F379955

General Info

Members Datasets Scaffolds Average Seq Length
274 188 244 378

Family's Representative Sequence

Representative Sequence 3300046522|Ga0495643_0009800|Ga0495643_0009800_871_2145
Length 424
Sequence MSGIPICASDYKISLFDKMSTHFYPDISRPSRAEAILSRSKLEKLVMPVLPDFKLETYFSKWEFTARYHMTASDAQSMTMEELLAIGSEEQQAAFKSQWLGYTETFGDPELRETIAGLYEQMQSADILCFAGAGEGIYIAMHVLLEKGDHAIVVTPNYQSAETVPLSICEVSGVALDPADGWSLDIDAVRAAIRPNTKLISINFPHNPTGKILERDRFDALVELCRQHGIWLFSDEVYRGLSIDGKPQLPAAADVYERGLSLAVTSKAYGLPGLRIGWIACRDHSVISRMERMKHYISICNAAPSESLAKIALQNAGGILERNNRLIATNLGKLKALFAEFEGLFEWYTPDGGCVGYPRYKGADGVENFARNLVESAGVLLLPASIYRSELNPTPDNRFRIGFGRANIEEGIAAMRSYLLRNGQ

Samples

Sample ID Description Type Environment
1 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
2 2558860280 Kutzneria sp. 744 Isolate Unclassified
3 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
4 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
5 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
6 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
7 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
8 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
9 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
10 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
11 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
12 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
13 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
14 2643221718 Rhizobium sp. Root268 Isolate Unclassified
15 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
16 2734482264 Dyella sp. AD052 Isolate Unclassified
17 2738543009 Luteibacter sp. OK325 Isolate Unclassified
18 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
19 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
20 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
21 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
22 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
23 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
24 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
25 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
26 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
27 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
28 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
29 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
30 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
31 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
32 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
33 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
34 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
35 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
36 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
37 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
38 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
66 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
71 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
90 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
100 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
101 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
102 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
111 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
114 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
115 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
118 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
121 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
122 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
123 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
124 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
125 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
126 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
129 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
130 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
136 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
137 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
140 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
144 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
147 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
159 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
160 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
161 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
162 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
170 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
174 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
175 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
176 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
177 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
178 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
179 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
180 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
181 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
182 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
183 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
184 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
185 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
187 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
188 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.05
Metatranscriptomes 0
Isolates 10.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.5
Nodule 2.55
Rhizoplane 6.93
Rhizosphere 54.74
Stem 0
Stem Tuber 0
Unclassified 22.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10015181 3300001989 Bacteria 2799
2 JGI24737J22298_10014449 3300001990 Bacteria 2563
3 JGI25162J39368_1000489 3300002737 Bacteria 30241
4 JGI25159J45721_1005217 3300002987 Bacteria 4113
5 JGI25151J46595_10000296 3300003187 Bacteria 55085
6 JGI25165J46597_1001070 3300003214 Bacteria 17582
7 rootH1_10018080 3300003323 Bacteria 2433
8 JGI25160J50197_1000026 3300003354 Bacteria 184693
9 JGI25160J50197_1008564 3300003354 Bacteria 3887
10 JGI25161J50226_1000014 3300003374 Bacteria 191109
11 Ga0055543_1000052 3300004625 Bacteria 104887
12 Ga0065165_1000073 3300005262 Bacteria 164910
13 Ga0070661_100087778 3300005344 Bacteria 2301
14 Ga0070692_10000065 3300005345 Bacteria 20952
15 Ga0070668_100069264 3300005347 Bacteria 2744
16 Ga0070667_100088704 3300005367 Bacteria 2656
17 Ga0070714_100167869 3300005435 Bacteria 1990
18 Ga0070711_100007476 3300005439 Bacteria 6648
19 Ga0068853_100271256 3300005539 Bacteria 1562
20 Ga0070665_100010808 3300005548 Bacteria 9231
21 Ga0068857_100168195 3300005577 Bacteria 1992
22 Ga0068854_100113803 3300005578 Bacteria 2044
23 Ga0081540_1000679 3300005983 Bacteria 31898
24 Ga0081539_10041530 3300005985 Bacteria 2687
25 Ga0075366_10147713 3300006195 Bacteria 1423
26 Ga0075430_100000621 3300006846 Bacteria 27076
27 Ga0105250_10081719 3300009092 Bacteria 1310
28 Ga0105240_10000217 3300009093 Bacteria 115649
29 Ga0105240_10018036 3300009093 Bacteria 9492
30 Ga0105240_10059421 3300009093 Bacteria 4771
31 Ga0111539_10000520 3300009094 Bacteria 48692
32 Ga0105237_10001458 3300009545 Bacteria 31192
33 Ga0105237_10078381 3300009545 Bacteria 3294
34 Ga0105238_10125998 3300009551 Bacteria 2539
35 Ga0105249_10307985 3300009553 Bacteria 1591
36 Ga0105239_10001164 3300010375 Bacteria 36154
37 Ga0157370_10000768 3300013104 Bacteria 40191
38 Ga0157369_10000432 3300013105 Bacteria 55626
39 Ga0157369_10147378 3300013105 Bacteria 2488
40 Ga0163162_10000456 3300013306 Bacteria 37890
41 Ga0163162_10003670 3300013306 Bacteria 14721
42 Ga0157375_10007550 3300013308 Bacteria 9509
43 Ga0182006_1000061 3300015261 Bacteria 156823
44 Ga0182005_1001969 3300015265 Bacteria 7711
45 Ga0182005_1023016 3300015265 Bacteria 1705
46 Ga0182005_1023098 3300015265 Bacteria 1702
47 Ga0163161_10000525 3300017792 Bacteria 31276
48 Ga0163161_10012887 3300017792 Bacteria 5809
49 Ga0213875_10032885 3300021388 Bacteria 2450
50 Ga0209436_104207 3300025208 Bacteria 3606
51 Ga0209437_100042 3300025233 Bacteria 444095
52 Ga0209677_100295 3300025253 Bacteria 32620
53 Ga0209759_1004053 3300025256 Bacteria 5606
54 Ga0209233_1000103 3300025261 Bacteria 284123
55 Ga0209233_1000288 3300025261 Bacteria 66882
56 Ga0209130_1000121 3300025284 Bacteria 127462
57 Ga0209130_1000462 3300025284 Bacteria 42249
58 Ga0209025_1000408 3300025294 Bacteria 86719
59 Ga0209758_1006423 3300025297 Bacteria 8457
60 Ga0207426_1000066 3300025302 Bacteria 351182
61 Ga0207426_1000075 3300025302 Bacteria 321337
62 Ga0207426_1003499 3300025302 Bacteria 8461
63 Ga0207695_10000613 3300025913 Bacteria 71568
64 Ga0207695_10039775 3300025913 Bacteria 5051
65 Ga0207671_10001160 3300025914 Bacteria 31428
66 Ga0207663_10019103 3300025916 Bacteria 3853
67 Ga0207694_10124851 3300025924 Bacteria 2058
68 Ga0207664_10213625 3300025929 Bacteria 1670
69 Ga0207712_10213853 3300025961 Bacteria 1537
70 Ga0207640_10128500 3300025981 Bacteria 1828
71 Ga0207698_10117727 3300026142 Bacteria 2242
72 Ga0207428_10000059 3300027907 Bacteria 156543
73 Ga0268266_10058524 3300028379 Bacteria 3318
74 Ga0268266_10097144 3300028379 Bacteria 2590
75 Ga0307515_10058969 3300028794 Bacteria 5514
76 Ga0307512_10096461 3300030522 Bacteria 2028
77 Ga0265327_10004724 3300031251 Bacteria 11891
78 Ga0307513_10188312 3300031456 Bacteria 1918
79 Ga0307410_10054809 3300031852 Bacteria 2704
80 Ga0307510_10000002 3300033180 Bacteria 801565
81 Ga0307510_10002311 3300033180 Bacteria 21551
82 Ga0395898_0036183 3300037466 Bacteria 4903
83 Ga0436364_1076025 3300037853 Bacteria 2720
84 Ga0395901_0006076 3300038443 Bacteria 12237
85 Ga0400483_006009 3300039062 Bacteria 2647
86 Ga0400483_161158 3300039062 Bacteria 2264
87 Ga0436361_0172037 3300039447 Bacteria 1995
88 Ga0439436_0009959 3300041404 Bacteria 2907
89 Ga0451795_0133238 3300041456 Bacteria 3031
90 Ga0450908_000048 3300042184 Bacteria 24178
91 Ga0466982_0000315 3300044672 Bacteria 13392
92 Ga0466965_0043241 3300044683 Bacteria 2224
93 Ga0466966_0007986 3300044684 Bacteria 7014
94 Ga0466961_0001593 3300044693 Bacteria 14062
95 Ga0466961_0105206 3300044693 Bacteria 1777
96 Ga0466971_0019527 3300044719 Bacteria 3011
97 Ga0466971_0092995 3300044719 Bacteria 1382
98 Ga0466957_0015980 3300044842 Bacteria 4386
99 Ga0466959_0006234 3300045049 Bacteria 8243
100 Ga0466958_0016330 3300045836 Bacteria 4273
101 Ga0466958_0043407 3300045836 Bacteria 2708
102 Ga0495617_000207 3300046452 Bacteria 37214
103 Ga0495627_017554 3300046453 Bacteria 2430
104 Ga0495638_0000035 3300046460 Bacteria 276385
105 Ga0495638_0000168 3300046460 Bacteria 101864
106 Ga0495638_0000911 3300046460 Bacteria 30198
107 Ga0495650_0002957 3300046471 Bacteria 12862
108 Ga0495650_0015652 3300046471 Bacteria 3880
109 Ga0495650_0019688 3300046471 Bacteria 3312
110 Ga0495605_0001337 3300046474 Bacteria 16311
111 Ga0495605_0003209 3300046474 Bacteria 9808
112 Ga0495584_0000619 3300046491 Bacteria 23778
113 Ga0495585_0000007 3300046492 Bacteria 288113
114 Ga0495585_0006200 3300046492 Bacteria 7451
115 Ga0495607_0000174 3300046501 Bacteria 68588
116 Ga0495607_0016347 3300046501 Bacteria 4788
117 Ga0495607_0017597 3300046501 Bacteria 4582
118 Ga0495607_0018081 3300046501 Bacteria 4503
119 Ga0495583_0027443 3300046506 Bacteria 2810
120 Ga0495606_0001027 3300046507 Bacteria 40502
121 Ga0495606_0003481 3300046507 Bacteria 16679
122 Ga0495606_0021439 3300046507 Bacteria 4733
123 Ga0495610_0054790 3300046512 Bacteria 1925
124 Ga0495616_0000138 3300046513 Bacteria 63336
125 Ga0495616_0000946 3300046513 Bacteria 20895
126 Ga0495616_0017774 3300046513 Bacteria 3916
127 Ga0495616_0065785 3300046513 Unclassified 1765
128 Ga0495620_0000366 3300046515 Bacteria 31069
129 Ga0495620_0002606 3300046515 Bacteria 10431
130 Ga0495631_0000282 3300046518 Bacteria 35407
131 Ga0495631_0000359 3300046518 Bacteria 31398
132 Ga0495631_0001421 3300046518 Bacteria 14544
133 Ga0495632_0012458 3300046519 Bacteria 4904
134 Ga0495632_0013811 3300046519 Bacteria 4592
135 Ga0495637_0028181 3300046520 Bacteria 2509
136 Ga0495643_0007239 3300046522 Bacteria 7189
137 Ga0495643_0009800 3300046522 Bacteria 5927
138 Ga0495648_0000894 3300046524 Bacteria 31267
139 Ga0495648_0011553 3300046524 Bacteria 6642
140 Ga0495609_0027566 3300046538 Bacteria 2595
141 Ga0495609_0040496 3300046538 Bacteria 2097
142 Ga0495597_0062533 3300046542 Bacteria 1619
143 Ga0495622_0037362 3300046557 Bacteria 2262
144 Ga0495656_0038761 3300046615 Unclassified 1976
145 Ga0495668_0003578 3300046616 Bacteria 11535
146 Ga0495668_0006397 3300046616 Bacteria 7719
147 Ga0495611_0000018 3300046648 Bacteria 126654
148 Ga0495625_0001015 3300046660 Bacteria 37022
149 Ga0495625_0001060 3300046660 Bacteria 35944
150 Ga0495625_0007888 3300046660 Bacteria 9166
151 Ga0495659_0027163 3300046664 Unclassified 1972
152 Ga0495661_0001010 3300046665 Bacteria 25205
153 Ga0495588_0032679 3300046674 Bacteria 2623
154 Ga0495623_0035064 3300046679 Bacteria 3216
155 Ga0495670_0001565 3300046691 Bacteria 11183
156 Ga0495670_0016893 3300046691 Bacteria 3587
157 Ga0495670_0024735 3300046691 Bacteria 2969
158 Ga0495589_0004314 3300046794 Bacteria 7595
159 Ga0495660_0000125 3300046810 Bacteria 84503
160 Ga0495660_0000251 3300046810 Bacteria 51425
161 Ga0495660_0103076 3300046810 Unclassified 1466
162 Ga0495604_0004316 3300047317 Bacteria 11255
163 Ga0495636_0000052 3300047318 Bacteria 51030
164 Ga0495636_0002156 3300047318 Bacteria 7555
165 Ga0495683_0002118 3300047323 Bacteria 12270
166 Ga0495675_0009448 3300047444 Bacteria 6068
167 Ga0495673_0000004 3300047469 Bacteria 1354526
168 Ga0495673_0000133 3300047469 Bacteria 137275
169 Ga0495686_0001191 3300047472 Bacteria 30218
170 Ga0495686_0008734 3300047472 Bacteria 7393
171 Ga0495686_0059081 3300047472 Bacteria 2388
172 Ga0495602_0074666 3300048088 Bacteria 2881
173 Ga0496100_0001458 3300048903 Bacteria 11600
174 Ga0496100_0026329 3300048903 Bacteria 3565
175 Ga0496101_0006244 3300048904 Bacteria 7665
176 Ga0496101_0015284 3300048904 Bacteria 5169
177 Ga0496101_0034009 3300048904 Bacteria 3599
178 Ga0496102_0001047 3300048905 Bacteria 25637
179 Ga0496102_0001288 3300048905 Bacteria 22599
180 Ga0496102_0003597 3300048905 Bacteria 13128
181 Ga0496102_0167826 3300048905 Bacteria 2066
182 Ga0496103_0002492 3300048906 Bacteria 11548
183 Ga0496104_0192828 3300048907 Bacteria 1949
184 Ga0496105_0001071 3300048908 Bacteria 18940
185 Ga0496105_0097727 3300048908 Bacteria 2425
186 Ga0496106_0001898 3300048909 Bacteria 15647
187 Ga0496106_0045786 3300048909 Bacteria 3287
188 Ga0496107_0040052 3300048910 Bacteria 3362
189 Ga0496107_0186640 3300048910 Bacteria 1540
190 Ga0496115_0008598 3300048918 Bacteria 7559
191 Ga0496116_0004853 3300048919 Bacteria 12683
192 Ga0496117_0000054 3300048920 Bacteria 278013
193 Ga0496117_0002402 3300048920 Bacteria 23807
194 Ga0496117_0004786 3300048920 Bacteria 14671
195 Ga0496118_0000045 3300048921 Bacteria 275165
196 Ga0496118_0002113 3300048921 Bacteria 27843
197 Ga0496118_0005381 3300048921 Bacteria 14579
198 Ga0496118_0081946 3300048921 Bacteria 2263
199 Ga0496119_0001077 3300048922 Bacteria 34526
200 Ga0496119_0004967 3300048922 Bacteria 12997
201 Ga0496119_0016387 3300048922 Bacteria 5642
202 Ga0496120_0000177 3300048923 Bacteria 108260
203 Ga0496120_0004041 3300048923 Bacteria 12700
204 Ga0496120_0013049 3300048923 Bacteria 5617
205 Ga0496121_0000226 3300048924 Bacteria 121831
206 Ga0496121_0000898 3300048924 Bacteria 53787
207 Ga0496121_0001047 3300048924 Bacteria 49262
208 Ga0496121_0006476 3300048924 Bacteria 14512
209 Ga0496121_0015562 3300048924 Bacteria 7951
210 Ga0496121_0025227 3300048924 Bacteria 5649
211 Ga0496121_0087422 3300048924 Bacteria 2447
212 Ga0496121_0121641 3300048924 Bacteria 1970
213 Ga0496122_0006549 3300048925 Bacteria 13317
214 Ga0496122_0041384 3300048925 Bacteria 3644
215 Ga0496123_0004822 3300048926 Bacteria 13919
216 Ga0496123_0029968 3300048926 Bacteria 3993
217 Ga0496124_0001043 3300048927 Bacteria 43756
218 Ga0496124_0001144 3300048927 Bacteria 41610
219 Ga0496124_0005510 3300048927 Bacteria 14211
220 Ga0496125_0007481 3300048928 Bacteria 11618
221 Ga0496125_0008092 3300048928 Bacteria 11076
222 Ga0496126_0000072 3300048929 Bacteria 238130
223 Ga0496126_0028735 3300048929 Bacteria 5293
224 Ga0496126_0052926 3300048929 Bacteria 3686
225 Ga0495678_064461 3300049459 Bacteria 1364
226 Ga0495682_0000516 3300049460 Bacteria 26749
227 Ga0495682_0026934 3300049460 Bacteria 2133
228 nmdc:mga0k408_136788_c1 3300050493 Bacteria 1456
229 nmdc:mga08y16_16_c1 3300050511 Bacteria 386948
230 Ga0500578_0024163 3300053086 Bacteria 3904
231 Ga0500643_000223 3300053087 Bacteria 52940
232 Ga0500643_001642 3300053087 Bacteria 12500
233 Ga0500660_009854 3300053100 Bacteria 5126
234 Ga0500555_001026 3300053103 Bacteria 9457
235 Ga0500557_009398 3300053105 Unclassified 2393
236 Ga0500569_003522 3300053109 Bacteria 3208
237 Ga0500594_0000401 3300053118 Bacteria 9623
238 Ga0500618_003829 3300053125 Bacteria 5021
239 Ga0500658_0027969 3300053134 Bacteria 2184
240 Ga0500568_0004550 3300053139 Bacteria 7397
241 Ga0500616_0009034 3300053153 Bacteria 6103
242 Ga0500633_0003076 3300053160 Bacteria 3573
243 Ga0500645_002268 3300053730 Bacteria 8738
244 Ga0466962_0028079 3300061719 Bacteria 2697

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_10007550 Ga0157375_100075503 340
2 3300039062 Ga0400483_161158 Ga0400483_161158_33_1073 340
3 3300046519 Ga0495632_0012458 Ga0495632_0012458_24_1058 340
4 3300048903 Ga0496100_0026329 Ga0496100_0026329_36_1067 340
5 3300048909 Ga0496106_0045786 Ga0496106_0045786_15_1058 340
6 3300048924 Ga0496121_0000226 Ga0496121_0000226_34093_35346 351
7 3300028794 Ga0307515_10058969 Ga0307515_100589692 352
8 3300013306 Ga0163162_10003670 Ga0163162_1000367010 353
9 3300046522 Ga0495643_0007239 Ga0495643_0007239_1969_3126 359
10 3300046616 Ga0495668_0003578 Ga0495668_0003578_4320_5417 361
11 3300009545 Ga0105237_10078381 Ga0105237_100783813 363
12 iso_pu_bacteria 2816332119 2816422353 365
13 iso_pu_bacteria 2844533157 2844537290 366
14 iso_pu_bacteria 2558860280 2559425166 367
15 iso_pu_bacteria 2582581308 2585281253 367
16 iso_pu_bacteria 2582581315 2585327360 367
17 iso_pu_bacteria 2582581316 2585335315 367
18 iso_pu_bacteria 2585427527 2585536086 367
19 iso_pu_bacteria 2585427530 2585557397 367
20 iso_pu_bacteria 2585427608 2585896862 367
21 iso_pu_bacteria 2615840626 2616310945 367
22 iso_pu_bacteria 2617270742 2617382876 367
23 iso_pu_bacteria 2643221601 2644015784 367
24 iso_pu_bacteria 2643221631 2644175101 367
25 iso_pu_bacteria 2718218334 2721025966 367
26 iso_pu_bacteria 2734482264 2735834070 367
27 iso_pu_bacteria 2738543009 2739225481 367
28 iso_pu_bacteria 2775507266 2778175150 367
29 iso_pu_bacteria 2818991453 2819643938 367
30 iso_pu_bacteria 2821443989 2821449170 367
31 iso_pu_bacteria 2842482326 2842487530 367
32 iso_pu_bacteria 2842914999 2842917805 367
33 iso_pu_bacteria 2852387548 2852395225 367
34 iso_pu_bacteria 2861520306 2861527148 367
35 iso_pu_bacteria 2997600082 2997608532 367
36 iso_pu_bacteria 8046767195 8046769094 367
37 iso_pu_bacteria 8057575449 8057576495 367
38 3300005439 Ga0070711_100007476 Ga0070711_1000074765 368
39 3300005985 Ga0081539_10041530 Ga0081539_100415301 368
40 3300025916 Ga0207663_10019103 Ga0207663_100191033 368
41 3300041404 Ga0439436_0009959 Ga0439436_0009959_174_1301 368
42 3300048907 Ga0496104_0192828 Ga0496104_0192828_512_1627 368
43 3300048908 Ga0496105_0001071 Ga0496105_0001071_3906_5021 368
44 3300048910 Ga0496107_0186640 Ga0496107_0186640_366_1481 368
45 3300048918 Ga0496115_0008598 Ga0496115_0008598_3627_4742 368
46 iso_pu_bacteria 2513237159 2514001567 368
47 iso_pu_bacteria 2842521101 2842527166 368
48 3300005345 Ga0070692_10000065 Ga0070692_100000655 369
49 3300030522 Ga0307512_10096461 Ga0307512_100964612 369
50 3300048929 Ga0496126_0000072 Ga0496126_0000072_47638_48762 369
51 3300003187 JGI25151J46595_10000296 JGI25151J46595_1000029644 370
52 3300025294 Ga0209025_1000408 Ga0209025_10004087 370
53 3300025297 Ga0209758_1006423 Ga0209758_10064237 370
54 3300039062 Ga0400483_006009 Ga0400483_006009_914_2044 370
55 3300001989 JGI24739J22299_10015181 JGI24739J22299_100151812 371
56 3300001990 JGI24737J22298_10014449 JGI24737J22298_100144493 371
57 3300002737 JGI25162J39368_1000489 JGI25162J39368_100048920 371
58 3300002987 JGI25159J45721_1005217 JGI25159J45721_10052173 371
59 3300003214 JGI25165J46597_1001070 JGI25165J46597_10010705 371
60 3300003323 rootH1_10018080 rootH1_100180802 371
61 3300003354 JGI25160J50197_1000026 JGI25160J50197_100002687 371
62 3300003354 JGI25160J50197_1008564 JGI25160J50197_10085643 371
63 3300003374 JGI25161J50226_1000014 JGI25161J50226_1000014103 371
64 3300004625 Ga0055543_1000052 Ga0055543_100005214 371
65 3300005262 Ga0065165_1000073 Ga0065165_100007380 371
66 3300005344 Ga0070661_100087778 Ga0070661_1000877782 371
67 3300005347 Ga0070668_100069264 Ga0070668_1000692642 371
68 3300005367 Ga0070667_100088704 Ga0070667_1000887043 371
69 3300005435 Ga0070714_100167869 Ga0070714_1001678692 371
70 3300005539 Ga0068853_100271256 Ga0068853_1002712561 371
71 3300005548 Ga0070665_100010808 Ga0070665_1000108086 371
72 3300005577 Ga0068857_100168195 Ga0068857_1001681952 371
73 3300005578 Ga0068854_100113803 Ga0068854_1001138032 371
74 3300005983 Ga0081540_1000679 Ga0081540_100067916 371
75 3300006195 Ga0075366_10147713 Ga0075366_101477131 371
76 3300006846 Ga0075430_100000621 Ga0075430_1000006219 371
77 3300009092 Ga0105250_10081719 Ga0105250_100817191 371
78 3300009093 Ga0105240_10000217 Ga0105240_1000021780 371
79 3300009093 Ga0105240_10018036 Ga0105240_100180366 371
80 3300009093 Ga0105240_10059421 Ga0105240_100594211 371
81 3300009094 Ga0111539_10000520 Ga0111539_1000052041 371
82 3300009545 Ga0105237_10001458 Ga0105237_1000145812 371
83 3300009551 Ga0105238_10125998 Ga0105238_101259982 371
84 3300009553 Ga0105249_10307985 Ga0105249_103079852 371
85 3300010375 Ga0105239_10001164 Ga0105239_1000116418 371
86 3300013104 Ga0157370_10000768 Ga0157370_100007686 371
87 3300013105 Ga0157369_10000432 Ga0157369_1000043241 371
88 3300013105 Ga0157369_10147378 Ga0157369_101473783 371
89 3300013306 Ga0163162_10000456 Ga0163162_1000045636 371
90 3300015261 Ga0182006_1000061 Ga0182006_100006132 371
91 3300015265 Ga0182005_1001969 Ga0182005_10019693 371
92 3300015265 Ga0182005_1023016 Ga0182005_10230162 371
93 3300015265 Ga0182005_1023098 Ga0182005_10230982 371
94 3300017792 Ga0163161_10000525 Ga0163161_100005253 371
95 3300017792 Ga0163161_10012887 Ga0163161_100128872 371
96 3300021388 Ga0213875_10032885 Ga0213875_100328852 371
97 3300025208 Ga0209436_104207 Ga0209436_1042072 371
98 3300025233 Ga0209437_100042 Ga0209437_100042125 371
99 3300025253 Ga0209677_100295 Ga0209677_10029527 371
100 3300025256 Ga0209759_1004053 Ga0209759_10040534 371
101 3300025261 Ga0209233_1000103 Ga0209233_1000103125 371
102 3300025261 Ga0209233_1000288 Ga0209233_100028831 371
103 3300025284 Ga0209130_1000121 Ga0209130_1000121119 371
104 3300025284 Ga0209130_1000462 Ga0209130_100046231 371
105 3300025302 Ga0207426_1000066 Ga0207426_1000066245 371
106 3300025302 Ga0207426_1000075 Ga0207426_1000075119 371
107 3300025302 Ga0207426_1003499 Ga0207426_10034993 371
108 3300025913 Ga0207695_10000613 Ga0207695_1000061333 371
109 3300025913 Ga0207695_10039775 Ga0207695_100397756 371
110 3300025914 Ga0207671_10001160 Ga0207671_1000116018 371
111 3300025924 Ga0207694_10124851 Ga0207694_101248512 371
112 3300025929 Ga0207664_10213625 Ga0207664_102136251 371
113 3300025961 Ga0207712_10213853 Ga0207712_102138532 371
114 3300025981 Ga0207640_10128500 Ga0207640_101285001 371
115 3300026142 Ga0207698_10117727 Ga0207698_101177272 371
116 3300027907 Ga0207428_10000059 Ga0207428_1000005926 371
117 3300028379 Ga0268266_10058524 Ga0268266_100585244 371
118 3300028379 Ga0268266_10097144 Ga0268266_100971442 371
119 3300031251 Ga0265327_10004724 Ga0265327_100047244 371
120 3300031456 Ga0307513_10188312 Ga0307513_101883122 371
121 3300031852 Ga0307410_10054809 Ga0307410_100548092 371
122 3300033180 Ga0307510_10000002 Ga0307510_1000000225 371
123 3300033180 Ga0307510_10002311 Ga0307510_100023113 371
124 3300037466 Ga0395898_0036183 Ga0395898_0036183_812_1972 371
125 3300037853 Ga0436364_1076025 Ga0436364_1076025_862_2052 371
126 3300038443 Ga0395901_0006076 Ga0395901_0006076_3666_4826 371
127 3300039447 Ga0436361_0172037 Ga0436361_0172037_719_1855 371
128 3300041456 Ga0451795_0133238 Ga0451795_0133238_762_1895 371
129 3300042184 Ga0450908_000048 Ga0450908_000048_16831_17958 371
130 3300044672 Ga0466982_0000315 Ga0466982_0000315_6681_7808 371
131 3300044683 Ga0466965_0043241 Ga0466965_0043241_424_1647 371
132 3300044684 Ga0466966_0007986 Ga0466966_0007986_3458_4585 371
133 3300044693 Ga0466961_0001593 Ga0466961_0001593_11111_12238 371
134 3300044693 Ga0466961_0105206 Ga0466961_0105206_16_1143 371
135 3300044719 Ga0466971_0019527 Ga0466971_0019527_1267_2400 371
136 3300044719 Ga0466971_0092995 Ga0466971_0092995_25_1161 371
137 3300044842 Ga0466957_0015980 Ga0466957_0015980_120_1256 371
138 3300045049 Ga0466959_0006234 Ga0466959_0006234_1788_2915 371
139 3300045836 Ga0466958_0016330 Ga0466958_0016330_1587_2723 371
140 3300045836 Ga0466958_0043407 Ga0466958_0043407_12_1160 371
141 3300046452 Ga0495617_000207 Ga0495617_000207_10804_11931 371
142 3300046453 Ga0495627_017554 Ga0495627_017554_964_2118 371
143 3300046460 Ga0495638_0000035 Ga0495638_0000035_274052_275206 371
144 3300046460 Ga0495638_0000168 Ga0495638_0000168_64079_65221 371
145 3300046460 Ga0495638_0000911 Ga0495638_0000911_6183_7319 371
146 3300046471 Ga0495650_0002957 Ga0495650_0002957_7583_8710 371
147 3300046471 Ga0495650_0015652 Ga0495650_0015652_2470_3597 371
148 3300046471 Ga0495650_0019688 Ga0495650_0019688_1383_2519 371
149 3300046474 Ga0495605_0001337 Ga0495605_0001337_5134_6270 371
150 3300046474 Ga0495605_0003209 Ga0495605_0003209_719_1855 371
151 3300046491 Ga0495584_0000619 Ga0495584_0000619_21192_22319 371
152 3300046492 Ga0495585_0000007 Ga0495585_0000007_4727_5854 371
153 3300046492 Ga0495585_0006200 Ga0495585_0006200_224_1360 371
154 3300046501 Ga0495607_0000174 Ga0495607_0000174_42577_43704 371
155 3300046501 Ga0495607_0016347 Ga0495607_0016347_2435_3562 371
156 3300046501 Ga0495607_0017597 Ga0495607_0017597_2934_4070 371
157 3300046501 Ga0495607_0018081 Ga0495607_0018081_2078_3232 371
158 3300046506 Ga0495583_0027443 Ga0495583_0027443_973_2106 371
159 3300046507 Ga0495606_0001027 Ga0495606_0001027_10835_11962 371
160 3300046507 Ga0495606_0003481 Ga0495606_0003481_11338_12465 371
161 3300046507 Ga0495606_0021439 Ga0495606_0021439_2987_4207 371
162 3300046512 Ga0495610_0054790 Ga0495610_0054790_515_1669 371
163 3300046513 Ga0495616_0000138 Ga0495616_0000138_37238_38365 371
164 3300046513 Ga0495616_0000946 Ga0495616_0000946_19548_20675 371
165 3300046513 Ga0495616_0017774 Ga0495616_0017774_1251_2378 371
166 3300046513 Ga0495616_0065785 Ga0495616_0065785_467_1603 371
167 3300046515 Ga0495620_0000366 Ga0495620_0000366_25269_26396 371
168 3300046515 Ga0495620_0002606 Ga0495620_0002606_2486_3613 371
169 3300046518 Ga0495631_0000282 Ga0495631_0000282_26791_27918 371
170 3300046518 Ga0495631_0000359 Ga0495631_0000359_25554_26681 371
171 3300046518 Ga0495631_0001421 Ga0495631_0001421_4638_5774 371
172 3300046519 Ga0495632_0013811 Ga0495632_0013811_2360_3487 371
173 3300046520 Ga0495637_0028181 Ga0495637_0028181_299_1453 371
174 3300046522 Ga0495643_0009800 Ga0495643_0009800_871_2145 371
175 3300046524 Ga0495648_0000894 Ga0495648_0000894_25617_26744 371
176 3300046524 Ga0495648_0011553 Ga0495648_0011553_2397_3524 371
177 3300046538 Ga0495609_0027566 Ga0495609_0027566_1142_2296 371
178 3300046538 Ga0495609_0040496 Ga0495609_0040496_942_2078 371
179 3300046542 Ga0495597_0062533 Ga0495597_0062533_199_1335 371
180 3300046557 Ga0495622_0037362 Ga0495622_0037362_227_1387 371
181 3300046615 Ga0495656_0038761 Ga0495656_0038761_303_1439 371
182 3300046616 Ga0495668_0006397 Ga0495668_0006397_4995_6131 371
183 3300046648 Ga0495611_0000018 Ga0495611_0000018_10774_11901 371
184 3300046660 Ga0495625_0001015 Ga0495625_0001015_27966_29108 371
185 3300046660 Ga0495625_0001060 Ga0495625_0001060_2328_3464 371
186 3300046660 Ga0495625_0007888 Ga0495625_0007888_119_1252 371
187 3300046664 Ga0495659_0027163 Ga0495659_0027163_719_1885 371
188 3300046665 Ga0495661_0001010 Ga0495661_0001010_4802_5929 371
189 3300046674 Ga0495588_0032679 Ga0495588_0032679_326_1480 371
190 3300046679 Ga0495623_0035064 Ga0495623_0035064_1085_2218 371
191 3300046691 Ga0495670_0001565 Ga0495670_0001565_6511_7638 371
192 3300046691 Ga0495670_0016893 Ga0495670_0016893_237_1373 371
193 3300046691 Ga0495670_0024735 Ga0495670_0024735_1591_2727 371
194 3300046794 Ga0495589_0004314 Ga0495589_0004314_1512_2648 371
195 3300046810 Ga0495660_0000125 Ga0495660_0000125_60910_62037 371
196 3300046810 Ga0495660_0000251 Ga0495660_0000251_24770_25897 371
197 3300046810 Ga0495660_0103076 Ga0495660_0103076_242_1378 371
198 3300047317 Ga0495604_0004316 Ga0495604_0004316_5550_6683 371
199 3300047318 Ga0495636_0000052 Ga0495636_0000052_9101_10267 371
200 3300047318 Ga0495636_0002156 Ga0495636_0002156_2199_3392 371
201 3300047323 Ga0495683_0002118 Ga0495683_0002118_4580_5707 371
202 3300047444 Ga0495675_0009448 Ga0495675_0009448_2345_3478 371
203 3300047469 Ga0495673_0000004 Ga0495673_0000004_724212_725339 371
204 3300047469 Ga0495673_0000133 Ga0495673_0000133_113294_114421 371
205 3300047472 Ga0495686_0001191 Ga0495686_0001191_3247_4380 371
206 3300047472 Ga0495686_0008734 Ga0495686_0008734_5822_6949 371
207 3300047472 Ga0495686_0059081 Ga0495686_0059081_669_1796 371
208 3300048088 Ga0495602_0074666 Ga0495602_0074666_691_1824 371
209 3300048903 Ga0496100_0001458 Ga0496100_0001458_8051_9205 371
210 3300048904 Ga0496101_0006244 Ga0496101_0006244_20_1147 371
211 3300048904 Ga0496101_0015284 Ga0496101_0015284_1966_3120 371
212 3300048904 Ga0496101_0034009 Ga0496101_0034009_1652_2788 371
213 3300048905 Ga0496102_0001047 Ga0496102_0001047_8493_9629 371
214 3300048905 Ga0496102_0001288 Ga0496102_0001288_9102_10229 371
215 3300048905 Ga0496102_0003597 Ga0496102_0003597_2724_3878 371
216 3300048905 Ga0496102_0167826 Ga0496102_0167826_55_1182 371
217 3300048906 Ga0496103_0002492 Ga0496103_0002492_2168_3322 371
218 3300048908 Ga0496105_0097727 Ga0496105_0097727_484_1620 371
219 3300048909 Ga0496106_0001898 Ga0496106_0001898_3735_4862 371
220 3300048910 Ga0496107_0040052 Ga0496107_0040052_1038_2174 371
221 3300048919 Ga0496116_0004853 Ga0496116_0004853_1837_2991 371
222 3300048920 Ga0496117_0000054 Ga0496117_0000054_28998_30125 371
223 3300048920 Ga0496117_0002402 Ga0496117_0002402_7794_8930 371
224 3300048920 Ga0496117_0004786 Ga0496117_0004786_9960_11114 371
225 3300048921 Ga0496118_0000045 Ga0496118_0000045_24756_25883 371
226 3300048921 Ga0496118_0002113 Ga0496118_0002113_24094_25230 371
227 3300048921 Ga0496118_0005381 Ga0496118_0005381_9916_11070 371
228 3300048921 Ga0496118_0081946 Ga0496118_0081946_251_1387 371
229 3300048922 Ga0496119_0001077 Ga0496119_0001077_28690_29817 371
230 3300048922 Ga0496119_0004967 Ga0496119_0004967_1965_3119 371
231 3300048922 Ga0496119_0016387 Ga0496119_0016387_473_1600 371
232 3300048923 Ga0496120_0000177 Ga0496120_0000177_42091_43218 371
233 3300048923 Ga0496120_0004041 Ga0496120_0004041_9710_10864 371
234 3300048923 Ga0496120_0013049 Ga0496120_0013049_448_1575 371
235 3300048924 Ga0496121_0000898 Ga0496121_0000898_25898_27025 371
236 3300048924 Ga0496121_0001047 Ga0496121_0001047_24734_25861 371
237 3300048924 Ga0496121_0006476 Ga0496121_0006476_3558_4712 371
238 3300048924 Ga0496121_0015562 Ga0496121_0015562_1565_2692 371
239 3300048924 Ga0496121_0025227 Ga0496121_0025227_470_1636 371
240 3300048924 Ga0496121_0087422 Ga0496121_0087422_224_1360 371
241 3300048924 Ga0496121_0121641 Ga0496121_0121641_231_1367 371
242 3300048925 Ga0496122_0006549 Ga0496122_0006549_9341_10495 371
243 3300048925 Ga0496122_0041384 Ga0496122_0041384_1456_2583 371
244 3300048926 Ga0496123_0004822 Ga0496123_0004822_3005_4159 371
245 3300048926 Ga0496123_0029968 Ga0496123_0029968_10_1137 371
246 3300048927 Ga0496124_0001043 Ga0496124_0001043_16592_17722 371
247 3300048927 Ga0496124_0001144 Ga0496124_0001144_16540_17670 371
248 3300048927 Ga0496124_0005510 Ga0496124_0005510_3533_4687 371
249 3300048928 Ga0496125_0007481 Ga0496125_0007481_2185_3339 371
250 3300048928 Ga0496125_0008092 Ga0496125_0008092_5024_6151 371
251 3300048929 Ga0496126_0028735 Ga0496126_0028735_3996_5123 371
252 3300048929 Ga0496126_0052926 Ga0496126_0052926_2087_3214 371
253 3300049459 Ga0495678_064461 Ga0495678_064461_94_1230 371
254 3300049460 Ga0495682_0000516 Ga0495682_0000516_24021_25148 371
255 3300049460 Ga0495682_0026934 Ga0495682_0026934_446_1573 371
256 3300050493 nmdc:mga0k408_136788_c1 nmdc:mga0k408_136788_c1_264_1406 371
257 3300050511 nmdc:mga08y16_16_c1 nmdc:mga08y16_16_c1_89778_90920 371
258 3300053086 Ga0500578_0024163 Ga0500578_0024163_2539_3675 371
259 3300053087 Ga0500643_000223 Ga0500643_000223_27391_28518 371
260 3300053087 Ga0500643_001642 Ga0500643_001642_1019_2152 371
261 3300053100 Ga0500660_009854 Ga0500660_009854_3058_4191 371
262 3300053103 Ga0500555_001026 Ga0500555_001026_3785_4912 371
263 3300053105 Ga0500557_009398 Ga0500557_009398_625_1761 371
264 3300053109 Ga0500569_003522 Ga0500569_003522_1676_2812 371
265 3300053118 Ga0500594_0000401 Ga0500594_0000401_4511_5647 371
266 3300053125 Ga0500618_003829 Ga0500618_003829_1693_2862 371
267 3300053134 Ga0500658_0027969 Ga0500658_0027969_765_1907 371
268 3300053139 Ga0500568_0004550 Ga0500568_0004550_6140_7294 371
269 3300053153 Ga0500616_0009034 Ga0500616_0009034_4535_5689 371
270 3300053160 Ga0500633_0003076 Ga0500633_0003076_1746_2873 371
271 3300053730 Ga0500645_002268 Ga0500645_002268_3089_4216 371
272 3300061719 Ga0466962_0028079 Ga0466962_0028079_535_1668 371
273 iso_pu_bacteria 2643221637 2644207441 371
274 iso_pu_bacteria 2643221718 2644651089 371

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00266

Aminotran_5

Aminotransferase class-V

96

244

0.91

PF00155

Aminotran_1_2

Aminotransferase class I and II

71

415

0.87

PF01053

Cys_Met_Meta_PP

Cys/Met metabolism PLP-dependent enzyme

90

243

0.83

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

86

238

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fft-assembly2.cif.gz_C structure of gntc, a plp-dependent enzyme catalyzing l-enduracididine biosynthesis from (s)-4-hydroxy-l-arginine 0.9328 22 369
3op7-assembly1.cif.gz_A crystal structure of a plp-dependent aminotransferase (zp_03625122.1) from streptococcus suis 89-1591 at 1.70 a resolution 0.9318 5 369
8fft-assembly1.cif.gz_B structure of gntc, a plp-dependent enzyme catalyzing l-enduracididine biosynthesis from (s)-4-hydroxy-l-arginine 0.9271 20 369
8fft-assembly2.cif.gz_C structure of gntc, a plp-dependent enzyme catalyzing l-enduracididine biosynthesis from (s)-4-hydroxy-l-arginine 0.9224 22 369
8fft-assembly2.cif.gz_D structure of gntc, a plp-dependent enzyme catalyzing l-enduracididine biosynthesis from (s)-4-hydroxy-l-arginine 0.9197 22 369
ID Description Score Start End Superfamily
3p6kB02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9543 60 267 3.40.640.10
af_A0A1D8PRL8_58_286_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9515 53 267 3.40.640.10
af_A0A0R0HS10_77_301_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9347 53 265 3.40.640.10
af_Q60317_48_276_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9343 54 265 3.40.640.10
1j32B02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9278 55 265 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A520ZUW1-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9768 6 263 GO:0008483
GO:0009058
GO:0030170
AF-A0A1F5KDR8-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9663 8 369 GO:0008483
GO:0009058
GO:0030170
AF-A0A0Q9YU75-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme (Capreomycidine synthase (EC 4.3.2.-)) 0.9652 6 369 GO:0008483
GO:0009058
GO:0016829
GO:0030170
AF-A0A7S9V5S1-F1-model_v4 deleted 0.9632 5 369
AF-A0A7V4GDX6-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9605 6 367 GO:0008483
GO:0009058
GO:0030170

Feature Viewer

pLDDT pTM Quality
94.92 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map