F380002

General Info

Members Datasets Scaffolds Average Seq Length
274 183 548 162

Family's Representative Sequence

Representative Sequence 3300048921|Ga0496118_0303135|Ga0496118_0303135_280_768
Length 162
Sequence MAVRPIRIFGDPVLRGTCAPIDDIDDGVRSLVTDLVDSVAEPGRAGVAAPQIGVALRAFSYNVDGVIGYVLNPVLEVSGDPEPTGEGCLSVPGLWHDALRHPWARVTGLGLDGAEIVIEGEGLLAQALQHECDHLDGILYLDRLPKDVRRQAMREVRESDWF

Samples

Sample ID Description Type Environment
1 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
41 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
42 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
58 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
59 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
60 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
70 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
71 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
72 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
73 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
74 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
75 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
76 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
77 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
78 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
84 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
85 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
86 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
87 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
88 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
89 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
90 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
91 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
92 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
93 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
94 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
97 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
100 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
101 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
102 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
103 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
104 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
105 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
106 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
107 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
108 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
109 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
110 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
117 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
118 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
119 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
120 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
121 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
122 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
123 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
124 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
125 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
126 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
127 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
128 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
129 2643221546 Microbacterium sp. Root53 Isolate Unclassified
130 2643221553 Microbacterium sp. Root553 Isolate Unclassified
131 2643221566 Microbacterium sp. Root166 Isolate Unclassified
132 2643221575 Microbacterium sp. Root61 Isolate Unclassified
133 2643221630 Microbacterium sp. Root322 Isolate Unclassified
134 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
135 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
136 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
137 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
138 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
139 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
140 2773857759 Microbacterium sp. 1294 Isolate Unclassified
141 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
142 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
143 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
144 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
145 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
146 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
147 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
148 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
149 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
150 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
151 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
152 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
153 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
154 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
155 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
156 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
157 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
158 2919069694 Microbacterium sp. 1154 Isolate Unclassified
159 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
160 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
161 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
162 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
163 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
164 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
165 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
166 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
167 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
168 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
169 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
170 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
171 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
172 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
173 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
174 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
175 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
176 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
177 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
178 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
179 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
180 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
181 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
182 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
183 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.47
Metatranscriptomes 0
Isolates 21.53

Biome Distribution

Category Percentage (%)
Aerial Root 0.73
Bulb 0
Endosphere 10.95
Nodule 0
Rhizoplane 9.49
Rhizosphere 48.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496118_0303135 3300048921 Bacteria 876
2 JGI24740J21852_10034079 3300001979 Bacteria 1608
3 Ga0068869_100362382 3300005334 Bacteria 1184
4 Ga0068868_100358043 3300005338 Bacteria 1251
5 Ga0070660_100784209 3300005339 Bacteria 801
6 Ga0070668_100069216 3300005347 Bacteria 2745
7 Ga0070675_100398716 3300005354 Bacteria 1227
8 Ga0070663_100594314 3300005455 Bacteria 930
9 Ga0070678_100210380 3300005456 Bacteria 1611
10 Ga0070678_100319672 3300005456 Bacteria 1325
11 Ga0070678_100752016 3300005456 Bacteria 882
12 Ga0070679_100755787 3300005530 Bacteria 915
13 Ga0068853_100281873 3300005539 Bacteria 1532
14 Ga0070672_101038973 3300005543 Bacteria 727
15 Ga0070696_100686631 3300005546 Bacteria 833
16 Ga0070665_100072188 3300005548 Bacteria 3460
17 Ga0068855_101472172 3300005563 Bacteria 700
18 Ga0068856_100873702 3300005614 Bacteria 918
19 Ga0068856_100954821 3300005614 Bacteria 876
20 Ga0068861_100037062 3300005719 Bacteria 3624
21 Ga0068870_10005248 3300005840 Bacteria 5640
22 Ga0068862_100374698 3300005844 Bacteria 1326
23 Ga0075365_10092204 3300006038 Bacteria 2065
24 Ga0075365_10121732 3300006038 Bacteria 1800
25 Ga0075363_100130795 3300006048 Bacteria 1407
26 Ga0075364_10027048 3300006051 Bacteria 3661
27 Ga0075364_10076653 3300006051 Bacteria 2206
28 Ga0075364_10128972 3300006051 Bacteria 1697
29 Ga0075364_10143671 3300006051 Bacteria 1606
30 Ga0075364_10168267 3300006051 Bacteria 1481
31 Ga0075364_10223205 3300006051 Bacteria 1279
32 Ga0075364_10328250 3300006051 Bacteria 1042
33 Ga0075367_10021822 3300006178 Bacteria 3584
34 Ga0075367_10121733 3300006178 Bacteria 1608
35 Ga0075369_10014400 3300006186 Bacteria 3158
36 Ga0075370_10059678 3300006353 Bacteria 2171
37 Ga0075428_100946748 3300006844 Bacteria 913
38 Ga0105244_10016628 3300009036 Bacteria 4184
39 Ga0105244_10016629 3300009036 Bacteria 4184
40 Ga0105244_10167782 3300009036 Bacteria 1046
41 Ga0111539_10376384 3300009094 Bacteria 1653
42 Ga0105243_10039989 3300009148 Bacteria 3659
43 Ga0105243_10352680 3300009148 Bacteria 1352
44 Ga0105243_10387639 3300009148 Bacteria 1294
45 Ga0105243_11285085 3300009148 Bacteria 748
46 Ga0105239_11855669 3300010375 Bacteria 699
47 Ga0157371_10024678 3300013102 Bacteria 4387
48 Ga0157370_10123261 3300013104 Bacteria 2420
49 Ga0157369_10341558 3300013105 Bacteria 1555
50 Ga0171462_1003 3300013250 Bacteria 853796
51 Ga0163162_10105762 3300013306 Bacteria 2908
52 Ga0157372_10480056 3300013307 Bacteria 1449
53 Ga0157375_10468855 3300013308 Bacteria 1424
54 Ga0163163_10933004 3300014325 Bacteria 931
55 Ga0157380_10014779 3300014326 Bacteria 5717
56 Ga0209646_1000248 3300025246 Bacteria 54666
57 Ga0209759_1030182 3300025256 Bacteria 1075
58 Ga0207655_1005377 3300025728 Bacteria 8721
59 Ga0207655_1179026 3300025728 Bacteria 649
60 Ga0207692_10013042 3300025898 Bacteria 3593
61 Ga0207692_10281555 3300025898 Bacteria 1006
62 Ga0207688_10128205 3300025901 Bacteria 1486
63 Ga0207647_10022807 3300025904 Bacteria 4152
64 Ga0207662_10118322 3300025918 Bacteria 1659
65 Ga0207652_10353899 3300025921 Bacteria 1325
66 Ga0207709_10247003 3300025935 Bacteria 1301
67 Ga0207691_10909550 3300025940 Bacteria 736
68 Ga0207689_10158367 3300025942 Bacteria 1866
69 Ga0207667_10610866 3300025949 Bacteria 1099
70 Ga0207639_10336738 3300026041 Bacteria 1344
71 Ga0207678_10242782 3300026067 Bacteria 1543
72 Ga0207678_10532863 3300026067 Bacteria 1026
73 Ga0207702_10766270 3300026078 Bacteria 953
74 Ga0207675_100411690 3300026118 Bacteria 1334
75 Ga0207683_10279938 3300026121 Bacteria 1524
76 Ga0207683_10351856 3300026121 Bacteria 1352
77 Ga0265327_10182760 3300031251 Bacteria 958
78 Ga0307514_10001412 3300031649 Bacteria 29641
79 Ga0307405_10298533 3300031731 Bacteria 1221
80 Ga0307406_10000034 3300031901 Bacteria 83739
81 Ga0307406_10000392 3300031901 Bacteria 25311
82 Ga0307406_10009054 3300031901 Bacteria 5568
83 Ga0307406_10019285 3300031901 Bacteria 4001
84 Ga0307406_10199709 3300031901 Bacteria 1471
85 Ga0307406_10340321 3300031901 Bacteria 1168
86 Ga0307412_10310247 3300031911 Bacteria 1251
87 Ga0307409_100185770 3300031995 Bacteria 1845
88 Ga0307409_100198129 3300031995 Bacteria 1794
89 Ga0307409_100774566 3300031995 Bacteria 965
90 Ga0307416_100529045 3300032002 Bacteria 1249
91 Ga0307416_101103892 3300032002 Bacteria 898
92 Ga0307414_10086854 3300032004 Bacteria 2309
93 Ga0307414_10107864 3300032004 Bacteria 2111
94 Ga0307414_11228103 3300032004 Bacteria 694
95 Ga0307414_11347054 3300032004 Bacteria 663
96 Ga0307411_11285368 3300032005 Bacteria 666
97 Ga0307415_100067491 3300032126 Bacteria 2500
98 Ga0307415_100192191 3300032126 Bacteria 1612
99 Ga0395898_0114095 3300037466 Bacteria 2589
100 Ga0395898_0178437 3300037466 Bacteria 2030
101 Ga0395901_0131452 3300038443 Bacteria 2630
102 Ga0439465_0148475 3300041413 Bacteria 836
103 Ga0451789_0303884 3300041443 Bacteria 1333
104 Ga0451791_1499039 3300041451 Bacteria 1403
105 Ga0451797_0026632 3300041453 Bacteria 614
106 Ga0451841_1039008 3300041498 Bacteria 1754
107 Ga0451841_1165843 3300041498 Bacteria 1529
108 Ga0451847_0347010 3300041503 Bacteria 1127
109 Ga0451853_1690663 3300041512 Bacteria 1106
110 Ga0450920_036681 3300042122 Bacteria 973
111 Ga0466972_0147301 3300044658 Bacteria 1107
112 Ga0466968_0139471 3300044735 Bacteria 1108
113 Ga0466968_0169124 3300044735 Bacteria 1012
114 Ga0466970_0000004 3300044765 Bacteria 108620
115 Ga0466970_0054681 3300044765 Bacteria 2132
116 Ga0466957_0538404 3300044842 Bacteria 813
117 Ga0466960_0780705 3300044901 Bacteria 577
118 Ga0466967_0411923 3300045976 Bacteria 1316
119 Ga0495627_000214 3300046453 Bacteria 62803
120 Ga0495654_0036011 3300046530 Bacteria 2489
121 Ga0495645_0050685 3300046543 Bacteria 3022
122 Ga0495656_0576281 3300046615 Bacteria 601
123 Ga0495671_0320092 3300046692 Bacteria 745
124 Ga0496100_0852972 3300048903 Bacteria 714
125 Ga0496101_0033704 3300048904 Bacteria 3613
126 Ga0496102_0019244 3300048905 Bacteria 6014
127 Ga0496102_0571387 3300048905 Bacteria 1053
128 Ga0496103_0164750 3300048906 Bacteria 1422
129 Ga0496104_0049226 3300048907 Bacteria 3975
130 Ga0496105_0151989 3300048908 Bacteria 1902
131 Ga0496105_0515669 3300048908 Bacteria 937
132 Ga0496105_0689172 3300048908 Bacteria 785
133 Ga0496108_0027156 3300048911 Bacteria 4724
134 Ga0496108_1298753 3300048911 Bacteria 612
135 Ga0496109_1769408 3300048912 Bacteria 551
136 Ga0496110_0280273 3300048913 Bacteria 1518
137 Ga0496111_0328116 3300048914 Bacteria 1133
138 Ga0496112_0171615 3300048915 Bacteria 2134
139 Ga0496113_0080582 3300048916 Bacteria 2494
140 Ga0496113_0818438 3300048916 Bacteria 739
141 Ga0496114_0021169 3300048917 Bacteria 5288
142 Ga0496114_0033837 3300048917 Bacteria 4214
143 Ga0496114_0134787 3300048917 Bacteria 2135
144 Ga0496114_0150976 3300048917 Bacteria 2015
145 Ga0496114_0470776 3300048917 Bacteria 1112
146 Ga0496115_0510920 3300048918 Bacteria 964
147 Ga0496116_0041678 3300048919 Bacteria 3147
148 Ga0496117_0000232 3300048920 Bacteria 105479
149 Ga0496117_0001383 3300048920 Bacteria 35268
150 Ga0496117_0002730 3300048920 Bacteria 21670
151 Ga0496117_0007872 3300048920 Bacteria 10249
152 Ga0496117_0042271 3300048920 Bacteria 3327
153 Ga0496117_0194103 3300048920 Bacteria 1153
154 Ga0496118_0018901 3300048921 Bacteria 6182
155 Ga0496118_0055945 3300048921 Bacteria 2971
156 Ga0496118_0056049 3300048921 Bacteria 2966
157 Ga0496119_0001189 3300048922 Bacteria 32563
158 Ga0496119_0004205 3300048922 Bacteria 14453
159 Ga0496119_0005825 3300048922 Bacteria 11646
160 Ga0496119_0010849 3300048922 Bacteria 7619
161 Ga0496120_0001174 3300048923 Bacteria 33434
162 Ga0496120_0001282 3300048923 Bacteria 31373
163 Ga0496120_0004149 3300048923 Bacteria 12462
164 Ga0496120_0004696 3300048923 Bacteria 11275
165 Ga0496120_0068079 3300048923 Bacteria 1965
166 Ga0496122_0000030 3300048925 Bacteria 331586
167 Ga0496122_0002594 3300048925 Bacteria 25336
168 Ga0496122_0002595 3300048925 Bacteria 25327
169 Ga0496122_0004089 3300048925 Bacteria 18484
170 Ga0496122_0012980 3300048925 Bacteria 8216
171 Ga0496122_0014711 3300048925 Bacteria 7544
172 Ga0496123_0000024 3300048926 Bacteria 331587
173 Ga0496123_0000051 3300048926 Bacteria 237095
174 Ga0496123_0001071 3300048926 Bacteria 41360
175 Ga0496123_0002826 3300048926 Bacteria 20537
176 Ga0496124_0007705 3300048927 Bacteria 11387
177 Ga0496124_0034504 3300048927 Bacteria 4439
178 Ga0496124_0043063 3300048927 Bacteria 3882
179 Ga0496124_0122324 3300048927 Bacteria 2078
180 Ga0496125_0000097 3300048928 Bacteria 204607
181 Ga0496125_0002398 3300048928 Bacteria 24410
182 Ga0496125_0004040 3300048928 Bacteria 17201
183 Ga0496125_0024198 3300048928 Bacteria 5587
184 Ga0496125_0031196 3300048928 Bacteria 4753
185 Ga0496125_0051500 3300048928 Bacteria 3395
186 Ga0496125_0221658 3300048928 Bacteria 1218
187 Ga0496126_0002454 3300048929 Bacteria 25035
188 Ga0496126_0008783 3300048929 Bacteria 10845
189 Ga0496126_0067819 3300048929 Bacteria 3186
190 Ga0496126_0199301 3300048929 Bacteria 1691
191 Ga0501033_0274934 3300049570 Bacteria 1190
192 Ga0501034_0000227 3300049571 Bacteria 106244
193 Ga0501034_0064650 3300049571 Bacteria 3672
194 Ga0501034_0657450 3300049571 Bacteria 949
195 Ga0501038_0303993 3300049574 Bacteria 1251
196 Ga0501039_0098897 3300049575 Bacteria 2276
197 Ga0501039_0613959 3300049575 Bacteria 852
198 Ga0501079_0576511 3300049741 Bacteria 885
199 nmdc:mga03n38_177843_c1 3300050490 Bacteria 1088
200 nmdc:mga00v17_134606_c1 3300050491 Bacteria 1581
201 nmdc:mga00v17_224221_c1 3300050491 Bacteria 1217
202 nmdc:mga00v17_227894_c1 3300050491 Bacteria 1207
203 nmdc:mga00v17_37855_c1 3300050491 Bacteria 2882
204 nmdc:mga00v17_63555_c2 3300050491 Bacteria 1685
205 nmdc:mga00v17_73084_c1 3300050491 Bacteria 2129
206 nmdc:mga00v17_85963_c1 3300050491 Bacteria 1970
207 nmdc:mga0yw44_5524_c1 3300050492 Bacteria 5990
208 nmdc:mga06z11_52975_c1 3300050494 Bacteria 2085
209 nmdc:mga07m45_318760_c1 3300050496 Bacteria 904
210 nmdc:mga08y16_387712_c1 3300050511 Bacteria 1431
211 nmdc:mga0sz30_63282_c1 3300050516 Bacteria 1583
212 Ga0500650_0016204 3300053098 Bacteria 3193
213 Ga0500577_0001723 3300053142 Bacteria 5601
214 Ga0500577_0015773 3300053142 Bacteria 2368
215 Ga0500577_0308333 3300053142 Bacteria 691
216 2586062753 2585427649 Bacteria 9053857
217 2587862503 2585428094 Bacteria 3604039
218 2588108170 2585428157 Bacteria 3018951
219 2643733325 2643221542 Bacteria 3563959
220 2643753547 2643221546 Bacteria 2910897
221 2643786186 2643221553 Bacteria 3544260
222 2643848038 2643221566 Bacteria 3460379
223 2643885065 2643221575 Bacteria 4022601
224 2644169899 2643221630 Bacteria 3601215
225 2644199441 2643221635 Bacteria 2632343
226 2644680579 2643221724 Bacteria 3593515
227 2730230039 2728369380 Bacteria 3620317
228 2747952762 2747842429 Bacteria 3914386
229 2758227212 2757320536 Bacteria 3629334
230 2774381615 2773857758 Bacteria 3592392
231 2774384752 2773857759 Bacteria 2963774
232 2774399864 2773857763 Bacteria 4180068
233 2808631478 2808606306 Bacteria 3608896
234 2808885364 2808606368 Bacteria 3174172
235 2809227116 2808606447 Bacteria 3572005
236 2812322797 2811994872 Bacteria 4121241
237 2821269673 2821268502 Bacteria 3750023
238 2833710620 2833709550 Bacteria 4008291
239 2852633503 2852632344 Bacteria 3463163
240 2852648740 2852646457 Bacteria 3408613
241 2852666887 2852663356 Bacteria 4090475
242 2857720523 2857720070 Bacteria 3189373
243 2857724244 2857723135 Bacteria 4217853
244 2870623302 2870622029 Bacteria 3643329
245 2870630039 2870628048 Bacteria 3696012
246 2895661100 2895660088 Bacteria 3782833
247 2904512729 2904509784 Bacteria 3520416
248 2908681273 2908678064 Bacteria 3482747
249 2919071437 2919069694 Bacteria 3622919
250 2919445893 2919443155 Bacteria 4072969
251 2928092393 2928090899 Bacteria 3158267
252 2939657736 2939657138 Bacteria 3740283
253 2939660917 2939660829 Bacteria 3784848
254 2945968166 2945968032 Bacteria 4111363
255 2946033420 2946033335 Bacteria 3835514
256 2946044665 2946041624 Bacteria 4191385
257 2946080565 2946080515 Bacteria 4310960
258 2966924692 2966924647 Bacteria 3268643
259 2974297749 2974294766 Bacteria 3767688
260 2974326017 2974324384 Bacteria 3750535
261 2977230979 2977228692 Bacteria 3450105
262 2977239775 2977236895 Bacteria 3569373
263 2977253665 2977251589 Bacteria 2952848
264 2977266216 2977264416 Bacteria 3750737
265 2984545952 2984542743 Bacteria 3569378
266 2984580841 2984580707 Bacteria 3351387
267 2995728263 2995726249 Bacteria 3470435
268 8002812873 8002811521 Bacteria 2942897
269 8004184811 8004182704 Bacteria 3391155
270 8004214418 8004212874 Bacteria 2861420
271 8016257925 8016254467 Bacteria 3797036
272 8045830847 8045830549 Bacteria 4444727
273 8055035719 8055034563 Bacteria 3562128
274 8055038725 8055037949 Bacteria 3337834
275 Ga0496118_0303135
276 JGI24740J21852_10034079
277 Ga0068869_100362382
278 Ga0068868_100358043
279 Ga0070660_100784209
280 Ga0070668_100069216
281 Ga0070675_100398716
282 Ga0070663_100594314
283 Ga0070678_100210380
284 Ga0070678_100319672
285 Ga0070678_100752016
286 Ga0070679_100755787
287 Ga0068853_100281873
288 Ga0070672_101038973
289 Ga0070696_100686631
290 Ga0070665_100072188
291 Ga0068855_101472172
292 Ga0068856_100873702
293 Ga0068856_100954821
294 Ga0068861_100037062
295 Ga0068870_10005248
296 Ga0068862_100374698
297 Ga0075365_10092204
298 Ga0075365_10121732
299 Ga0075363_100130795
300 Ga0075364_10027048
301 Ga0075364_10076653
302 Ga0075364_10128972
303 Ga0075364_10143671
304 Ga0075364_10168267
305 Ga0075364_10223205
306 Ga0075364_10328250
307 Ga0075367_10021822
308 Ga0075367_10121733
309 Ga0075369_10014400
310 Ga0075370_10059678
311 Ga0075428_100946748
312 Ga0105244_10016628
313 Ga0105244_10016629
314 Ga0105244_10167782
315 Ga0111539_10376384
316 Ga0105243_10039989
317 Ga0105243_10352680
318 Ga0105243_10387639
319 Ga0105243_11285085
320 Ga0105239_11855669
321 Ga0157371_10024678
322 Ga0157370_10123261
323 Ga0157369_10341558
324 Ga0171462_1003
325 Ga0163162_10105762
326 Ga0157372_10480056
327 Ga0157375_10468855
328 Ga0163163_10933004
329 Ga0157380_10014779
330 Ga0209646_1000248
331 Ga0209759_1030182
332 Ga0207655_1005377
333 Ga0207655_1179026
334 Ga0207692_10013042
335 Ga0207692_10281555
336 Ga0207688_10128205
337 Ga0207647_10022807
338 Ga0207662_10118322
339 Ga0207652_10353899
340 Ga0207709_10247003
341 Ga0207691_10909550
342 Ga0207689_10158367
343 Ga0207667_10610866
344 Ga0207639_10336738
345 Ga0207678_10242782
346 Ga0207678_10532863
347 Ga0207702_10766270
348 Ga0207675_100411690
349 Ga0207683_10279938
350 Ga0207683_10351856
351 Ga0265327_10182760
352 Ga0307514_10001412
353 Ga0307405_10298533
354 Ga0307406_10000034
355 Ga0307406_10000392
356 Ga0307406_10009054
357 Ga0307406_10019285
358 Ga0307406_10199709
359 Ga0307406_10340321
360 Ga0307412_10310247
361 Ga0307409_100185770
362 Ga0307409_100198129
363 Ga0307409_100774566
364 Ga0307416_100529045
365 Ga0307416_101103892
366 Ga0307414_10086854
367 Ga0307414_10107864
368 Ga0307414_11228103
369 Ga0307414_11347054
370 Ga0307411_11285368
371 Ga0307415_100067491
372 Ga0307415_100192191
373 Ga0395898_0114095
374 Ga0395898_0178437
375 Ga0395901_0131452
376 Ga0439465_0148475
377 Ga0451789_0303884
378 Ga0451791_1499039
379 Ga0451797_0026632
380 Ga0451841_1039008
381 Ga0451841_1165843
382 Ga0451847_0347010
383 Ga0451853_1690663
384 Ga0450920_036681
385 Ga0466972_0147301
386 Ga0466968_0139471
387 Ga0466968_0169124
388 Ga0466970_0000004
389 Ga0466970_0054681
390 Ga0466957_0538404
391 Ga0466960_0780705
392 Ga0466967_0411923
393 Ga0495627_000214
394 Ga0495654_0036011
395 Ga0495645_0050685
396 Ga0495656_0576281
397 Ga0495671_0320092
398 Ga0496100_0852972
399 Ga0496101_0033704
400 Ga0496102_0019244
401 Ga0496102_0571387
402 Ga0496103_0164750
403 Ga0496104_0049226
404 Ga0496105_0151989
405 Ga0496105_0515669
406 Ga0496105_0689172
407 Ga0496108_0027156
408 Ga0496108_1298753
409 Ga0496109_1769408
410 Ga0496110_0280273
411 Ga0496111_0328116
412 Ga0496112_0171615
413 Ga0496113_0080582
414 Ga0496113_0818438
415 Ga0496114_0021169
416 Ga0496114_0033837
417 Ga0496114_0134787
418 Ga0496114_0150976
419 Ga0496114_0470776
420 Ga0496115_0510920
421 Ga0496116_0041678
422 Ga0496117_0000232
423 Ga0496117_0001383
424 Ga0496117_0002730
425 Ga0496117_0007872
426 Ga0496117_0042271
427 Ga0496117_0194103
428 Ga0496118_0018901
429 Ga0496118_0055945
430 Ga0496118_0056049
431 Ga0496119_0001189
432 Ga0496119_0004205
433 Ga0496119_0005825
434 Ga0496119_0010849
435 Ga0496120_0001174
436 Ga0496120_0001282
437 Ga0496120_0004149
438 Ga0496120_0004696
439 Ga0496120_0068079
440 Ga0496122_0000030
441 Ga0496122_0002594
442 Ga0496122_0002595
443 Ga0496122_0004089
444 Ga0496122_0012980
445 Ga0496122_0014711
446 Ga0496123_0000024
447 Ga0496123_0000051
448 Ga0496123_0001071
449 Ga0496123_0002826
450 Ga0496124_0007705
451 Ga0496124_0034504
452 Ga0496124_0043063
453 Ga0496124_0122324
454 Ga0496125_0000097
455 Ga0496125_0002398
456 Ga0496125_0004040
457 Ga0496125_0024198
458 Ga0496125_0031196
459 Ga0496125_0051500
460 Ga0496125_0221658
461 Ga0496126_0002454
462 Ga0496126_0008783
463 Ga0496126_0067819
464 Ga0496126_0199301
465 Ga0501033_0274934
466 Ga0501034_0000227
467 Ga0501034_0064650
468 Ga0501034_0657450
469 Ga0501038_0303993
470 Ga0501039_0098897
471 Ga0501039_0613959
472 Ga0501079_0576511
473 nmdc:mga03n38_177843_c1
474 nmdc:mga00v17_134606_c1
475 nmdc:mga00v17_224221_c1
476 nmdc:mga00v17_227894_c1
477 nmdc:mga00v17_37855_c1
478 nmdc:mga00v17_63555_c2
479 nmdc:mga00v17_73084_c1
480 nmdc:mga00v17_85963_c1
481 nmdc:mga0yw44_5524_c1
482 nmdc:mga06z11_52975_c1
483 nmdc:mga07m45_318760_c1
484 nmdc:mga08y16_387712_c1
485 nmdc:mga0sz30_63282_c1
486 Ga0500650_0016204
487 Ga0500577_0001723
488 Ga0500577_0015773
489 Ga0500577_0308333
490 2586062753
491 2587862503
492 2588108170
493 2643733325
494 2643753547
495 2643786186
496 2643848038
497 2643885065
498 2644169899
499 2644199441
500 2644680579
501 2730230039
502 2747952762
503 2758227212
504 2774381615
505 2774384752
506 2774399864
507 2808631478
508 2808885364
509 2809227116
510 2812322797
511 2821269673
512 2833710620
513 2852633503
514 2852648740
515 2852666887
516 2857720523
517 2857724244
518 2870623302
519 2870630039
520 2895661100
521 2904512729
522 2908681273
523 2919071437
524 2919445893
525 2928092393
526 2939657736
527 2939660917
528 2945968166
529 2946033420
530 2946044665
531 2946080565
532 2966924692
533 2974297749
534 2974326017
535 2977230979
536 2977239775
537 2977253665
538 2977266216
539 2984545952
540 2984580841
541 2995728263
542 8002812873
543 8004184811
544 8004214418
545 8016257925
546 8045830847
547 8055035719
548 8055038725

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

3

150

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pn3-assembly1.cif.gz_A crystal structure of arabidopsis thaliana petide deformylase 1b (atpdf1b) in complex with inhibitor 21 0.9401 5 159
3pn5-assembly1.cif.gz_A crystal structure of arabidopsis thaliana petide deformylase 1b (atpdf1b) g41q mutant 0.9357 5 159
6jf4-assembly1.cif.gz_A k1u bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii 0.9335 1 144
5mte-assembly2.cif.gz_B crystal structure of pdf from the vibrio parahaemolyticus bacteriophage vp16t in complex with actinonin - crystal form ii 0.9317 5 140
6jf4-assembly1.cif.gz_B k1u bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii 0.9316 1 145
ID Description Score Start End Superfamily
5mtdB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9307 5 140 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9303 1 147 3.90.45.10
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.93 1 145 3.90.45.10
3e3uA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9285 2 159 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9243 1 147 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A1R4HLG4-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9965 25 163 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A840DQ41-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9934 1 163 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A2S5UX42-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9913 1 163 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A373DT04-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9912 1 163 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A6J7CII7-F1-model_v4 peptide deformylase (EC 3.5.1.88) 0.9911 1 163 GO:0042586
GO:0043686

Map