F380189

General Info

Members Datasets Scaffolds Average Seq Length
275 215 550 230

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100530034|Ga0070680_1005300341
Length 260
Sequence VSGSRPLPGQPGPGTAANEEWASAGPSPRQPVPVVFVPGLLCTPRLYQDQIERLWPLGPVTIADHTRDDSVASIARRILHSAPPRFMLVGLSMGGYISFEILRQAPERVTRLALLDTTARPDAPEQAESRRALIALAGSGGFGEIADRLFASLVAPQHRDDGPLRQIVRTMARDVGPEAFVRQQNAIMGRPDSRPTLEQIRCPTLVLVGEQDALTPPERASEIAAGIRGSRLVSVAGCGHLSTLERPAEVSRALTELLQS

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
114 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
115 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
120 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
121 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
122 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
133 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
134 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
135 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
136 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
137 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
166 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
194 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
195 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
196 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
197 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
198 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
199 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
200 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
201 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
204 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
205 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
206 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
207 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
208 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
209 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
210 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
211 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
212 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
213 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
214 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
215 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.27
Metatranscriptomes 0
Isolates 4.73

Biome Distribution

Category Percentage (%)
Aerial Root 0.73
Bulb 0
Endosphere 12
Nodule 0.36
Rhizoplane 2.91
Rhizosphere 76.36
Stem 0
Stem Tuber 0
Unclassified 2.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100530034 3300005336 Bacteria 1009
2 JGI25157J39369_1014706 3300002741 Bacteria 969
3 JGI25151J46595_10000044 3300003187 Bacteria 170418
4 rootH2_10111590 3300003320 Bacteria 1152
5 rootH2_10162982 3300003320 Bacteria 2138
6 rootL2_10129054 3300003322 Bacteria 2435
7 Ga0055526_1000091 3300003771 Bacteria 82891
8 Ga0055531_10004091 3300003794 Bacteria 9029
9 Ga0055543_1005804 3300004625 Bacteria 3094
10 Ga0065165_1002439 3300005262 Bacteria 15748
11 Ga0065165_1025805 3300005262 Bacteria 1946
12 Ga0070683_100358729 3300005329 Bacteria 1388
13 Ga0070670_100080315 3300005331 Bacteria 2803
14 Ga0070666_10015005 3300005335 Bacteria 4937
15 Ga0070666_10442961 3300005335 Bacteria 937
16 Ga0068868_100029298 3300005338 Bacteria 4215
17 Ga0068868_100231020 3300005338 Bacteria 1552
18 Ga0070668_100010477 3300005347 Bacteria 6891
19 Ga0070669_100030985 3300005353 Bacteria 3861
20 Ga0070671_100136958 3300005355 Bacteria 2064
21 Ga0070673_100044454 3300005364 Bacteria 3439
22 Ga0070673_100086808 3300005364 Bacteria 2550
23 Ga0070659_100006653 3300005366 Bacteria 8353
24 Ga0070659_100098723 3300005366 Bacteria 2348
25 Ga0070667_100000130 3300005367 Bacteria 95182
26 Ga0070667_100535482 3300005367 Unclassified 1075
27 Ga0070701_10150560 3300005438 Bacteria 1339
28 Ga0070711_100127179 3300005439 Bacteria 1893
29 Ga0070663_100229652 3300005455 Bacteria 1461
30 Ga0070678_100183268 3300005456 Bacteria 1716
31 Ga0070662_100064035 3300005457 Bacteria 2691
32 Ga0070681_10000669 3300005458 Bacteria 28356
33 Ga0070681_10069282 3300005458 Bacteria 3494
34 Ga0068867_100138659 3300005459 Bacteria 1899
35 Ga0070698_100046453 3300005471 Bacteria 4440
36 Ga0070698_100545046 3300005471 Bacteria 1099
37 Ga0070679_100004175 3300005530 Bacteria 13317
38 Ga0070679_100211396 3300005530 Bacteria 1904
39 Ga0070672_100164766 3300005543 Bacteria 1841
40 Ga0070665_100351859 3300005548 Bacteria 1479
41 Ga0068855_100019362 3300005563 Bacteria 8178
42 Ga0070664_100057544 3300005564 Bacteria 3305
43 Ga0070664_100062451 3300005564 Bacteria 3176
44 Ga0068857_100044800 3300005577 Bacteria 3925
45 Ga0068854_100366359 3300005578 Bacteria 1184
46 Ga0068856_100006229 3300005614 Bacteria 11707
47 Ga0068856_100095657 3300005614 Bacteria 2958
48 Ga0068856_100670293 3300005614 Bacteria 1058
49 Ga0068866_10035205 3300005718 Bacteria 2444
50 Ga0068863_100000029 3300005841 Bacteria 177191
51 Ga0068863_100198830 3300005841 Bacteria 1927
52 Ga0068860_100059997 3300005843 Bacteria 3616
53 Ga0081540_1007125 3300005983 Bacteria 8023
54 Ga0081540_1030754 3300005983 Bacteria 2968
55 Ga0081539_10004115 3300005985 Bacteria 16576
56 Ga0070717_10099378 3300006028 Bacteria 2469
57 Ga0075364_10055562 3300006051 Bacteria 2590
58 Ga0075364_10103476 3300006051 Bacteria 1896
59 Ga0075364_10107486 3300006051 Bacteria 1860
60 Ga0070712_100016574 3300006175 Bacteria 4760
61 Ga0070712_100500529 3300006175 Bacteria 1018
62 Ga0075362_10026425 3300006177 Bacteria 2479
63 Ga0075362_10034897 3300006177 Bacteria 2194
64 Ga0075362_10070545 3300006177 Bacteria 1595
65 Ga0075366_10028626 3300006195 Bacteria 3270
66 Ga0075428_100083811 3300006844 Bacteria 3478
67 Ga0075431_100243703 3300006847 Bacteria 1828
68 Ga0075433_10787529 3300006852 Bacteria 831
69 Ga0075429_100524587 3300006880 Bacteria 1038
70 Ga0068865_100067905 3300006881 Bacteria 2519
71 Ga0105251_10001747 3300009011 Bacteria 18146
72 Ga0105244_10021467 3300009036 Bacteria 3571
73 Ga0114129_10116927 3300009147 Bacteria 3674
74 Ga0105241_10140359 3300009174 Bacteria 1966
75 Ga0105241_10977786 3300009174 Unclassified 790
76 Ga0105248_10001357 3300009177 Bacteria 27293
77 Ga0105248_10072466 3300009177 Bacteria 3872
78 Ga0105238_10035615 3300009551 Bacteria 5059
79 Ga0105238_10040446 3300009551 Bacteria 4724
80 Ga0105249_10208748 3300009553 Bacteria 1915
81 Ga0105239_10108325 3300010375 Bacteria 3078
82 Ga0105239_10263807 3300010375 Bacteria 1936
83 Ga0105239_10649362 3300010375 Bacteria 1205
84 Ga0157371_10001847 3300013102 Bacteria 21300
85 Ga0157371_10052458 3300013102 Bacteria 2896
86 Ga0157371_10181924 3300013102 Bacteria 1503
87 Ga0157370_10001797 3300013104 Bacteria 26441
88 Ga0157369_10004191 3300013105 Bacteria 17079
89 Ga0157369_10025345 3300013105 Bacteria 6584
90 Ga0157374_10972454 3300013296 Unclassified 868
91 Ga0157378_10093342 3300013297 Bacteria 2739
92 Ga0157378_10156766 3300013297 Bacteria 2126
93 Ga0163162_10406362 3300013306 Bacteria 1494
94 Ga0157372_10023641 3300013307 Bacteria 6666
95 Ga0157372_10816391 3300013307 Bacteria 1083
96 Ga0157375_10213003 3300013308 Bacteria 2090
97 Ga0163163_10038024 3300014325 Bacteria 4686
98 Ga0163163_10040827 3300014325 Bacteria 4533
99 Ga0157376_10272909 3300014969 Bacteria 1589
100 Ga0213871_10099386 3300021441 Bacteria 850
101 Ga0209026_1002760 3300025250 Bacteria 6276
102 Ga0209564_1000017 3300025295 Bacteria 594063
103 Ga0209758_1000431 3300025297 Bacteria 71115
104 Ga0209050_1000098 3300025298 Bacteria 236717
105 Ga0209257_1000221 3300025304 Bacteria 134870
106 Ga0209257_1000638 3300025304 Bacteria 56121
107 Ga0207713_1018114 3300025735 Bacteria 3497
108 Ga0207642_10010674 3300025899 Bacteria 3249
109 Ga0207688_10464332 3300025901 Bacteria 790
110 Ga0207680_10011052 3300025903 Bacteria 4545
111 Ga0207699_10028168 3300025906 Bacteria 3119
112 Ga0207645_10017507 3300025907 Bacteria 4728
113 Ga0207705_10372226 3300025909 Bacteria 1103
114 Ga0207707_10000408 3300025912 Bacteria 45020
115 Ga0207707_10010675 3300025912 Bacteria 7981
116 Ga0207707_10057889 3300025912 Bacteria 3373
117 Ga0207695_10002946 3300025913 Bacteria 24559
118 Ga0207693_10018455 3300025915 Bacteria 5557
119 Ga0207663_10275274 3300025916 Bacteria 1248
120 Ga0207660_10032907 3300025917 Bacteria 3582
121 Ga0207657_10014657 3300025919 Bacteria 7639
122 Ga0207652_10012101 3300025921 Bacteria 6967
123 Ga0207681_10022283 3300025923 Bacteria 4039
124 Ga0207694_10008477 3300025924 Bacteria 7760
125 Ga0207694_10238119 3300025924 Bacteria 1487
126 Ga0207650_10130126 3300025925 Bacteria 1969
127 Ga0207700_10071342 3300025928 Bacteria 2674
128 Ga0207644_10184025 3300025931 Bacteria 1639
129 Ga0207690_10072330 3300025932 Bacteria 2381
130 Ga0207706_10081140 3300025933 Bacteria 2850
131 Ga0207706_10124392 3300025933 Bacteria 2269
132 Ga0207669_10043704 3300025937 Bacteria 2626
133 Ga0207711_10000843 3300025941 Bacteria 29642
134 Ga0207711_10075103 3300025941 Bacteria 2941
135 Ga0207679_10042320 3300025945 Bacteria 3273
136 Ga0207679_10201586 3300025945 Bacteria 1662
137 Ga0207667_10003991 3300025949 Bacteria 18133
138 Ga0207668_10003902 3300025972 Bacteria 8787
139 Ga0207640_10280529 3300025981 Bacteria 1308
140 Ga0207658_10000100 3300025986 Bacteria 95179
141 Ga0207677_10186237 3300026023 Bacteria 1638
142 Ga0207678_10128948 3300026067 Bacteria 2157
143 Ga0207678_10382961 3300026067 Unclassified 1216
144 Ga0207702_10004851 3300026078 Bacteria 11844
145 Ga0207702_10405163 3300026078 Bacteria 1316
146 Ga0207702_10634073 3300026078 Bacteria 1050
147 Ga0207641_10000049 3300026088 Bacteria 177222
148 Ga0207641_10056474 3300026088 Bacteria 3337
149 Ga0207676_10019141 3300026095 Bacteria 4989
150 Ga0207674_10039576 3300026116 Bacteria 4886
151 Ga0207683_10008827 3300026121 Bacteria 8596
152 Ga0207683_10060244 3300026121 Bacteria 3337
153 Ga0207698_10336569 3300026142 Bacteria 1420
154 Ga0209974_10071312 3300027876 Bacteria 1185
155 Ga0268264_10079608 3300028381 Bacteria 2796
156 Ga0307517_10000196 3300028786 Bacteria 102384
157 Ga0268256_1033721 3300030500 Bacteria 1207
158 Ga0314311_1051972 3300030733 Bacteria 3768
159 Ga0265331_10093848 3300031250 Unclassified 1385
160 Ga0307508_10227516 3300031616 Bacteria 1464
161 Ga0265314_10128119 3300031711 Bacteria 1587
162 Ga0373926_0087011 3300035083 Bacteria 1160
163 Ga0373944_0044560 3300035089 Bacteria 1382
164 Ga0373945_0020284 3300035116 Bacteria 2273
165 Ga0373960_0063203 3300035121 Bacteria 1128
166 Ga0373943_0028548 3300035170 Bacteria 2629
167 Ga0373942_0030491 3300035207 Bacteria 1421
168 Ga0373935_0235295 3300035692 Bacteria 1277
169 Ga0373927_0195998 3300035695 Bacteria 1325
170 Ga0373925_0295748 3300037068 Bacteria 1306
171 Ga0395905_0004068 3300037471 Bacteria 15326
172 Ga0395905_0013681 3300037471 Bacteria 7772
173 Ga0395905_0087249 3300037471 Bacteria 2925
174 Ga0237819_00331 3300038705 Bacteria 17340
175 Ga0436365_1181058 3300039437 Bacteria 3361
176 Ga0436363_0733387 3300039450 Bacteria 4276
177 Ga0436363_0746016 3300039450 Bacteria 1521
178 Ga0439436_0008302 3300041404 Bacteria 3191
179 Ga0439447_000864 3300041407 Bacteria 11127
180 Ga0439466_0079879 3300041411 Bacteria 1032
181 Ga0439432_001445 3300042006 Bacteria 8920
182 Ga0439452_000774 3300042010 Bacteria 15217
183 Ga0439446_0007778 3300042156 Bacteria 2825
184 Ga0453684_0116896 3300044712 Bacteria 3228
185 Ga0451576_0078324 3300045051 Bacteria 3440
186 Ga0495629_0017418 3300046459 Bacteria 5149
187 Ga0495629_0417317 3300046459 Unclassified 911
188 Ga0495638_0021946 3300046460 Bacteria 4196
189 Ga0495653_0241592 3300046463 Bacteria 1203
190 Ga0495650_0001375 3300046471 Bacteria 24009
191 Ga0495650_0015683 3300046471 Bacteria 3876
192 Ga0495639_0205805 3300046475 Bacteria 964
193 Ga0495662_0009013 3300046476 Bacteria 4899
194 Ga0495664_0000314 3300046477 Bacteria 23280
195 Ga0495583_0010839 3300046506 Bacteria 5277
196 Ga0495618_0162578 3300046514 Bacteria 1423
197 Ga0495618_0224996 3300046514 Bacteria 1182
198 Ga0495620_0069012 3300046515 Bacteria 1451
199 Ga0495630_0003906 3300046517 Bacteria 10422
200 Ga0495642_0013696 3300046528 Bacteria 3141
201 Ga0495642_0056283 3300046528 Bacteria 1624
202 Ga0495652_0123994 3300046529 Bacteria 2056
203 Ga0495640_0202753 3300046533 Bacteria 1256
204 Ga0495586_0129441 3300046535 Bacteria 1413
205 Ga0495586_0358849 3300046535 Bacteria 837
206 Ga0495645_0002928 3300046543 Bacteria 11575
207 Ga0495668_0225871 3300046616 Bacteria 1025
208 Ga0495634_0031190 3300046642 Bacteria 3672
209 Ga0495625_0278689 3300046660 Bacteria 1076
210 Ga0495635_0009928 3300046663 Bacteria 6655
211 Ga0495635_0166919 3300046663 Bacteria 1497
212 Ga0495646_0148270 3300046680 Bacteria 1307
213 Ga0495669_0190160 3300046684 Bacteria 980
214 Ga0495624_0049722 3300046690 Bacteria 2658
215 Ga0495600_0344532 3300046809 Bacteria 934
216 Ga0495674_0041537 3300047319 Bacteria 4107
217 Ga0495672_0018455 3300047320 Bacteria 4629
218 Ga0495677_0054434 3300047445 Bacteria 1476
219 Ga0495684_0108298 3300047471 Bacteria 2098
220 Ga0495686_0015225 3300047472 Bacteria 5262
221 Ga0496102_0067331 3300048905 Bacteria 3285
222 Ga0496107_0640409 3300048910 Bacteria 784
223 Ga0496108_0017567 3300048911 Bacteria 5853
224 Ga0496109_0229961 3300048912 Bacteria 1744
225 Ga0496110_0094835 3300048913 Bacteria 2672
226 Ga0496111_0641404 3300048914 Bacteria 775
227 Ga0496112_0035659 3300048915 Bacteria 4848
228 Ga0496112_0169740 3300048915 Bacteria 2147
229 Ga0496125_0001016 3300048928 Bacteria 43614
230 Ga0496126_0039603 3300048929 Bacteria 4372
231 Ga0496126_0189697 3300048929 Bacteria 1742
232 Ga0496126_0508542 3300048929 Bacteria 961
233 Ga0501034_0113927 3300049571 Bacteria 2693
234 Ga0501034_0237539 3300049571 Bacteria 1769
235 Ga0501034_0307318 3300049571 Bacteria 1521
236 Ga0501072_0001534 3300049588 Bacteria 17271
237 Ga0501073_0380354 3300049589 Bacteria 975
238 Ga0501225_0001698 3300049705 Bacteria 6887
239 Ga0501080_0789097 3300049742 Bacteria 834
240 Ga0501083_0167687 3300049744 Bacteria 1435
241 nmdc:mga03n38_77151_c1 3300050490 Bacteria 1556
242 nmdc:mga00v17_12875_c1 3300050491 Bacteria 4628
243 nmdc:mga00v17_204606_c1 3300050491 Bacteria 1276
244 nmdc:mga0yw44_113864_c1 3300050492 Bacteria 1736
245 nmdc:mga04h51_96905_c1 3300050495 Unclassified 1069
246 nmdc:mga07m45_88460_c1 3300050496 Bacteria 1773
247 nmdc:mga05p37_73244_c1 3300050507 Bacteria 4215
248 Ga0495601_0024429 3300053077 Bacteria 3721
249 Ga0495601_0156487 3300053077 Bacteria 1488
250 Ga0495612_0157779 3300053078 Bacteria 989
251 Ga0495619_0003483 3300053085 Bacteria 10158
252 Ga0495619_0004137 3300053085 Bacteria 9273
253 Ga0500646_0020125 3300053090 Bacteria 1771
254 Ga0500651_0219380 3300053093 Bacteria 1116
255 Ga0500641_0024019 3300053096 Bacteria 2349
256 Ga0500562_001023 3300053108 Bacteria 6847
257 Ga0500595_010608 3300053119 Bacteria 3652
258 Ga0500559_0244396 3300053136 Bacteria 846
259 Ga0500604_0007143 3300053151 Bacteria 2956
260 Ga0500637_0000593 3300053178 Bacteria 14222
261 Ga0500645_001044 3300053730 Bacteria 15423
262 Ga0501082_0000025 3300060353 Bacteria 103262
263 2510283094 2510065053 Bacteria 5005518
264 2510293768 2510065055 Bacteria 5037935
265 2510310626 2510065058 Bacteria 5005894
266 2513675270 2513237098 Bacteria 9902361
267 2523469246 2523231067 Bacteria 5230452
268 2774131207 2773857672 Bacteria 4993178
269 2885389509 2885383462 Bacteria 9473874
270 2917836489 2917832318 Bacteria 5346010
271 2919126484 2919125081 Bacteria 5385106
272 2974302725 2974298342 Bacteria 4840922
273 2984499689 2984499530 Bacteria 5020881
274 2984506840 2984504281 Bacteria 5262371
275 8016731114 8016728285 Bacteria 5263933
276 Ga0070680_100530034
277 JGI25157J39369_1014706
278 JGI25151J46595_10000044
279 rootH2_10111590
280 rootH2_10162982
281 rootL2_10129054
282 Ga0055526_1000091
283 Ga0055531_10004091
284 Ga0055543_1005804
285 Ga0065165_1002439
286 Ga0065165_1025805
287 Ga0070683_100358729
288 Ga0070670_100080315
289 Ga0070666_10015005
290 Ga0070666_10442961
291 Ga0068868_100029298
292 Ga0068868_100231020
293 Ga0070668_100010477
294 Ga0070669_100030985
295 Ga0070671_100136958
296 Ga0070673_100044454
297 Ga0070673_100086808
298 Ga0070659_100006653
299 Ga0070659_100098723
300 Ga0070667_100000130
301 Ga0070667_100535482
302 Ga0070701_10150560
303 Ga0070711_100127179
304 Ga0070663_100229652
305 Ga0070678_100183268
306 Ga0070662_100064035
307 Ga0070681_10000669
308 Ga0070681_10069282
309 Ga0068867_100138659
310 Ga0070698_100046453
311 Ga0070698_100545046
312 Ga0070679_100004175
313 Ga0070679_100211396
314 Ga0070672_100164766
315 Ga0070665_100351859
316 Ga0068855_100019362
317 Ga0070664_100057544
318 Ga0070664_100062451
319 Ga0068857_100044800
320 Ga0068854_100366359
321 Ga0068856_100006229
322 Ga0068856_100095657
323 Ga0068856_100670293
324 Ga0068866_10035205
325 Ga0068863_100000029
326 Ga0068863_100198830
327 Ga0068860_100059997
328 Ga0081540_1007125
329 Ga0081540_1030754
330 Ga0081539_10004115
331 Ga0070717_10099378
332 Ga0075364_10055562
333 Ga0075364_10103476
334 Ga0075364_10107486
335 Ga0070712_100016574
336 Ga0070712_100500529
337 Ga0075362_10026425
338 Ga0075362_10034897
339 Ga0075362_10070545
340 Ga0075366_10028626
341 Ga0075428_100083811
342 Ga0075431_100243703
343 Ga0075433_10787529
344 Ga0075429_100524587
345 Ga0068865_100067905
346 Ga0105251_10001747
347 Ga0105244_10021467
348 Ga0114129_10116927
349 Ga0105241_10140359
350 Ga0105241_10977786
351 Ga0105248_10001357
352 Ga0105248_10072466
353 Ga0105238_10035615
354 Ga0105238_10040446
355 Ga0105249_10208748
356 Ga0105239_10108325
357 Ga0105239_10263807
358 Ga0105239_10649362
359 Ga0157371_10001847
360 Ga0157371_10052458
361 Ga0157371_10181924
362 Ga0157370_10001797
363 Ga0157369_10004191
364 Ga0157369_10025345
365 Ga0157374_10972454
366 Ga0157378_10093342
367 Ga0157378_10156766
368 Ga0163162_10406362
369 Ga0157372_10023641
370 Ga0157372_10816391
371 Ga0157375_10213003
372 Ga0163163_10038024
373 Ga0163163_10040827
374 Ga0157376_10272909
375 Ga0213871_10099386
376 Ga0209026_1002760
377 Ga0209564_1000017
378 Ga0209758_1000431
379 Ga0209050_1000098
380 Ga0209257_1000221
381 Ga0209257_1000638
382 Ga0207713_1018114
383 Ga0207642_10010674
384 Ga0207688_10464332
385 Ga0207680_10011052
386 Ga0207699_10028168
387 Ga0207645_10017507
388 Ga0207705_10372226
389 Ga0207707_10000408
390 Ga0207707_10010675
391 Ga0207707_10057889
392 Ga0207695_10002946
393 Ga0207693_10018455
394 Ga0207663_10275274
395 Ga0207660_10032907
396 Ga0207657_10014657
397 Ga0207652_10012101
398 Ga0207681_10022283
399 Ga0207694_10008477
400 Ga0207694_10238119
401 Ga0207650_10130126
402 Ga0207700_10071342
403 Ga0207644_10184025
404 Ga0207690_10072330
405 Ga0207706_10081140
406 Ga0207706_10124392
407 Ga0207669_10043704
408 Ga0207711_10000843
409 Ga0207711_10075103
410 Ga0207679_10042320
411 Ga0207679_10201586
412 Ga0207667_10003991
413 Ga0207668_10003902
414 Ga0207640_10280529
415 Ga0207658_10000100
416 Ga0207677_10186237
417 Ga0207678_10128948
418 Ga0207678_10382961
419 Ga0207702_10004851
420 Ga0207702_10405163
421 Ga0207702_10634073
422 Ga0207641_10000049
423 Ga0207641_10056474
424 Ga0207676_10019141
425 Ga0207674_10039576
426 Ga0207683_10008827
427 Ga0207683_10060244
428 Ga0207698_10336569
429 Ga0209974_10071312
430 Ga0268264_10079608
431 Ga0307517_10000196
432 Ga0268256_1033721
433 Ga0314311_1051972
434 Ga0265331_10093848
435 Ga0307508_10227516
436 Ga0265314_10128119
437 Ga0373926_0087011
438 Ga0373944_0044560
439 Ga0373945_0020284
440 Ga0373960_0063203
441 Ga0373943_0028548
442 Ga0373942_0030491
443 Ga0373935_0235295
444 Ga0373927_0195998
445 Ga0373925_0295748
446 Ga0395905_0004068
447 Ga0395905_0013681
448 Ga0395905_0087249
449 Ga0237819_00331
450 Ga0436365_1181058
451 Ga0436363_0733387
452 Ga0436363_0746016
453 Ga0439436_0008302
454 Ga0439447_000864
455 Ga0439466_0079879
456 Ga0439432_001445
457 Ga0439452_000774
458 Ga0439446_0007778
459 Ga0453684_0116896
460 Ga0451576_0078324
461 Ga0495629_0017418
462 Ga0495629_0417317
463 Ga0495638_0021946
464 Ga0495653_0241592
465 Ga0495650_0001375
466 Ga0495650_0015683
467 Ga0495639_0205805
468 Ga0495662_0009013
469 Ga0495664_0000314
470 Ga0495583_0010839
471 Ga0495618_0162578
472 Ga0495618_0224996
473 Ga0495620_0069012
474 Ga0495630_0003906
475 Ga0495642_0013696
476 Ga0495642_0056283
477 Ga0495652_0123994
478 Ga0495640_0202753
479 Ga0495586_0129441
480 Ga0495586_0358849
481 Ga0495645_0002928
482 Ga0495668_0225871
483 Ga0495634_0031190
484 Ga0495625_0278689
485 Ga0495635_0009928
486 Ga0495635_0166919
487 Ga0495646_0148270
488 Ga0495669_0190160
489 Ga0495624_0049722
490 Ga0495600_0344532
491 Ga0495674_0041537
492 Ga0495672_0018455
493 Ga0495677_0054434
494 Ga0495684_0108298
495 Ga0495686_0015225
496 Ga0496102_0067331
497 Ga0496107_0640409
498 Ga0496108_0017567
499 Ga0496109_0229961
500 Ga0496110_0094835
501 Ga0496111_0641404
502 Ga0496112_0035659
503 Ga0496112_0169740
504 Ga0496125_0001016
505 Ga0496126_0039603
506 Ga0496126_0189697
507 Ga0496126_0508542
508 Ga0501034_0113927
509 Ga0501034_0237539
510 Ga0501034_0307318
511 Ga0501072_0001534
512 Ga0501073_0380354
513 Ga0501225_0001698
514 Ga0501080_0789097
515 Ga0501083_0167687
516 nmdc:mga03n38_77151_c1
517 nmdc:mga00v17_12875_c1
518 nmdc:mga00v17_204606_c1
519 nmdc:mga0yw44_113864_c1
520 nmdc:mga04h51_96905_c1
521 nmdc:mga07m45_88460_c1
522 nmdc:mga05p37_73244_c1
523 Ga0495601_0024429
524 Ga0495601_0156487
525 Ga0495612_0157779
526 Ga0495619_0003483
527 Ga0495619_0004137
528 Ga0500646_0020125
529 Ga0500651_0219380
530 Ga0500641_0024019
531 Ga0500562_001023
532 Ga0500595_010608
533 Ga0500559_0244396
534 Ga0500604_0007143
535 Ga0500637_0000593
536 Ga0500645_001044
537 Ga0501082_0000025
538 2510283094
539 2510293768
540 2510310626
541 2513675270
542 2523469246
543 2774131207
544 2885389509
545 2917836489
546 2919126484
547 2974302725
548 2984499689
549 2984506840
550 8016731114

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03096

Ndr

Ndr family

69

260

0.84

PF08386

Abhydrolase_4

TAP-like protein

183

260

0.81

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

50

247

0.69

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

7

253

0.6

Structural Annotation

Top 5 Hits

ID Description Score Start End
4uhd-assembly1.cif.gz_A structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) 0.9098 4 234
2xua-assembly1.cif.gz_A crystal structure of the enol-lactonase from burkholderia xenovorans lb400 0.8959 1 231
4uhd-assembly1.cif.gz_A structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) 0.8913 4 234
3om8-assembly1.cif.gz_B the crystal structure of a hydrolase from pseudomonas aeruginosa pa01 0.89 3 230
7dq9-assembly4.cif.gz_D crystal structure of a type-a feruloyl esterase from gut alistipes shahii 0.8889 4 231
ID Description Score Start End Superfamily
4uhfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9075 4 233 3.40.50.1820
4uhfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8853 4 233 3.40.50.1820
af_Q5AMS7_12_264_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8734 4 231 3.40.50.1820
af_A0A0R0IG56_1_246_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8682 36 231 3.40.50.1820
3om8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8635 3 230 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7Y9VH29-F1-model_v4 deleted 0.994 1 230
AF-S0G7I8-F1-model_v4 Alpha/beta hydrolase fold protein 0.9875 1 230 GO:0016787
AF-A0A3S0IIC0-F1-model_v4 Alpha/beta fold hydrolase 0.9873 2 230 GO:0016787
AF-A0A165ZYA7-F1-model_v4 Putative aminoacrylate hydrolase RutD (EC 3.5.1.-) 0.9868 3 231 GO:0016787
AF-G8PFI6-F1-model_v4 Hydrolase, alpha/beta fold family protein 0.9867 3 231 GO:0016787

Map