1536
8 Ga0070673_100001534 3300005364 Bacteria 13599
9 Ga0070688_100007309 3300005365 Bacteria 5949
10 Ga0070688_100066700 3300005365 Bacteria 2291
11 Ga0070667_100151571 3300005367 Bacteria 2037
12 Ga0070709_10023623 3300005434 Bacteria 3613
13 Ga0070714_100006313 3300005435 Bacteria 9137
14 Ga0070714_100089889 3300005435 Bacteria 2689
15 Ga0070713_100004655 3300005436 Bacteria 9259
16 Ga0070713_100082467 3300005436 Bacteria 2746
17 Ga0070713_100413323 3300005436 Bacteria 1262
18 Ga0070710_10000896 3300005437 Bacteria 14247
19 Ga0070711_100013859 3300005439 Bacteria 5072
20 Ga0070700_100228803 3300005441 Bacteria 1322
21 Ga0070694_100026621 3300005444 Bacteria 3750
22 Ga0070678_100050387 3300005456 Bacteria 3012
23 Ga0070681_10156465 3300005458 Bacteria 2204
24 Ga0070685_10172772 3300005466 Bacteria 1386
25 Ga0070706_100044196 3300005467 Bacteria 4115
26 Ga0070706_100052301 3300005467 Bacteria 3770
27 Ga0070706_100493396 3300005467 Bacteria 1139
28 Ga0070707_100026406 3300005468 Bacteria 5513
29 Ga0070698_100054415 3300005471 Bacteria 4062
30 Ga0070679_100006790 3300005530 Bacteria 10675
31 Ga0070679_100148332 3300005530 Bacteria 2323
32 Ga0070697_100033523 3300005536 Bacteria 4136
33 Ga0070672_100089648 3300005543 Bacteria 2478
34 Ga0070672_100134001 3300005543 Bacteria 2039
35 Ga0070665_100152438 3300005548 Bacteria 2314
36 Ga0070665_100448386 3300005548 Bacteria 1300
37 Ga0068855_100641200 3300005563 Unclassified 1142
38 Ga0081540_1001051 3300005983 Bacteria 24615
39 Ga0070717_10030294 3300006028 Bacteria 4347
40 Ga0070717_10089340 3300006028 Bacteria 2599
41 Ga0070717_10371783 3300006028 Bacteria 1281
42 Ga0070715_10000456 3300006163 Bacteria 10562
43 Ga0070716_100039618 3300006173 Bacteria 2616
44 Ga0070712_100052084 3300006175 Bacteria 2853
45 Ga0070712_100236813 3300006175 Bacteria 1452
46 Ga0075428_100025608 3300006844 Bacteria 6533
47 Ga0075431_100028340 3300006847 Bacteria 5753
48 Ga0075434_100389736 3300006871 Bacteria 1414
49 Ga0068865_100201597 3300006881 Bacteria 1545
50 Ga0075436_100142161 3300006914 Bacteria 1687
51 Ga0075435_100137046 3300007076 Bacteria 2051
52 Ga0075435_100247354 3300007076 Bacteria 1517
53 Ga0105247_10065173 3300009101 Bacteria 2265
54 Ga0114129_10180454 3300009147 Unclassified 2873
55 Ga0105241_10074647 3300009174 Bacteria 2641
56 Ga0105249_10363557 3300009553 Bacteria 1469
57 Ga0099796_10000903 3300010159 Bacteria 5511
58 Ga0099796_10005259 3300010159 Bacteria 3215
59 Ga0157370_10120990 3300013104 Bacteria 2444
60 Ga0157369_10357602 3300013105 Bacteria 1516
61 Ga0157378_10077493 3300013297 Bacteria 2997
62 Ga0163162_10084267 3300013306 Bacteria 3254
63 Ga0163163_10012754 3300014325 Bacteria 7667
64 Ga0163163_10227019 3300014325 Bacteria 1916
65 Ga0163163_10292576 3300014325 Bacteria 1681
66 Ga0157380_10053755 3300014326 Bacteria 3194
67 Ga0213872_10088221 3300021361 Bacteria 1389
68 Ga0213876_10131247 3300021384 Bacteria 1331
69 Ga0207692_10002872 3300025898 Bacteria 6666
70 Ga0207692_10060087 3300025898 Unclassified 1964
71 Ga0207685_10000267 3300025905 Bacteria 8260
72 Ga0207699_10020815 3300025906 Bacteria 3523
73 Ga0207684_10006027 3300025910 Bacteria 11090
74 Ga0207684_10037983 3300025910 Bacteria 4086
75 Ga0207707_10153459 3300025912 Bacteria 2013
76 Ga0207693_10000326 3300025915 Bacteria 44051
77 Ga0207693_10164514 3300025915 Bacteria 1746
78 Ga0207693_10210715 3300025915 Bacteria 1527
79 Ga0207693_10237363 3300025915 Bacteria 1431
80 Ga0207663_10000225 3300025916 Bacteria 25184
81 Ga0207652_10105688 3300025921 Bacteria 2491
82 Ga0207652_10201581 3300025921 Bacteria 1790
83 Ga0207646_10085016 3300025922 Bacteria 2830
84 Ga0207681_10023923 3300025923 Bacteria 3914
85 Ga0207681_10165995 3300025923 Bacteria 1669
86 Ga0207650_10163875 3300025925 Bacteria 1763
87 Ga0207659_10064420 3300025926 Bacteria 2652
88 Ga0207687_10173079 3300025927 Bacteria 1667
89 Ga0207700_10023892 3300025928 Bacteria 4224
90 Ga0207700_10065344 3300025928 Bacteria 2775
91 Ga0207644_10002191 3300025931 Bacteria 12666
92 Ga0207670_10002897 3300025936 Bacteria 9063
93 Ga0207670_10024483 3300025936 Bacteria 3773
94 Ga0207669_10137539 3300025937 Bacteria 1690
95 Ga0207704_10037651 3300025938 Bacteria 2796
96 Ga0207665_10001364 3300025939 Bacteria 16457
97 Ga0207665_10082666 3300025939 Bacteria 2213
98 Ga0207665_10096272 3300025939 Bacteria 2058
99 Ga0207689_10029373 3300025942 Bacteria 4592
100 Ga0207661_10042658 3300025944 Bacteria 3577
101 Ga0207667_10019875 3300025949 Bacteria 7483
102 Ga0207651_10108986 3300025960 Bacteria 2074
103 Ga0207658_10141864 3300025986 Bacteria 1945
104 Ga0207658_10472808 3300025986 Bacteria 1113
105 Ga0207648_10073006 3300026089 Bacteria 2990
106 Ga0207648_10211115 3300026089 Bacteria 1723
107 Ga0207675_100075617 3300026118 Bacteria 3153
108 Ga0268266_10072656 3300028379 Bacteria 2984
109 Ga0265325_10000875 3300031241 Bacteria 21734
110 Ga0265316_10154307 3300031344 Bacteria 1719
111 Ga0373926_0082503 3300035083 Unclassified 1190
112 Ga0373949_0025302 3300035090 Bacteria 1384
113 Ga0373923_0000433 3300035111 Bacteria 9837
114 Ga0373932_0013069 3300035112 Bacteria 2058
115 Ga0373936_0010995 3300035113 Bacteria 3420
116 Ga0373939_0018178 3300035114 Bacteria 1879
117 Ga0373941_0067970 3300035115 Unclassified 1176
118 Ga0373945_0014909 3300035116 Bacteria 2609
119 Ga0373953_0007398 3300035117 Bacteria 3675
120 Ga0373954_0002680 3300035118 Bacteria 7491
121 Ga0373957_0097394 3300035120 Bacteria 1175
122 Ga0373943_0008583 3300035170 Bacteria 4581
123 Ga0373946_0000730 3300035171 Bacteria 11165
124 Ga0373946_0028759 3300035171 Unclassified 2207
125 Ga0373955_0000177 3300035172 Bacteria 26296
126 Ga0373955_0073805 3300035172 Bacteria 1913
127 Ga0373924_0003229 3300035410 Bacteria 5579
128 Ga0373931_0035388 3300035691 Bacteria 2596
129 Ga0373935_0000018 3300035692 Bacteria 68811
130 Ga0373927_0023224 3300035695 Bacteria 4063
131 Ga0373927_0060768 3300035695 Unclassified 2445
132 Ga0373933_0013156 3300035724 Bacteria 4583
133 Ga0373947_0000264 3300035725 Bacteria 29727
134 Ga0373947_0125521 3300035725 Unclassified 1634
135 Ga0373937_0000054 3300036401 Bacteria 102542
136 Ga0373937_0002369 3300036401 Bacteria 15690
137 Ga0373937_0185976 3300036401 Bacteria 1951
138 Ga0373925_0000018 3300037068 Bacteria 174213
139 Ga0436364_0998443 3300037853 Bacteria 1983
140 Ga0436365_0301032 3300039437 Bacteria 3656
141 Ga0436365_0310535 3300039437 Unclassified 1329
142 Ga0436360_0465246 3300039438 Bacteria 1029
143 Ga0436361_0800326 3300039447 Bacteria 7977
144 Ga0436361_1093397 3300039447 Bacteria 3533
145 Ga0466966_0117706 3300044684 Unclassified 1634
146 Ga0466963_0335369 3300044694 Bacteria 1065
147 Ga0466957_0145459 3300044842 Bacteria 1530
148 Ga0451576_0069995 3300045051 Bacteria 3651
149 Ga0466958_0202671 3300045836 Bacteria 1263
150 Ga0495592_0000001 3300046454 Bacteria 305819
151 Ga0495592_0018570 3300046454 Bacteria 5291
152 Ga0495592_0218120 3300046454 Bacteria 1277
153 Ga0495603_0053857 3300046455 Bacteria 2386
154 Ga0495629_0028626 3300046459 Bacteria 3954
155 Ga0495638_0037151 3300046460 Bacteria 3099
156 Ga0495638_0062149 3300046460 Bacteria 2306
157 Ga0495641_0048717 3300046461 Bacteria 1942
158 Ga0495651_0001812 3300046462 Bacteria 16489
159 Ga0495653_0000015 3300046463 Bacteria 213697
160 Ga0495582_0009782 3300046473 Bacteria 5282
161 Ga0495605_0019754 3300046474 Bacteria 3593
162 Ga0495662_0008305 3300046476 Bacteria 5109
163 Ga0495664_0000001 3300046477 Bacteria 757730
164 Ga0495664_0212402 3300046477 Bacteria 1172
165 Ga0495585_0155681 3300046492 Bacteria 1189
166 Ga0495608_0000116 3300046511 Bacteria 56633
167 Ga0495608_0021474 3300046511 Bacteria 4430
168 Ga0495618_0000021 3300046514 Bacteria 129750
169 Ga0495628_0000005 3300046516 Bacteria 420969
170 Ga0495652_0000001 3300046529 Bacteria 1045081
171 Ga0495652_0005453 3300046529 Bacteria 11983
172 Ga0495640_0000006 3300046533 Bacteria 285419
173 Ga0495640_0080415 3300046533 Unclassified 2167
174 Ga0495586_0148204 3300046535 Bacteria 1319
175 Ga0495587_0000012 3300046536 Bacteria 197088
176 Ga0495598_0039218 3300046537 Bacteria 1376
177 Ga0495598_0040701 3300046537 Bacteria 1356
178 Ga0495621_0041669 3300046539 Bacteria 1613
179 Ga0495645_0000004 3300046543 Bacteria 532661
180 Ga0495645_0003872 3300046543 Bacteria 10192
181 Ga0495667_0000001 3300046559 Bacteria 834831
182 Ga0495667_0049733 3300046559 Bacteria 2767
183 Ga0495656_0069721 3300046615 Bacteria 1558
184 Ga0495634_0000388 3300046642 Bacteria 42999
185 Ga0495635_0000007 3300046663 Bacteria 278786
186 Ga0495659_0060010 3300046664 Bacteria 1402
187 Ga0495588_0019857 3300046674 Bacteria 3296
188 Ga0495657_0000250 3300046675 Bacteria 48717
189 Ga0495599_0000002 3300046678 Bacteria 348168
190 Ga0495599_0005784 3300046678 Bacteria 7421
191 Ga0495599_0267313 3300046678 Bacteria 1038
192 Ga0495623_0000116 3300046679 Bacteria 48662
193 Ga0495623_0090556 3300046679 Bacteria 1878
194 Ga0495646_0000049 3300046680 Bacteria 60856
195 Ga0495646_0015749 3300046680 Bacteria 4799
196 Ga0495658_0054562 3300046683 Bacteria 2274
197 Ga0495613_0060999 3300046689 Bacteria 2762
198 Ga0495624_0015643 3300046690 Bacteria 5116
199 Ga0495624_0117013 3300046690 Unclassified 1637
200 Ga0495600_0000344 3300046809 Bacteria 24778
201 Ga0495581_0023497 3300047315 Bacteria 3572
202 Ga0495604_0000007 3300047317 Bacteria 412174
203 Ga0495604_0039140 3300047317 Bacteria 3727
204 Ga0495604_0184225 3300047317 Bacteria 1459
205 Ga0495604_0224725 3300047317 Bacteria 1291
206 Ga0495674_0000001 3300047319 Bacteria 778665
207 Ga0495674_0001585 3300047319 Bacteria 22283
208 Ga0495674_0424372 3300047319 Bacteria 1071
209 Ga0495676_0051377 3300047321 Bacteria 3299
210 Ga0495680_0001759 3300047322 Bacteria 22952
211 Ga0495675_0001296 3300047444 Bacteria 15160
212 Ga0495675_0001879 3300047444 Bacteria 12511
213 Ga0495685_078017 3300047447 Bacteria 1105
214 Ga0495684_0000046 3300047471 Bacteria 92658
215 Ga0495593_0000935 3300047673 Bacteria 17005
216 Ga0495602_0000004 3300048088 Bacteria 326932
217 Ga0495602_0048443 3300048088 Bacteria 3819
218 Ga0496100_0086223 3300048903 Bacteria 2132
219 Ga0496101_0328043 3300048904 Bacteria 1201
220 Ga0496102_0181323 3300048905 Bacteria 1984
221 Ga0496104_0099078 3300048907 Bacteria 2790
222 Ga0496106_0039858 3300048909 Bacteria 3517
223 Ga0496106_0162658 3300048909 Bacteria 1766
224 Ga0496106_0205293 3300048909 Bacteria 1569
225 Ga0496107_0074018 3300048910 Bacteria 2478
226 Ga0496108_0156713 3300048911 Bacteria 1967
227 Ga0496109_0125400 3300048912 Bacteria 2394
228 Ga0496109_0180819 3300048912 Bacteria 1981
229 Ga0496111_0172807 3300048914 Bacteria 1606
230 Ga0496112_0049251 3300048915 Bacteria 4130
231 Ga0496112_0198846 3300048915 Bacteria 1964
232 Ga0496114_0004487 3300048917 Bacteria 10832
233 Ga0496114_0026252 3300048917 Bacteria 4767
234 Ga0496115_0011930 3300048918 Bacteria 6525
235 Ga0496115_0018825 3300048918 Bacteria 5309
236 Ga0496115_0082775 3300048918 Bacteria 2615
237 Ga0501039_0031224 3300049575 Bacteria 4106
238 Ga0501046_0240540 3300049580 Bacteria 1335
239 Ga0501047_0004391 3300049581 Bacteria 13273
240 Ga0501068_0067265 3300049584 Bacteria 2183
241 Ga0501070_0026577 3300049586 Bacteria 4856
242 Ga0501071_0010033 3300049587 Bacteria 6331
243 Ga0501072_0024878 3300049588 Bacteria 4662
244 Ga0501074_0276954 3300049590 Bacteria 1193
245 Ga0501076_0054217 3300049592 Bacteria 3177
246 Ga0501079_0043043 3300049741 Bacteria 3486
247 Ga0501080_0025040 3300049742 Bacteria 5537
248 Ga0501081_0143017 3300049743 Bacteria 1715
249 Ga0501035_0058055 3300049822 Bacteria 3449
250 Ga0501044_0330742 3300049823 Bacteria 1446
251 nmdc:mga07m45_123952_c1 3300050496 Bacteria 1493
252 nmdc:mga06r32_8801_c1 3300050510 Bacteria 9097
253 nmdc:mga0n895_54988_c1 3300050512 Bacteria 3916
254 nmdc:mga0rr50_254323_c1 3300050513 Bacteria 1460
255 nmdc:mga0rr50_34566_c1 3300050513 Bacteria 3620
256 nmdc:mga08x19_143224_c1 3300050514 Bacteria 1615
257 Ga0495601_0000006 3300053077 Bacteria 373770
258 Ga0495601_0004063 3300053077 Bacteria 8436
259 Ga0495601_0063220 3300053077 Bacteria 2352
260 Ga0495601_0176437 3300053077 Bacteria 1397
261 Ga0495612_0000004 3300053078 Bacteria 286946
262 Ga0495612_0003675 3300053078 Bacteria 6364
263 Ga0495595_0000006 3300053084 Bacteria 231295
264 Ga0495619_0000240 3300053085 Bacteria 39732
265 Ga0495619_0000668 3300053085 Bacteria 22510
266 Ga0495619_0002929 3300053085 Bacteria 11096
267 Ga0495619_0007609 3300053085 Bacteria 6861
268 Ga0500658_0020124 3300053134 Bacteria 2517
269 Ga0500604_0010252 3300053151 Bacteria 2503
270 Ga0500604_0039491 3300053151 Bacteria 1420
271 Ga0500616_0000001 3300053153 Bacteria 1986011
272 Ga0501082_0152191 3300060353 Bacteria 2010
273 Ga0501082_0230367 3300060353 Bacteria 1612
274 Ga0530510_0048235 3300061734 Unclassified 3078
275 Ga0495603_0079195
276 Ga0070690_100073912
277 Ga0070670_100285404
278 Ga0070660_100299050
279 Ga0070689_100117454
280 Ga0070669_100336174
281 Ga0070674_100201890
282 Ga0070673_100001534
283 Ga0070688_100007309
284 Ga0070688_100066700
285 Ga0070667_100151571
286 Ga0070709_10023623
287 Ga0070714_100006313
288 Ga0070714_100089889
289 Ga0070713_100004655
290 Ga0070713_100082467
291 Ga0070713_100413323
292 Ga0070710_10000896
293 Ga0070711_100013859
294 Ga0070700_100228803
295 Ga0070694_100026621
296 Ga0070678_100050387
297 Ga0070681_10156465
298 Ga0070685_10172772
299 Ga0070706_100044196
300 Ga0070706_100052301
301 Ga0070706_100493396
302 Ga0070707_100026406
303 Ga0070698_100054415
304 Ga0070679_100006790
305 Ga0070679_100148332
306 Ga0070697_100033523
307 Ga0070672_100089648
308 Ga0070672_100134001
309 Ga0070665_100152438
310 Ga0070665_100448386
311 Ga0068855_100641200
312 Ga0081540_1001051
313 Ga0070717_10030294
314 Ga0070717_10089340
315 Ga0070717_10371783
316 Ga0070715_10000456
317 Ga0070716_100039618
318 Ga0070712_100052084
319 Ga0070712_100236813
320 Ga0075428_100025608
321 Ga0075431_100028340
322 Ga0075434_100389736
323 Ga0068865_100201597
324 Ga0075436_100142161
325 Ga0075435_100137046
326 Ga0075435_100247354
327 Ga0105247_10065173
328 Ga0114129_10180454
329 Ga0105241_10074647
330 Ga0105249_10363557
331 Ga0099796_10000903
332 Ga0099796_10005259
333 Ga0157370_10120990
334 Ga0157369_10357602
335 Ga0157378_10077493
336 Ga0163162_10084267
337 Ga0163163_10012754
338 Ga0163163_10227019
339 Ga0163163_10292576
340 Ga0157380_10053755
341 Ga0213872_10088221
342 Ga0213876_10131247
343 Ga0207692_10002872
344 Ga0207692_10060087
345 Ga0207685_10000267
346 Ga0207699_10020815
347 Ga0207684_10006027
348 Ga0207684_10037983
349 Ga0207707_10153459
350 Ga0207693_10000326
351 Ga0207693_10164514
352 Ga0207693_10210715
353 Ga0207693_10237363
354 Ga0207663_10000225
355 Ga0207652_10105688
356 Ga0207652_10201581
357 Ga0207646_10085016
358 Ga0207681_10023923
359 Ga0207681_10165995
360 Ga0207650_10163875
361 Ga0207659_10064420
362 Ga0207687_10173079
363 Ga0207700_10023892
364 Ga0207700_10065344
365 Ga0207644_10002191
366 Ga0207670_10002897
367 Ga0207670_10024483
368 Ga0207669_10137539
369 Ga0207704_10037651
370 Ga0207665_10001364
371 Ga0207665_10082666
372 Ga0207665_10096272
373 Ga0207689_10029373
374 Ga0207661_10042658
375 Ga0207667_10019875
376 Ga0207651_10108986
377 Ga0207658_10141864
378 Ga0207658_10472808
379 Ga0207648_10073006
380 Ga0207648_10211115
381 Ga0207675_100075617
382 Ga0268266_10072656
383 Ga0265325_10000875
384 Ga0265316_10154307
385 Ga0373926_0082503
386 Ga0373949_0025302
387 Ga0373923_0000433
388 Ga0373932_0013069
389 Ga0373936_0010995
390 Ga0373939_0018178
391 Ga0373941_0067970
392 Ga0373945_0014909
393 Ga0373953_0007398
394 Ga0373954_0002680
395 Ga0373957_0097394
396 Ga0373943_0008583
397 Ga0373946_0000730
398 Ga0373946_0028759
399 Ga0373955_0000177
400 Ga0373955_0073805
401 Ga0373924_0003229
402 Ga0373931_0035388
403 Ga0373935_0000018
404 Ga0373927_0023224
405 Ga0373927_0060768
406 Ga0373933_0013156
407 Ga0373947_0000264
408 Ga0373947_0125521
409 Ga0373937_0000054
410 Ga0373937_0002369
411 Ga0373937_0185976
412 Ga0373925_0000018
413 Ga0436364_0998443
414 Ga0436365_0301032
415 Ga0436365_0310535
416 Ga0436360_0465246
417 Ga0436361_0800326
418 Ga0436361_1093397
419 Ga0466966_0117706
420 Ga0466963_0335369
421 Ga0466957_0145459
422 Ga0451576_0069995
423 Ga0466958_0202671
424 Ga0495592_0000001
425 Ga0495592_0018570
426 Ga0495592_0218120
427 Ga0495603_0053857
428 Ga0495629_0028626
429 Ga0495638_0037151
430 Ga0495638_0062149
431 Ga0495641_0048717
432 Ga0495651_0001812
433 Ga0495653_0000015
434 Ga0495582_0009782
435 Ga0495605_0019754
436 Ga0495662_0008305
437 Ga0495664_0000001
438 Ga0495664_0212402
439 Ga0495585_0155681
440 Ga0495608_0000116
441 Ga0495608_0021474
442 Ga0495618_0000021
443 Ga0495628_0000005
444 Ga0495652_0000001
445 Ga0495652_0005453
446 Ga0495640_0000006
447 Ga0495640_0080415
448 Ga0495586_0148204
449 Ga0495587_0000012
450 Ga0495598_0039218
451 Ga0495598_0040701
452 Ga0495621_0041669
453 Ga0495645_0000004
454 Ga0495645_0003872
455 Ga0495667_0000001
456 Ga0495667_0049733
457 Ga0495656_0069721
458 Ga0495634_0000388
459 Ga0495635_0000007
460 Ga0495659_0060010
461 Ga0495588_0019857
462 Ga0495657_0000250
463 Ga0495599_0000002
464 Ga0495599_0005784
465 Ga0495599_0267313
466 Ga0495623_0000116
467 Ga0495623_0090556
468 Ga0495646_0000049
469 Ga0495646_0015749
470 Ga0495658_0054562
471 Ga0495613_0060999
472 Ga0495624_0015643
473 Ga0495624_0117013
474 Ga0495600_0000344
475 Ga0495581_0023497
476 Ga0495604_0000007
477 Ga0495604_0039140
478 Ga0495604_0184225
479 Ga0495604_0224725
480 Ga0495674_0000001
481 Ga0495674_0001585
482 Ga0495674_0424372
483 Ga0495676_0051377
484 Ga0495680_0001759
485 Ga0495675_0001296
486 Ga0495675_0001879
487 Ga0495685_078017
488 Ga0495684_0000046
489 Ga0495593_0000935
490 Ga0495602_0000004
491 Ga0495602_0048443
492 Ga0496100_0086223
493 Ga0496101_0328043
494 Ga0496102_0181323
495 Ga0496104_0099078
496 Ga0496106_0039858
497 Ga0496106_0162658
498 Ga0496106_0205293
499 Ga0496107_0074018
500 Ga0496108_0156713
501 Ga0496109_0125400
502 Ga0496109_0180819
503 Ga0496111_0172807
504 Ga0496112_0049251
505 Ga0496112_0198846
506 Ga0496114_0004487
507 Ga0496114_0026252
508 Ga0496115_0011930
509 Ga0496115_0018825
510 Ga0496115_0082775
511 Ga0501039_0031224
512 Ga0501046_0240540
513 Ga0501047_0004391
514 Ga0501068_0067265
515 Ga0501070_0026577
516 Ga0501071_0010033
517 Ga0501072_0024878
518 Ga0501074_0276954
519 Ga0501076_0054217
520 Ga0501079_0043043
521 Ga0501080_0025040
522 Ga0501081_0143017
523 Ga0501035_0058055
524 Ga0501044_0330742
525 nmdc:mga07m45_123952_c1
526 nmdc:mga06r32_8801_c1
527 nmdc:mga0n895_54988_c1
528 nmdc:mga0rr50_254323_c1
529 nmdc:mga0rr50_34566_c1
530 nmdc:mga08x19_143224_c1
531 Ga0495601_0000006
532 Ga0495601_0004063
533 Ga0495601_0063220
534 Ga0495601_0176437
535 Ga0495612_0000004
536 Ga0495612_0003675
537 Ga0495595_0000006
538 Ga0495619_0000240
539 Ga0495619_0000668
540 Ga0495619_0002929
541 Ga0495619_0007609
542 Ga0500658_0020124
543 Ga0500604_0010252
544 Ga0500604_0039491
545 Ga0500616_0000001
546 Ga0501082_0152191
547 Ga0501082_0230367
548 Ga0530510_0048235

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20434

BD-FAE

BD-FAE

151

271

0.86

PF00135

COesterase

Carboxylesterase family

149

306

0.77

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

164

359

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pbl-assembly4.cif.gz_D crystal structure of a putative thioesterase (tm1040_2492) from silicibacter sp. tm1040 at 1.79 a resolution 0.9164 50 325
2pbl-assembly4.cif.gz_D crystal structure of a putative thioesterase (tm1040_2492) from silicibacter sp. tm1040 at 1.79 a resolution 0.9032 50 325
4e11-assembly1.cif.gz_A crystal structure of kynurenine formamidase from drosophila melanogaster 0.8685 51 323
4e14-assembly1.cif.gz_A crystal structure of kynurenine formamidase conjugated with phenylmethylsulfonyl fluoride 0.8616 62 323
3wyd-assembly1.cif.gz_B c-terminal esterase domain of lc-est1 0.8252 98 325
ID Description Score Start End Superfamily
af_Q566U4_36_288_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.912 71 321 3.40.50.1820
2pblC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9089 69 325 3.40.50.1820
af_Q566U4_36_288_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8981 71 321 3.40.50.1820
af_Q63HM1_47_299_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8976 71 321 3.40.50.1820
2pblC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8944 69 325 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1F9KEI6-F1-model_v4 BD-FAE-like domain-containing protein 0.9964 68 327 GO:0016787
AF-A0A536X300-F1-model_v4 Alpha/beta hydrolase 0.9917 98 327 GO:0016787
AF-A0A5S4ZIF3-F1-model_v4 deleted 0.9849 42 325
AF-A0A800IIK4-F1-model_v4 Carboxylic ester hydrolase (EC 3.1.1.-) 0.9833 168 327 GO:0016787
AF-A0A1E3Z6R5-F1-model_v4 deleted 0.975 36 327

Map