F379989

General Info

Members Datasets Scaffolds Average Seq Length
274 177 548 226

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0000771|Ga0496104_0000771_360_1154
Length 264
Sequence MAGFTLQSPRSAPRPTAAFSLAASFCYNAVAMKLVIFDCDGTLVDSQQAIFGTMQHAFGALGLPTPGRMQVLGVIGLSLPEAFAILAPAETPAAQAELVAAYRSAFSLTRMNGAQHNDPLFPGMREVVTVLAGRDDIVLGVATGKSRRGVARLLEREGWHGHFLTIQTADDHPSKPHPSMIFKAMVDAGVGPEATVMVGDTTFDIEMARSARVGAVGVAWGYHKPAQLVRAGAHVVAETGDVLVATIETQFAAQAQEKSHDHNG

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
78 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
79 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
80 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
81 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
82 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
83 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
84 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
85 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
89 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
90 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
91 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
96 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
97 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
105 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
112 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
113 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
128 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
136 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
137 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
140 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
144 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
145 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
146 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
154 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
155 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
156 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
157 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
158 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
159 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
160 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
161 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
162 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
163 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
164 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
165 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
166 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
167 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
168 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
169 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
170 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
171 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
175 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
176 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
177 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 0
Isolates 1.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.69
Nodule 0
Rhizoplane 9.12
Rhizosphere 71.17
Stem 0
Stem Tuber 0
Unclassified 1.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0000771 3300048907 Bacteria 27410
2 JGI25153J46596_10000255 3300003215 Bacteria 43499
3 rootH1_10151817 3300003316 Bacteria 1175
4 rootH2_10008039 3300003320 Bacteria 7309
5 rootL2_10050325 3300003322 Bacteria 2612
6 Ga0055531_10004459 3300003794 Bacteria 8518
7 Ga0070683_100822517 3300005329 Bacteria 891
8 Ga0070682_100037011 3300005337 Bacteria 2985
9 Ga0070682_100745431 3300005337 Bacteria 790
10 Ga0070660_100245028 3300005339 Bacteria 1460
11 Ga0070691_10013038 3300005341 Bacteria 3807
12 Ga0070691_10018269 3300005341 Bacteria 3232
13 Ga0070675_100571736 3300005354 Bacteria 1023
14 Ga0070713_100670941 3300005436 Bacteria 988
15 Ga0070705_100015820 3300005440 Bacteria 3906
16 Ga0070694_100022321 3300005444 Bacteria 4055
17 Ga0070663_100002363 3300005455 Bacteria 10612
18 Ga0070663_100039194 3300005455 Bacteria 3310
19 Ga0070681_10036435 3300005458 Bacteria 4940
20 Ga0068867_100225651 3300005459 Bacteria 1512
21 Ga0070679_100039803 3300005530 Bacteria 4673
22 Ga0068853_100016084 3300005539 Bacteria 6153
23 Ga0070695_100000628 3300005545 Bacteria 18731
24 Ga0070696_100024420 3300005546 Bacteria 4107
25 Ga0070696_100037613 3300005546 Bacteria 3339
26 Ga0070693_100006553 3300005547 Bacteria 5648
27 Ga0068855_100279969 3300005563 Bacteria 1852
28 Ga0068854_100784148 3300005578 Bacteria 829
29 Ga0070702_100015541 3300005615 Bacteria 3888
30 Ga0068859_100662510 3300005617 Bacteria 1135
31 Ga0068861_100509384 3300005719 Bacteria 1089
32 Ga0068858_100306404 3300005842 Bacteria 1516
33 Ga0068862_100023870 3300005844 Bacteria 5126
34 Ga0081455_10000194 3300005937 Bacteria 77128
35 Ga0081540_1000072 3300005983 Bacteria 109383
36 Ga0081539_10089181 3300005985 Bacteria 1598
37 Ga0075365_10068126 3300006038 Bacteria 2391
38 Ga0075365_10270065 3300006038 Bacteria 1196
39 Ga0075368_10002945 3300006042 Bacteria 5623
40 Ga0075364_10012038 3300006051 Bacteria 5276
41 Ga0075431_100034826 3300006847 Bacteria 5186
42 Ga0075431_100076140 3300006847 Bacteria 3463
43 Ga0075433_10012108 3300006852 Bacteria 6957
44 Ga0075434_100067813 3300006871 Bacteria 3554
45 Ga0075429_100023577 3300006880 Bacteria 5341
46 Ga0097620_100662528 3300006931 Bacteria 1135
47 Ga0075435_100053664 3300007076 Bacteria 3251
48 Ga0111539_10003054 3300009094 Bacteria 22177
49 Ga0111539_10193630 3300009094 Bacteria 2372
50 Ga0111539_10211366 3300009094 Bacteria 2260
51 Ga0111539_10346633 3300009094 Bacteria 1729
52 Ga0105245_10288705 3300009098 Bacteria 1606
53 Ga0105247_10384853 3300009101 Bacteria 996
54 Ga0105241_10097432 3300009174 Bacteria 2332
55 Ga0105242_10326317 3300009176 Bacteria 1410
56 Ga0105238_10011218 3300009551 Bacteria 9016
57 Ga0105246_10148856 3300011119 Bacteria 1770
58 Ga0157378_10591156 3300013297 Bacteria 1120
59 Ga0163162_10222649 3300013306 Bacteria 2016
60 Ga0163163_10133935 3300014325 Bacteria 2518
61 Ga0209758_1000118 3300025297 Bacteria 195889
62 Ga0209758_1033026 3300025297 Bacteria 2087
63 Ga0209050_1006197 3300025298 Bacteria 7176
64 Ga0209257_1000733 3300025304 Bacteria 49710
65 Ga0209257_1050662 3300025304 Bacteria 1174
66 Ga0209257_1082377 3300025304 Bacteria 822
67 Ga0207654_10439852 3300025911 Bacteria 913
68 Ga0207657_10102752 3300025919 Bacteria 2370
69 Ga0207652_10099273 3300025921 Bacteria 2569
70 Ga0207694_10224378 3300025924 Bacteria 1533
71 Ga0207659_10626024 3300025926 Bacteria 918
72 Ga0207690_10350891 3300025932 Bacteria 1166
73 Ga0207703_10027331 3300026035 Bacteria 4493
74 Ga0207639_10063281 3300026041 Bacteria 2864
75 Ga0207678_10000118 3300026067 Bacteria 65608
76 Ga0207674_10277694 3300026116 Bacteria 1623
77 Ga0207675_100035072 3300026118 Bacteria 4679
78 Ga0207675_100254187 3300026118 Bacteria 1701
79 Ga0209813_10001603 3300027866 Bacteria 5092
80 Ga0207428_10130000 3300027907 Bacteria 1928
81 Ga0268265_10004501 3300028380 Bacteria 9647
82 Ga0268264_10097367 3300028381 Bacteria 2550
83 Ga0307517_10051927 3300028786 Bacteria 4123
84 Ga0265327_10037632 3300031251 Bacteria 2647
85 Ga0307513_10017309 3300031456 Bacteria 8645
86 Ga0307408_100050534 3300031548 Bacteria 2991
87 Ga0307516_10383882 3300031730 Bacteria 1066
88 Ga0307405_10431957 3300031731 Bacteria 1039
89 Ga0307415_100493837 3300032126 Bacteria 1068
90 Ga0373958_0031176 3300034819 Bacteria 1046
91 Ga0373940_0001943 3300035088 Bacteria 3899
92 Ga0373949_0006483 3300035090 Bacteria 2573
93 Ga0373951_0038319 3300035091 Bacteria 1149
94 Ga0373941_0042652 3300035115 Bacteria 1409
95 Ga0373960_0035105 3300035121 Bacteria 1422
96 Ga0373942_0020474 3300035207 Bacteria 1662
97 Ga0373961_0034330 3300035241 Bacteria 1433
98 Ga0373961_0052120 3300035241 Bacteria 1217
99 Ga0373931_0004480 3300035691 Bacteria 6385
100 Ga0373931_0122754 3300035691 Bacteria 1486
101 Ga0373931_0134054 3300035691 Bacteria 1428
102 Ga0373927_0146160 3300035695 Bacteria 1548
103 Ga0395901_0329067 3300038443 Bacteria 1580
104 Ga0436360_0265470 3300039438 Bacteria 2700
105 Ga0451797_0639180 3300041453 Bacteria 1114
106 Ga0451845_0302774 3300041501 Bacteria 1245
107 Ga0451849_1033220 3300041505 Bacteria 774
108 Ga0466957_0349468 3300044842 Bacteria 1003
109 Ga0451576_0215599 3300045051 Bacteria 2004
110 Ga0495638_0075002 3300046460 Bacteria 2062
111 Ga0495584_0080417 3300046491 Bacteria 1640
112 Ga0495668_0137970 3300046616 Bacteria 1335
113 Ga0495686_0160816 3300047472 Bacteria 1312
114 Ga0496100_0078901 3300048903 Bacteria 2217
115 Ga0496100_0117293 3300048903 Bacteria 1858
116 Ga0496101_0029950 3300048904 Bacteria 3811
117 Ga0496101_0091831 3300048904 Bacteria 2260
118 Ga0496102_0020335 3300048905 Bacteria 5867
119 Ga0496102_0045230 3300048905 Bacteria 3996
120 Ga0496102_0075677 3300048905 Bacteria 3095
121 Ga0496103_0002979 3300048906 Bacteria 10486
122 Ga0496104_0018722 3300048907 Bacteria 6321
123 Ga0496105_0011499 3300048908 Bacteria 6995
124 Ga0496105_0249449 3300048908 Bacteria 1438
125 Ga0496106_0004532 3300048909 Bacteria 10293
126 Ga0496106_0028103 3300048909 Bacteria 4189
127 Ga0496107_0092561 3300048910 Bacteria 2210
128 Ga0496108_0001711 3300048911 Bacteria 17382
129 Ga0496109_0023994 3300048912 Bacteria 5417
130 Ga0496110_0001734 3300048913 Bacteria 16069
131 Ga0496110_0025296 3300048913 Bacteria 5072
132 Ga0496112_0067032 3300048915 Bacteria 3542
133 Ga0496113_0022711 3300048916 Bacteria 4442
134 Ga0496113_0464204 3300048916 Bacteria 1017
135 Ga0496115_0003535 3300048918 Bacteria 11241
136 Ga0496115_0006350 3300048918 Bacteria 8658
137 Ga0496118_0106840 3300048921 Bacteria 1871
138 Ga0496126_0169647 3300048929 Bacteria 1860
139 Ga0501032_0002279 3300049569 Bacteria 15077
140 Ga0501032_0213376 3300049569 Unclassified 1258
141 Ga0501033_0125535 3300049570 Bacteria 1861
142 Ga0501034_0000077 3300049571 Bacteria 173873
143 Ga0501034_0000482 3300049571 Bacteria 65380
144 Ga0501034_0038876 3300049571 Bacteria 4819
145 Ga0501034_0110071 3300049571 Bacteria 2746
146 Ga0501034_0288717 3300049571 Bacteria 1579
147 Ga0501034_0339652 3300049571 Bacteria 1432
148 Ga0501034_0534604 3300049571 Unclassified 1083
149 Ga0501036_0405617 3300049572 Bacteria 1137
150 Ga0501037_0002353 3300049573 Bacteria 13662
151 Ga0501037_0233153 3300049573 Bacteria 1292
152 Ga0501037_0431600 3300049573 Bacteria 901
153 Ga0501038_0003219 3300049574 Bacteria 15235
154 Ga0501038_0026343 3300049574 Bacteria 5179
155 Ga0501038_0204386 3300049574 Bacteria 1583
156 Ga0501038_0350554 3300049574 Bacteria 1150
157 Ga0501039_0000300 3300049575 Bacteria 35152
158 Ga0501039_0091936 3300049575 Bacteria 2365
159 Ga0501039_0112547 3300049575 Bacteria 2128
160 Ga0501040_0168514 3300049576 Bacteria 1550
161 Ga0501041_0057764 3300049577 Bacteria 2373
162 Ga0501042_0190814 3300049578 Bacteria 1478
163 Ga0501043_0030125 3300049579 Bacteria 4263
164 Ga0501043_0041316 3300049579 Bacteria 3623
165 Ga0501043_0124053 3300049579 Bacteria 2025
166 Ga0501043_0411149 3300049579 Bacteria 1021
167 Ga0501046_0000045 3300049580 Bacteria 144492
168 Ga0501046_0000956 3300049580 Bacteria 28325
169 Ga0501046_0007615 3300049580 Bacteria 9500
170 Ga0501046_0119965 3300049580 Bacteria 2001
171 Ga0501047_0000129 3300049581 Bacteria 91572
172 Ga0501047_0016963 3300049581 Bacteria 6962
173 Ga0501047_0033764 3300049581 Bacteria 4938
174 Ga0501047_0090904 3300049581 Bacteria 2930
175 Ga0501047_0143624 3300049581 Bacteria 2264
176 Ga0501047_0601542 3300049581 Unclassified 921
177 Ga0501048_0006130 3300049582 Bacteria 9164
178 Ga0501048_0127826 3300049582 Bacteria 1797
179 Ga0501067_0001502 3300049583 Bacteria 12702
180 Ga0501067_0034829 3300049583 Bacteria 2795
181 Ga0501067_0133793 3300049583 Bacteria 1380
182 Ga0501067_0327252 3300049583 Bacteria 853
183 Ga0501068_0008627 3300049584 Bacteria 5680
184 Ga0501068_0175997 3300049584 Bacteria 1352
185 Ga0501070_0014469 3300049586 Bacteria 6640
186 Ga0501070_0080954 3300049586 Bacteria 2687
187 Ga0501070_0112820 3300049586 Bacteria 2247
188 Ga0501070_0232055 3300049586 Bacteria 1512
189 Ga0501070_0422954 3300049586 Bacteria 1076
190 Ga0501071_0491350 3300049587 Bacteria 941
191 Ga0501071_0664607 3300049587 Bacteria 802
192 Ga0501072_0170934 3300049588 Bacteria 1734
193 Ga0501072_0246349 3300049588 Bacteria 1423
194 Ga0501073_0012270 3300049589 Bacteria 6253
195 Ga0501073_0012290 3300049589 Bacteria 6248
196 Ga0501073_0014152 3300049589 Bacteria 5793
197 Ga0501073_0052631 3300049589 Bacteria 2850
198 Ga0501073_0431298 3300049589 Bacteria 911
199 Ga0501074_0029237 3300049590 Bacteria 3992
200 Ga0501076_0015159 3300049592 Bacteria 5820
201 Ga0501076_0156758 3300049592 Bacteria 1854
202 Ga0501077_0005661 3300049593 Bacteria 7617
203 Ga0501225_0139912 3300049705 Bacteria 731
204 Ga0501079_0002936 3300049741 Bacteria 12453
205 Ga0501080_0000053 3300049742 Bacteria 74409
206 Ga0501080_0009920 3300049742 Bacteria 8701
207 Ga0501080_0024647 3300049742 Bacteria 5579
208 Ga0501080_0171743 3300049742 Bacteria 1999
209 Ga0501081_0241839 3300049743 Bacteria 1316
210 Ga0501083_0008070 3300049744 Bacteria 7446
211 Ga0501083_0021559 3300049744 Bacteria 4475
212 Ga0501083_0194543 3300049744 Bacteria 1323
213 Ga0501035_0000010 3300049822 Bacteria 309349
214 Ga0501035_0491635 3300049822 Bacteria 1011
215 Ga0501035_0598533 3300049822 Bacteria 899
216 Ga0501044_0000074 3300049823 Bacteria 121086
217 Ga0501044_0025470 3300049823 Bacteria 6270
218 Ga0501044_0080403 3300049823 Bacteria 3302
219 Ga0501044_0170327 3300049823 Bacteria 2149
220 Ga0501044_0201322 3300049823 Bacteria 1949
221 Ga0501044_0223055 3300049823 Bacteria 1835
222 Ga0501044_0313804 3300049823 Bacteria 1494
223 Ga0501045_0073485 3300049824 Bacteria 2518
224 Ga0501045_0161881 3300049824 Bacteria 1666
225 nmdc:mga0k408_65684_c1 3300050493 Bacteria 2112
226 nmdc:mga04h51_1816_c1 3300050495 Bacteria 4994
227 nmdc:mga07m45_77452_c1 3300050496 Bacteria 1896
228 nmdc:mga05p37_158691_c1 3300050507 Bacteria 2763
229 nmdc:mga06r32_110092_c1 3300050510 Bacteria 2709
230 nmdc:mga08y16_247850_c1 3300050511 Bacteria 1841
231 nmdc:mga08y16_578173_c1 3300050511 Bacteria 1134
232 nmdc:mga08y16_86366_c1 3300050511 Bacteria 3269
233 nmdc:mga0rr50_40163_c1 3300050513 Bacteria 3400
234 nmdc:mga0a205_2296_c1 3300050515 Bacteria 16872
235 Ga0495619_0122554 3300053085 Bacteria 1783
236 Ga0500578_0063592 3300053086 Unclassified 2354
237 Ga0500644_0000282 3300053088 Bacteria 28207
238 Ga0500646_0083927 3300053090 Bacteria 976
239 Ga0500646_0085267 3300053090 Bacteria 970
240 Ga0500583_0118860 3300053092 Bacteria 1307
241 Ga0500651_0002419 3300053093 Bacteria 9846
242 Ga0500651_0006391 3300053093 Bacteria 6791
243 Ga0500566_0038669 3300053094 Bacteria 2760
244 Ga0500641_0005679 3300053096 Bacteria 4421
245 Ga0500641_0133523 3300053096 Bacteria 1071
246 Ga0500555_003937 3300053103 Bacteria 4225
247 Ga0500556_0000636 3300053104 Bacteria 22036
248 Ga0500594_0059145 3300053118 Bacteria 1100
249 Ga0500595_000405 3300053119 Bacteria 27569
250 Ga0500595_016776 3300053119 Bacteria 2721
251 Ga0500658_0047686 3300053134 Bacteria 1739
252 Ga0500568_0025820 3300053139 Bacteria 2472
253 Ga0500577_0025936 3300053142 Bacteria 1989
254 Ga0500577_0078773 3300053142 Bacteria 1309
255 Ga0500588_0002746 3300053146 Bacteria 3629
256 Ga0500588_0039997 3300053146 Bacteria 1407
257 Ga0500604_0003087 3300053151 Bacteria 4471
258 Ga0500616_0005017 3300053153 Bacteria 9173
259 Ga0500616_0005115 3300053153 Bacteria 9037
260 Ga0500616_0015755 3300053153 Bacteria 4315
261 Ga0500645_000033 3300053730 Bacteria 119279
262 Ga0500609_001609 3300053731 Bacteria 3291
263 Ga0501084_0021579 3300054114 Bacteria 5369
264 Ga0501084_0028329 3300054114 Bacteria 4682
265 Ga0501084_0294976 3300054114 Bacteria 1369
266 Ga0501084_0432360 3300054114 Bacteria 1113
267 Ga0501082_0007458 3300060353 Bacteria 9439
268 Ga0501082_0008742 3300060353 Bacteria 8729
269 Ga0501082_0171652 3300060353 Bacteria 1885
270 Ga0501082_0415960 3300060353 Bacteria 1174
271 Ga0530510_0025525 3300061734 Bacteria 4226
272 2523107269 2522572158 Bacteria 6514390
273 2917557374 2917554339 Bacteria 4987857
274 3000406705 3000405567 Bacteria 3779330
275 Ga0496104_0000771
276 JGI25153J46596_10000255
277 rootH1_10151817
278 rootH2_10008039
279 rootL2_10050325
280 Ga0055531_10004459
281 Ga0070683_100822517
282 Ga0070682_100037011
283 Ga0070682_100745431
284 Ga0070660_100245028
285 Ga0070691_10013038
286 Ga0070691_10018269
287 Ga0070675_100571736
288 Ga0070713_100670941
289 Ga0070705_100015820
290 Ga0070694_100022321
291 Ga0070663_100002363
292 Ga0070663_100039194
293 Ga0070681_10036435
294 Ga0068867_100225651
295 Ga0070679_100039803
296 Ga0068853_100016084
297 Ga0070695_100000628
298 Ga0070696_100024420
299 Ga0070696_100037613
300 Ga0070693_100006553
301 Ga0068855_100279969
302 Ga0068854_100784148
303 Ga0070702_100015541
304 Ga0068859_100662510
305 Ga0068861_100509384
306 Ga0068858_100306404
307 Ga0068862_100023870
308 Ga0081455_10000194
309 Ga0081540_1000072
310 Ga0081539_10089181
311 Ga0075365_10068126
312 Ga0075365_10270065
313 Ga0075368_10002945
314 Ga0075364_10012038
315 Ga0075431_100034826
316 Ga0075431_100076140
317 Ga0075433_10012108
318 Ga0075434_100067813
319 Ga0075429_100023577
320 Ga0097620_100662528
321 Ga0075435_100053664
322 Ga0111539_10003054
323 Ga0111539_10193630
324 Ga0111539_10211366
325 Ga0111539_10346633
326 Ga0105245_10288705
327 Ga0105247_10384853
328 Ga0105241_10097432
329 Ga0105242_10326317
330 Ga0105238_10011218
331 Ga0105246_10148856
332 Ga0157378_10591156
333 Ga0163162_10222649
334 Ga0163163_10133935
335 Ga0209758_1000118
336 Ga0209758_1033026
337 Ga0209050_1006197
338 Ga0209257_1000733
339 Ga0209257_1050662
340 Ga0209257_1082377
341 Ga0207654_10439852
342 Ga0207657_10102752
343 Ga0207652_10099273
344 Ga0207694_10224378
345 Ga0207659_10626024
346 Ga0207690_10350891
347 Ga0207703_10027331
348 Ga0207639_10063281
349 Ga0207678_10000118
350 Ga0207674_10277694
351 Ga0207675_100035072
352 Ga0207675_100254187
353 Ga0209813_10001603
354 Ga0207428_10130000
355 Ga0268265_10004501
356 Ga0268264_10097367
357 Ga0307517_10051927
358 Ga0265327_10037632
359 Ga0307513_10017309
360 Ga0307408_100050534
361 Ga0307516_10383882
362 Ga0307405_10431957
363 Ga0307415_100493837
364 Ga0373958_0031176
365 Ga0373940_0001943
366 Ga0373949_0006483
367 Ga0373951_0038319
368 Ga0373941_0042652
369 Ga0373960_0035105
370 Ga0373942_0020474
371 Ga0373961_0034330
372 Ga0373961_0052120
373 Ga0373931_0004480
374 Ga0373931_0122754
375 Ga0373931_0134054
376 Ga0373927_0146160
377 Ga0395901_0329067
378 Ga0436360_0265470
379 Ga0451797_0639180
380 Ga0451845_0302774
381 Ga0451849_1033220
382 Ga0466957_0349468
383 Ga0451576_0215599
384 Ga0495638_0075002
385 Ga0495584_0080417
386 Ga0495668_0137970
387 Ga0495686_0160816
388 Ga0496100_0078901
389 Ga0496100_0117293
390 Ga0496101_0029950
391 Ga0496101_0091831
392 Ga0496102_0020335
393 Ga0496102_0045230
394 Ga0496102_0075677
395 Ga0496103_0002979
396 Ga0496104_0018722
397 Ga0496105_0011499
398 Ga0496105_0249449
399 Ga0496106_0004532
400 Ga0496106_0028103
401 Ga0496107_0092561
402 Ga0496108_0001711
403 Ga0496109_0023994
404 Ga0496110_0001734
405 Ga0496110_0025296
406 Ga0496112_0067032
407 Ga0496113_0022711
408 Ga0496113_0464204
409 Ga0496115_0003535
410 Ga0496115_0006350
411 Ga0496118_0106840
412 Ga0496126_0169647
413 Ga0501032_0002279
414 Ga0501032_0213376
415 Ga0501033_0125535
416 Ga0501034_0000077
417 Ga0501034_0000482
418 Ga0501034_0038876
419 Ga0501034_0110071
420 Ga0501034_0288717
421 Ga0501034_0339652
422 Ga0501034_0534604
423 Ga0501036_0405617
424 Ga0501037_0002353
425 Ga0501037_0233153
426 Ga0501037_0431600
427 Ga0501038_0003219
428 Ga0501038_0026343
429 Ga0501038_0204386
430 Ga0501038_0350554
431 Ga0501039_0000300
432 Ga0501039_0091936
433 Ga0501039_0112547
434 Ga0501040_0168514
435 Ga0501041_0057764
436 Ga0501042_0190814
437 Ga0501043_0030125
438 Ga0501043_0041316
439 Ga0501043_0124053
440 Ga0501043_0411149
441 Ga0501046_0000045
442 Ga0501046_0000956
443 Ga0501046_0007615
444 Ga0501046_0119965
445 Ga0501047_0000129
446 Ga0501047_0016963
447 Ga0501047_0033764
448 Ga0501047_0090904
449 Ga0501047_0143624
450 Ga0501047_0601542
451 Ga0501048_0006130
452 Ga0501048_0127826
453 Ga0501067_0001502
454 Ga0501067_0034829
455 Ga0501067_0133793
456 Ga0501067_0327252
457 Ga0501068_0008627
458 Ga0501068_0175997
459 Ga0501070_0014469
460 Ga0501070_0080954
461 Ga0501070_0112820
462 Ga0501070_0232055
463 Ga0501070_0422954
464 Ga0501071_0491350
465 Ga0501071_0664607
466 Ga0501072_0170934
467 Ga0501072_0246349
468 Ga0501073_0012270
469 Ga0501073_0012290
470 Ga0501073_0014152
471 Ga0501073_0052631
472 Ga0501073_0431298
473 Ga0501074_0029237
474 Ga0501076_0015159
475 Ga0501076_0156758
476 Ga0501077_0005661
477 Ga0501225_0139912
478 Ga0501079_0002936
479 Ga0501080_0000053
480 Ga0501080_0009920
481 Ga0501080_0024647
482 Ga0501080_0171743
483 Ga0501081_0241839
484 Ga0501083_0008070
485 Ga0501083_0021559
486 Ga0501083_0194543
487 Ga0501035_0000010
488 Ga0501035_0491635
489 Ga0501035_0598533
490 Ga0501044_0000074
491 Ga0501044_0025470
492 Ga0501044_0080403
493 Ga0501044_0170327
494 Ga0501044_0201322
495 Ga0501044_0223055
496 Ga0501044_0313804
497 Ga0501045_0073485
498 Ga0501045_0161881
499 nmdc:mga0k408_65684_c1
500 nmdc:mga04h51_1816_c1
501 nmdc:mga07m45_77452_c1
502 nmdc:mga05p37_158691_c1
503 nmdc:mga06r32_110092_c1
504 nmdc:mga08y16_247850_c1
505 nmdc:mga08y16_578173_c1
506 nmdc:mga08y16_86366_c1
507 nmdc:mga0rr50_40163_c1
508 nmdc:mga0a205_2296_c1
509 Ga0495619_0122554
510 Ga0500578_0063592
511 Ga0500644_0000282
512 Ga0500646_0083927
513 Ga0500646_0085267
514 Ga0500583_0118860
515 Ga0500651_0002419
516 Ga0500651_0006391
517 Ga0500566_0038669
518 Ga0500641_0005679
519 Ga0500641_0133523
520 Ga0500555_003937
521 Ga0500556_0000636
522 Ga0500594_0059145
523 Ga0500595_000405
524 Ga0500595_016776
525 Ga0500658_0047686
526 Ga0500568_0025820
527 Ga0500577_0025936
528 Ga0500577_0078773
529 Ga0500588_0002746
530 Ga0500588_0039997
531 Ga0500604_0003087
532 Ga0500616_0005017
533 Ga0500616_0005115
534 Ga0500616_0015755
535 Ga0500645_000033
536 Ga0500609_001609
537 Ga0501084_0021579
538 Ga0501084_0028329
539 Ga0501084_0294976
540 Ga0501084_0432360
541 Ga0501082_0007458
542 Ga0501082_0008742
543 Ga0501082_0171652
544 Ga0501082_0415960
545 Ga0530510_0025525
546 2523107269
547 2917557374
548 3000406705

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13242

Hydrolase_like

HAD-hyrolase-like

172

243

0.91

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

35

218

0.88

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

32

212

0.87

PF12710

HAD

haloacid dehalogenase-like hydrolase

35

209

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d6j-assembly1.cif.gz_A crystal structure of putative haloacid dehalogenase-like hydrolase from bacteroides fragilis 0.9177 7 211
2ah5-assembly1.cif.gz_A hydrolase, haloacid dehalogenase-like family protein sp0104 from streptococcus pneumoniae 0.9007 6 221
3mc1-assembly1.cif.gz_A crystal structure of a predicted phosphatase from clostridium acetobutylicum 0.8993 7 222
3s6j-assembly1.cif.gz_A the crystal structure of a hydrolase from pseudomonas syringae 0.8923 7 223
2hdo-assembly1.cif.gz_A crystal structure of putative phosphoglycolate phosphatase (np_784602.1) from lactobacillus plantarum at 1.50 a resolution 0.8913 7 218
ID Description Score Start End Superfamily
af_O17773_104_249_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9381 99 220 3.40.50.1000
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9376 94 199 3.40.50.1000
af_Q652P6_229_339_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9363 110 216 3.40.50.1000
af_D7SFJ0_151_278_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9332 99 214 3.40.50.1000
3d6jA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9292 7 211 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A5C7NTJ3-F1-model_v4 deleted 0.9835 4 225
AF-A0A2A4UX86-F1-model_v4 Haloacid dehalogenase 0.9835 8 222 GO:0005829
GO:0006281
GO:0008967
AF-A0A2R4MEP5-F1-model_v4 Phosphoglycolate phosphatase 0.9826 8 223 GO:0005829
GO:0006281
GO:0008967
AF-A0A168T6K2-F1-model_v4 deleted 0.981 6 226
AF-H6SKG3-F1-model_v4 Haloacid dehalogenase-like hydrolase 0.9801 7 220 GO:0005829
GO:0006281
GO:0008967

Map