F380511

General Info

Members Datasets Scaffolds Average Seq Length
275 144 550 114

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10000001|Ga0307515_10000001858
Length 135
Sequence LSGIANAVRCIDIINYLKKILMNEFLLIFRRENTGPESVLSPEQLQAMMKPWQDWIGSIAAQNKLVTAGNRLAPQGKVIKPGQVITDGPYVEIKEAIGGYTIVKTDTLEEAAELAKGCPILMAGGNVEVRPIIAM

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
100 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
112 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
113 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
114 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
117 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
118 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
123 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
128 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
129 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
134 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
135 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
136 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
137 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
138 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
139 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
140 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
141 2738541278 Niastella sp. CF465 Isolate Unclassified
142 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
143 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
144 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.36
Metatranscriptomes 1.82
Isolates 1.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.09
Nodule 0
Rhizoplane 1.09
Rhizosphere 85.82
Stem 0
Stem Tuber 0
Unclassified 12.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10000001 3300028794 Bacteria 4259510
2 JGI24739J22299_10118584 3300001989 Bacteria 791
3 JGI24737J22298_10000909 3300001990 Bacteria 10521
4 JGI24737J22298_10001233 3300001990 Bacteria 9028
5 JGI24735J21928_10000002 3300002067 Bacteria 624895
6 JGI24735J21928_10047135 3300002067 Bacteria 1249
7 rootH1_10071229 3300003316 Bacteria 10970
8 rootH1_10105597 3300003316 Unclassified 2109
9 rootH2_10006948 3300003320 Bacteria 57399
10 rootH2_10046169 3300003320 Bacteria 24365
11 rootH2_10061079 3300003320 Bacteria 1313
12 rootH2_10262228 3300003320 Bacteria 1590
13 rootL2_10104857 3300003322 Bacteria 1067
14 rootL2_10332361 3300003322 Unclassified 1499
15 rootL2_10350529 3300003322 Bacteria 1389
16 rootH1_10038428 3300003323 Bacteria 18024
17 rootH1_10055347 3300003323 Bacteria 26133
18 rootH1_10133727 3300003323 Bacteria 3022
19 rootH1_10305584 3300003323 Unclassified 2023
20 Ga0055531_10000118 3300003794 Bacteria 88104
21 Ga0058863_10099269 3300004799 Bacteria 2544
22 Ga0058862_12597517 3300004803 Unclassified 518
23 Ga0065714_10015348 3300005288 Bacteria 3014
24 Ga0070658_10093118 3300005327 Unclassified 2485
25 Ga0070658_10262296 3300005327 Bacteria 1467
26 Ga0070658_10416831 3300005327 Bacteria 1154
27 Ga0070658_10444969 3300005327 Bacteria 1116
28 Ga0070658_10488879 3300005327 Bacteria 1062
29 Ga0070658_10664157 3300005327 Bacteria 904
30 Ga0070683_100090862 3300005329 Bacteria 2867
31 Ga0070683_102141284 3300005329 Bacteria 537
32 Ga0070680_100003607 3300005336 Bacteria 11556
33 Ga0070680_100385101 3300005336 Bacteria 1194
34 Ga0070682_100175266 3300005337 Bacteria 1493
35 Ga0070682_100231709 3300005337 Bacteria 1321
36 Ga0070682_100805831 3300005337 Unclassified 763
37 Ga0070660_100180514 3300005339 Bacteria 1708
38 Ga0070660_100190934 3300005339 Bacteria 1659
39 Ga0070660_100204857 3300005339 Bacteria 1601
40 Ga0070660_101347838 3300005339 Bacteria 606
41 Ga0070668_101039426 3300005347 Unclassified 737
42 Ga0070675_101734748 3300005354 Bacteria 576
43 Ga0070674_100767291 3300005356 Bacteria 830
44 Ga0070688_100173998 3300005365 Bacteria 1488
45 Ga0070659_100052690 3300005366 Bacteria 3201
46 Ga0070667_100296004 3300005367 Bacteria 1456
47 Ga0070714_101020846 3300005435 Bacteria 805
48 Ga0070711_100790957 3300005439 Bacteria 804
49 Ga0070663_101856877 3300005455 Bacteria 541
50 Ga0070681_10007755 3300005458 Bacteria 10494
51 Ga0070681_10065884 3300005458 Bacteria 3591
52 Ga0070681_10081823 3300005458 Bacteria 3185
53 Ga0070681_11877329 3300005458 Bacteria 526
54 Ga0070698_100032768 3300005471 Bacteria 5381
55 Ga0070679_100000706 3300005530 Bacteria 28666
56 Ga0070679_100018537 3300005530 Bacteria 6755
57 Ga0070679_100575940 3300005530 Bacteria 1069
58 Ga0068853_100096153 3300005539 Bacteria 2613
59 Ga0068853_100442846 3300005539 Bacteria 1221
60 Ga0070665_100001316 3300005548 Bacteria 29624
61 Ga0070665_100785278 3300005548 Unclassified 965
62 Ga0070665_100911011 3300005548 Bacteria 892
63 Ga0068855_100021828 3300005563 Bacteria 7679
64 Ga0068855_100138035 3300005563 Bacteria 2781
65 Ga0068855_100916473 3300005563 Bacteria 925
66 Ga0068855_101179145 3300005563 Bacteria 797
67 Ga0070664_100080721 3300005564 Bacteria 2802
68 Ga0068857_100096038 3300005577 Bacteria 2656
69 Ga0068857_100183223 3300005577 Bacteria 1906
70 Ga0068857_101019446 3300005577 Bacteria 797
71 Ga0068854_100152307 3300005578 Bacteria 1784
72 Ga0068854_100307696 3300005578 Bacteria 1284
73 Ga0068856_100043033 3300005614 Bacteria 4443
74 Ga0068856_100072730 3300005614 Unclassified 3404
75 Ga0068856_100195781 3300005614 Bacteria 2035
76 Ga0068852_100014691 3300005616 Bacteria 6038
77 Ga0068852_100505291 3300005616 Bacteria 1204
78 Ga0068852_102657887 3300005616 Bacteria 520
79 Ga0068859_100000534 3300005617 Bacteria 37702
80 Ga0068859_101592220 3300005617 Bacteria 721
81 Ga0068864_101150802 3300005618 Unclassified 773
82 Ga0068863_100291740 3300005841 Bacteria 1581
83 Ga0075366_10054013 3300006195 Bacteria 2387
84 Ga0075428_100142213 3300006844 Bacteria 2608
85 Ga0075430_100256636 3300006846 Bacteria 1448
86 Ga0097620_100000534 3300006931 Bacteria 37702
87 Ga0097620_101592575 3300006931 Bacteria 721
88 Ga0075435_100535973 3300007076 Bacteria 1013
89 Ga0105240_10000101 3300009093 Bacteria 175584
90 Ga0105240_10087527 3300009093 Bacteria 3814
91 Ga0105240_10197890 3300009093 Bacteria 2357
92 Ga0105240_11190167 3300009093 Unclassified 807
93 Ga0111539_10055390 3300009094 Bacteria 4713
94 Ga0105241_10017531 3300009174 Bacteria 5264
95 Ga0105241_12123473 3300009174 Bacteria 555
96 Ga0105242_12774822 3300009176 Unclassified 540
97 Ga0105237_10023814 3300009545 Bacteria 6268
98 Ga0105237_10152476 3300009545 Bacteria 2307
99 Ga0105237_10237602 3300009545 Bacteria 1823
100 Ga0105237_11937760 3300009545 Bacteria 597
101 Ga0105249_12904333 3300009553 Unclassified 550
102 Ga0105239_10000860 3300010375 Bacteria 43145
103 Ga0105239_10020574 3300010375 Bacteria 7281
104 Ga0105239_10055816 3300010375 Bacteria 4332
105 Ga0105239_10425646 3300010375 Bacteria 1504
106 Ga0105239_10679971 3300010375 Bacteria 1176
107 Ga0157373_10003753 3300013100 Bacteria 11489
108 Ga0157373_10019386 3300013100 Bacteria 4951
109 Ga0157373_10434582 3300013100 Bacteria 943
110 Ga0157373_11124143 3300013100 Bacteria 590
111 Ga0157371_10000164 3300013102 Bacteria 96408
112 Ga0157371_10001941 3300013102 Bacteria 20574
113 Ga0157371_10006756 3300013102 Bacteria 9378
114 Ga0157371_10036837 3300013102 Bacteria 3503
115 Ga0157371_10113740 3300013102 Bacteria 1922
116 Ga0157371_10133190 3300013102 Bacteria 1769
117 Ga0157371_10167055 3300013102 Bacteria 1572
118 Ga0157371_10448122 3300013102 Unclassified 949
119 Ga0157370_10095462 3300013104 Bacteria 2790
120 Ga0157370_10149234 3300013104 Bacteria 2176
121 Ga0157370_10453081 3300013104 Bacteria 1179
122 Ga0157370_10498134 3300013104 Bacteria 1119
123 Ga0157370_10659320 3300013104 Bacteria 956
124 Ga0157370_11751919 3300013104 Bacteria 558
125 Ga0157370_12131986 3300013104 Unclassified 502
126 Ga0157369_10001995 3300013105 Bacteria 24562
127 Ga0157369_10087279 3300013105 Bacteria 3331
128 Ga0157369_10200999 3300013105 Bacteria 2092
129 Ga0157369_10298908 3300013105 Bacteria 1675
130 Ga0157369_10402573 3300013105 Bacteria 1420
131 Ga0157369_10453282 3300013105 Bacteria 1328
132 Ga0157374_10185709 3300013296 Bacteria 2032
133 Ga0157378_11856339 3300013297 Bacteria 651
134 Ga0163162_10108318 3300013306 Bacteria 2875
135 Ga0157372_10000249 3300013307 Bacteria 59656
136 Ga0157372_10003920 3300013307 Bacteria 15988
137 Ga0157372_10006504 3300013307 Bacteria 12440
138 Ga0157372_10196820 3300013307 Bacteria 2334
139 Ga0157372_10331774 3300013307 Bacteria 1771
140 Ga0157372_10335606 3300013307 Bacteria 1761
141 Ga0157372_10620086 3300013307 Unclassified 1260
142 Ga0157372_10900015 3300013307 Bacteria 1027
143 Ga0157375_10576208 3300013308 Bacteria 1286
144 Ga0182008_10306690 3300014497 Bacteria 832
145 Ga0157379_12213438 3300014968 Bacteria 546
146 Ga0157376_10015664 3300014969 Bacteria 5734
147 Ga0157376_10320264 3300014969 Bacteria 1474
148 Ga0206351_10447596 3300020077 Bacteria 615
149 Ga0206354_10706508 3300020081 Unclassified 556
150 Ga0206353_11611970 3300020082 Bacteria 585
151 Ga0213876_10015680 3300021384 Bacteria 4011
152 Ga0209258_123399 3300025242 Bacteria 624
153 Ga0209233_1003596 3300025261 Bacteria 5434
154 Ga0209257_1000007 3300025304 Bacteria 1564415
155 Ga0207647_10001469 3300025904 Bacteria 18105
156 Ga0207647_10098662 3300025904 Bacteria 1735
157 Ga0207705_10007369 3300025909 Bacteria 8088
158 Ga0207705_10021098 3300025909 Bacteria 4646
159 Ga0207705_10028902 3300025909 Unclassified 3952
160 Ga0207705_10240130 3300025909 Bacteria 1380
161 Ga0207705_10793301 3300025909 Bacteria 735
162 Ga0207707_10002694 3300025912 Bacteria 15868
163 Ga0207707_10057695 3300025912 Bacteria 3379
164 Ga0207707_11142138 3300025912 Bacteria 633
165 Ga0207695_10000020 3300025913 Bacteria 723025
166 Ga0207695_10030284 3300025913 Bacteria 5960
167 Ga0207695_10030306 3300025913 Bacteria 5957
168 Ga0207671_10001820 3300025914 Bacteria 23785
169 Ga0207671_10188664 3300025914 Bacteria 1607
170 Ga0207671_10657852 3300025914 Bacteria 834
171 Ga0207660_10167261 3300025917 Bacteria 1700
172 Ga0207660_10307774 3300025917 Bacteria 1263
173 Ga0207660_10320407 3300025917 Bacteria 1238
174 Ga0207657_10128613 3300025919 Bacteria 2078
175 Ga0207657_11153916 3300025919 Bacteria 590
176 Ga0207652_10001967 3300025921 Bacteria 17765
177 Ga0207652_10034601 3300025921 Bacteria 4259
178 Ga0207652_10094009 3300025921 Bacteria 2639
179 Ga0207694_11288334 3300025924 Bacteria 618
180 Ga0207664_11801114 3300025929 Bacteria 535
181 Ga0207690_10011768 3300025932 Bacteria 5233
182 Ga0207706_10474158 3300025933 Bacteria 1081
183 Ga0207686_11289994 3300025934 Unclassified 599
184 Ga0207661_10109062 3300025944 Bacteria 2338
185 Ga0207661_11300219 3300025944 Bacteria 668
186 Ga0207679_10983358 3300025945 Bacteria 773
187 Ga0207667_10002332 3300025949 Bacteria 23768
188 Ga0207667_10382645 3300025949 Bacteria 1434
189 Ga0207667_10613465 3300025949 Bacteria 1096
190 Ga0207667_11335470 3300025949 Bacteria 692
191 Ga0207640_10131004 3300025981 Bacteria 1813
192 Ga0207640_10838028 3300025981 Bacteria 799
193 Ga0207703_10575508 3300026035 Bacteria 1064
194 Ga0207639_10033878 3300026041 Bacteria 3771
195 Ga0207639_10082341 3300026041 Bacteria 2551
196 Ga0207639_11373062 3300026041 Bacteria 663
197 Ga0207678_10239501 3300026067 Bacteria 1554
198 Ga0207678_11266937 3300026067 Bacteria 652
199 Ga0207702_10037719 3300026078 Bacteria 4046
200 Ga0207702_10053425 3300026078 Unclassified 3420
201 Ga0207702_10161265 3300026078 Bacteria 2048
202 Ga0207674_10205575 3300026116 Bacteria 1918
203 Ga0207674_10294990 3300026116 Bacteria 1570
204 Ga0207675_100969214 3300026118 Bacteria 868
205 Ga0207698_10003590 3300026142 Bacteria 9361
206 Ga0207698_10227763 3300026142 Unclassified 1690
207 Ga0207698_10483494 3300026142 Bacteria 1202
208 Ga0207698_10601929 3300026142 Bacteria 1084
209 Ga0207428_10138065 3300027907 Bacteria 1863
210 Ga0268266_10017867 3300028379 Bacteria 6043
211 Ga0268266_11080907 3300028379 Unclassified 776
212 Ga0268266_11995602 3300028379 Bacteria 554
213 Ga0268265_10835157 3300028380 Unclassified 900
214 Ga0265337_1019497 3300028556 Bacteria 2136
215 Ga0265319_1170340 3300028563 Unclassified 671
216 Ga0307515_10458442 3300028794 Unclassified 889
217 Ga0265338_10030826 3300028800 Bacteria 5270
218 Ga0265325_10035138 3300031241 Unclassified 2663
219 Ga0265327_10000415 3300031251 Bacteria 78296
220 Ga0265327_10004805 3300031251 Bacteria 11729
221 Ga0373927_0571299 3300035695 Bacteria 747
222 Ga0395899_0035345 3300037312 Unclassified 3751
223 Ga0395899_0132665 3300037312 Bacteria 1777
224 Ga0395899_0209685 3300037312 Bacteria 1354
225 Ga0395900_0024749 3300037418 Bacteria 6144
226 Ga0395900_0694332 3300037418 Bacteria 951
227 Ga0395900_0856302 3300037418 Bacteria 834
228 Ga0395898_0033364 3300037466 Bacteria 5138
229 Ga0395898_0126408 3300037466 Bacteria 2449
230 Ga0395898_0876122 3300037466 Unclassified 836
231 Ga0395898_1464579 3300037466 Bacteria 609
232 Ga0395905_0228503 3300037471 Unclassified 1740
233 Ga0395905_0281349 3300037471 Bacteria 1549
234 Ga0395901_0062425 3300038443 Bacteria 3877
235 Ga0395901_0089007 3300038443 Bacteria 3230
236 Ga0395901_0167737 3300038443 Unclassified 2304
237 Ga0395901_1050823 3300038443 Bacteria 787
238 Ga0436365_0469722 3300039437 Bacteria 48860
239 Ga0439436_0001423 3300041404 Bacteria 6921
240 Ga0451795_1176380 3300041456 Bacteria 780
241 Ga0451804_0177271 3300041463 Unclassified 883
242 Ga0451851_0948459 3300041507 Bacteria 659
243 Ga0451853_3762901 3300041512 Bacteria 1612
244 Ga0439449_0015692 3300042007 Bacteria 2848
245 Ga0439449_0067435 3300042007 Bacteria 1319
246 Ga0439457_000682 3300042014 Bacteria 10025
247 Ga0439462_0184177 3300042015 Unclassified 592
248 Ga0451577_1483091 3300042876 Bacteria 600
249 Ga0466964_0051693 3300044706 Bacteria 1688
250 Ga0453684_0015956 3300044712 Bacteria 11810
251 Ga0495668_0000564 3300046616 Bacteria 45569
252 Ga0495687_001565 3300047443 Bacteria 20768
253 Ga0495686_0061103 3300047472 Bacteria 2341
254 Ga0501047_0005548 3300049581 Bacteria 11874
255 Ga0501047_0148797 3300049581 Bacteria 2218
256 Ga0501073_0995403 3300049589 Bacteria 577
257 Ga0501257_093774 3300049686 Unclassified 783
258 Ga0501225_0003476 3300049705 Bacteria 4759
259 nmdc:mga07m45_381536_c1 3300050496 Bacteria 818
260 nmdc:mga0qj67_551948_c1 3300050509 Bacteria 924
261 nmdc:mga08y16_16694_c1 3300050511 Bacteria 7725
262 nmdc:mga0rr50_1471718_c1 3300050513 Bacteria 576
263 Ga0500644_0147050 3300053088 Bacteria 941
264 Ga0500642_0070520 3300053130 Bacteria 1589
265 Ga0500559_0005253 3300053136 Bacteria 5971
266 Ga0500573_0023436 3300053140 Bacteria 3545
267 Ga0500590_100896 3300053148 Bacteria 1386
268 Ga0500616_0026855 3300053153 Unclassified 3183
269 Ga0500616_0411864 3300053153 Bacteria 538
270 Ga0500636_0134356 3300053177 Bacteria 1375
271 2599478561 2599185184 Bacteria 6430550
272 2738730526 2738541278 Bacteria 9755573
273 2928080385 2928078545 Bacteria 6534839
274 2928149442 2928147474 Bacteria 6512076
275 2932083271 2932082852 Bacteria 6563563
276 Ga0307515_10000001
277 JGI24739J22299_10118584
278 JGI24737J22298_10000909
279 JGI24737J22298_10001233
280 JGI24735J21928_10000002
281 JGI24735J21928_10047135
282 rootH1_10071229
283 rootH1_10105597
284 rootH2_10006948
285 rootH2_10046169
286 rootH2_10061079
287 rootH2_10262228
288 rootL2_10104857
289 rootL2_10332361
290 rootL2_10350529
291 rootH1_10038428
292 rootH1_10055347
293 rootH1_10133727
294 rootH1_10305584
295 Ga0055531_10000118
296 Ga0058863_10099269
297 Ga0058862_12597517
298 Ga0065714_10015348
299 Ga0070658_10093118
300 Ga0070658_10262296
301 Ga0070658_10416831
302 Ga0070658_10444969
303 Ga0070658_10488879
304 Ga0070658_10664157
305 Ga0070683_100090862
306 Ga0070683_102141284
307 Ga0070680_100003607
308 Ga0070680_100385101
309 Ga0070682_100175266
310 Ga0070682_100231709
311 Ga0070682_100805831
312 Ga0070660_100180514
313 Ga0070660_100190934
314 Ga0070660_100204857
315 Ga0070660_101347838
316 Ga0070668_101039426
317 Ga0070675_101734748
318 Ga0070674_100767291
319 Ga0070688_100173998
320 Ga0070659_100052690
321 Ga0070667_100296004
322 Ga0070714_101020846
323 Ga0070711_100790957
324 Ga0070663_101856877
325 Ga0070681_10007755
326 Ga0070681_10065884
327 Ga0070681_10081823
328 Ga0070681_11877329
329 Ga0070698_100032768
330 Ga0070679_100000706
331 Ga0070679_100018537
332 Ga0070679_100575940
333 Ga0068853_100096153
334 Ga0068853_100442846
335 Ga0070665_100001316
336 Ga0070665_100785278
337 Ga0070665_100911011
338 Ga0068855_100021828
339 Ga0068855_100138035
340 Ga0068855_100916473
341 Ga0068855_101179145
342 Ga0070664_100080721
343 Ga0068857_100096038
344 Ga0068857_100183223
345 Ga0068857_101019446
346 Ga0068854_100152307
347 Ga0068854_100307696
348 Ga0068856_100043033
349 Ga0068856_100072730
350 Ga0068856_100195781
351 Ga0068852_100014691
352 Ga0068852_100505291
353 Ga0068852_102657887
354 Ga0068859_100000534
355 Ga0068859_101592220
356 Ga0068864_101150802
357 Ga0068863_100291740
358 Ga0075366_10054013
359 Ga0075428_100142213
360 Ga0075430_100256636
361 Ga0097620_100000534
362 Ga0097620_101592575
363 Ga0075435_100535973
364 Ga0105240_10000101
365 Ga0105240_10087527
366 Ga0105240_10197890
367 Ga0105240_11190167
368 Ga0111539_10055390
369 Ga0105241_10017531
370 Ga0105241_12123473
371 Ga0105242_12774822
372 Ga0105237_10023814
373 Ga0105237_10152476
374 Ga0105237_10237602
375 Ga0105237_11937760
376 Ga0105249_12904333
377 Ga0105239_10000860
378 Ga0105239_10020574
379 Ga0105239_10055816
380 Ga0105239_10425646
381 Ga0105239_10679971
382 Ga0157373_10003753
383 Ga0157373_10019386
384 Ga0157373_10434582
385 Ga0157373_11124143
386 Ga0157371_10000164
387 Ga0157371_10001941
388 Ga0157371_10006756
389 Ga0157371_10036837
390 Ga0157371_10113740
391 Ga0157371_10133190
392 Ga0157371_10167055
393 Ga0157371_10448122
394 Ga0157370_10095462
395 Ga0157370_10149234
396 Ga0157370_10453081
397 Ga0157370_10498134
398 Ga0157370_10659320
399 Ga0157370_11751919
400 Ga0157370_12131986
401 Ga0157369_10001995
402 Ga0157369_10087279
403 Ga0157369_10200999
404 Ga0157369_10298908
405 Ga0157369_10402573
406 Ga0157369_10453282
407 Ga0157374_10185709
408 Ga0157378_11856339
409 Ga0163162_10108318
410 Ga0157372_10000249
411 Ga0157372_10003920
412 Ga0157372_10006504
413 Ga0157372_10196820
414 Ga0157372_10331774
415 Ga0157372_10335606
416 Ga0157372_10620086
417 Ga0157372_10900015
418 Ga0157375_10576208
419 Ga0182008_10306690
420 Ga0157379_12213438
421 Ga0157376_10015664
422 Ga0157376_10320264
423 Ga0206351_10447596
424 Ga0206354_10706508
425 Ga0206353_11611970
426 Ga0213876_10015680
427 Ga0209258_123399
428 Ga0209233_1003596
429 Ga0209257_1000007
430 Ga0207647_10001469
431 Ga0207647_10098662
432 Ga0207705_10007369
433 Ga0207705_10021098
434 Ga0207705_10028902
435 Ga0207705_10240130
436 Ga0207705_10793301
437 Ga0207707_10002694
438 Ga0207707_10057695
439 Ga0207707_11142138
440 Ga0207695_10000020
441 Ga0207695_10030284
442 Ga0207695_10030306
443 Ga0207671_10001820
444 Ga0207671_10188664
445 Ga0207671_10657852
446 Ga0207660_10167261
447 Ga0207660_10307774
448 Ga0207660_10320407
449 Ga0207657_10128613
450 Ga0207657_11153916
451 Ga0207652_10001967
452 Ga0207652_10034601
453 Ga0207652_10094009
454 Ga0207694_11288334
455 Ga0207664_11801114
456 Ga0207690_10011768
457 Ga0207706_10474158
458 Ga0207686_11289994
459 Ga0207661_10109062
460 Ga0207661_11300219
461 Ga0207679_10983358
462 Ga0207667_10002332
463 Ga0207667_10382645
464 Ga0207667_10613465
465 Ga0207667_11335470
466 Ga0207640_10131004
467 Ga0207640_10838028
468 Ga0207703_10575508
469 Ga0207639_10033878
470 Ga0207639_10082341
471 Ga0207639_11373062
472 Ga0207678_10239501
473 Ga0207678_11266937
474 Ga0207702_10037719
475 Ga0207702_10053425
476 Ga0207702_10161265
477 Ga0207674_10205575
478 Ga0207674_10294990
479 Ga0207675_100969214
480 Ga0207698_10003590
481 Ga0207698_10227763
482 Ga0207698_10483494
483 Ga0207698_10601929
484 Ga0207428_10138065
485 Ga0268266_10017867
486 Ga0268266_11080907
487 Ga0268266_11995602
488 Ga0268265_10835157
489 Ga0265337_1019497
490 Ga0265319_1170340
491 Ga0307515_10458442
492 Ga0265338_10030826
493 Ga0265325_10035138
494 Ga0265327_10000415
495 Ga0265327_10004805
496 Ga0373927_0571299
497 Ga0395899_0035345
498 Ga0395899_0132665
499 Ga0395899_0209685
500 Ga0395900_0024749
501 Ga0395900_0694332
502 Ga0395900_0856302
503 Ga0395898_0033364
504 Ga0395898_0126408
505 Ga0395898_0876122
506 Ga0395898_1464579
507 Ga0395905_0228503
508 Ga0395905_0281349
509 Ga0395901_0062425
510 Ga0395901_0089007
511 Ga0395901_0167737
512 Ga0395901_1050823
513 Ga0436365_0469722
514 Ga0439436_0001423
515 Ga0451795_1176380
516 Ga0451804_0177271
517 Ga0451851_0948459
518 Ga0451853_3762901
519 Ga0439449_0015692
520 Ga0439449_0067435
521 Ga0439457_000682
522 Ga0439462_0184177
523 Ga0451577_1483091
524 Ga0466964_0051693
525 Ga0453684_0015956
526 Ga0495668_0000564
527 Ga0495687_001565
528 Ga0495686_0061103
529 Ga0501047_0005548
530 Ga0501047_0148797
531 Ga0501073_0995403
532 Ga0501257_093774
533 Ga0501225_0003476
534 nmdc:mga07m45_381536_c1
535 nmdc:mga0qj67_551948_c1
536 nmdc:mga08y16_16694_c1
537 nmdc:mga0rr50_1471718_c1
538 Ga0500644_0147050
539 Ga0500642_0070520
540 Ga0500559_0005253
541 Ga0500573_0023436
542 Ga0500590_100896
543 Ga0500616_0026855
544 Ga0500616_0411864
545 Ga0500636_0134356
546 2599478561
547 2738730526
548 2928080385
549 2928149442
550 2932083271

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

25

135

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8376 2 115
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8183 2 115
3znj-assembly3.cif.gz_9 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.6933 3 114
4fpi-assembly1.cif.gz_E crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.6856 3 114
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.6716 4 114
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8376 2 115 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8183 2 115 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7701 3 114 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7392 4 114 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7141 3 114 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A5B8VKB9-F1-model_v4 Transcription initiation protein 0.9949 19 114
AF-A0A5B8VKB9-F1-model_v4 Transcription initiation protein 0.9847 19 114
AF-S3VFQ3-F1-model_v4 YCII-related domain-containing protein 0.9818 30 112
AF-R7ZL41-F1-model_v4 DGPFAETKE family protein 0.9759 28 115
AF-A0A1H6QCW5-F1-model_v4 Uncharacterized conserved protein 0.9734 2 114

Map