F380683

General Info

Members Datasets Scaffolds Average Seq Length
275 216 193 161

Family's Representative Sequence

Representative Sequence 3300048919|Ga0496116_0029322|Ga0496116_0029322_2202_2753
Length 183
Sequence VYGAFEDMAYAAETLLFNKYRDRNGRVDMGFTHFNEQGRARMVDVSDKEVTTRQATAESMVRMAPDTLKQIKAGTIGKGDVLAVAQVAGIMAAKRTSDWIPMCHPLSLTGINIEFSDNDNDELYIEGTVKTTGKTGVEMEALTAVSAAALTVYDMCKALQKDMEIGPTRLTAKSGGKNGDYKR

Samples

Sample ID Description Type Environment
1 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
2 2554235283 Bacillus safensis VK Isolate Rhizosphere
3 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
4 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
5 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
6 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
7 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
8 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
9 2643221731 Bacillus sp. Root147 Isolate Unclassified
10 2643221732 Bacillus sp. Root239 Isolate Unclassified
11 2643221735 Bacillus sp. Root920 Isolate Unclassified
12 2671180694 Paenibacillus sp. A3 Isolate Unclassified
13 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
14 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
15 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
16 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
17 2738543006 Bacillus sp. OK077 Isolate Unclassified
18 2738543010 Bacillus sp. YR335 Isolate Unclassified
19 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
20 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
21 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
22 2811994870 Bacillus sp. JB4 Isolate Unclassified
23 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
24 2818991459 Paenibacillus sp. 597 Isolate Unclassified
25 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
26 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
27 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
28 2842882022 Bacillus sp. R-71893 Isolate Unclassified
29 2860837431 Bacillus sp. WR11 Isolate Unclassified
30 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
31 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
32 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
33 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
34 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
35 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
36 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
37 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
38 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
39 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
40 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
41 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
42 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
43 2919720352 Priestia megaterium 4340 Isolate Unclassified
44 2919726948 Bacillus pumilus 4489 Isolate Unclassified
45 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
46 2929004312 Priestia megaterium 1104 Isolate Unclassified
47 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
48 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
49 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
50 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
51 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
52 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
53 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
54 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
55 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
56 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
57 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
58 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
59 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
60 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
61 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
62 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
63 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
64 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
65 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
66 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
67 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
68 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
69 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
70 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
71 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
72 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
73 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
74 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
75 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
76 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
77 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
78 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
79 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
80 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
81 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
82 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
83 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
88 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
89 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
99 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
123 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
153 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
154 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
155 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
159 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
180 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
186 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
198 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
199 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
203 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
205 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
206 8022653035 Bacillus sp. Rc4 Isolate Unclassified
207 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
208 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
209 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
210 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
211 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
212 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
213 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
214 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
215 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
216 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 64.73
Metatranscriptomes 5.45
Isolates 29.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.55
Nodule 2.55
Rhizoplane 4.73
Rhizosphere 63.64
Stem 0
Stem Tuber 0
Unclassified 22.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1001297 3300002987 Bacteria 10556
2 JGI25151J46595_10000236 3300003187 Bacteria 65544
3 JGI25151J46595_10001304 3300003187 Bacteria 17469
4 JGI25151J46595_10001336 3300003187 Bacteria 17186
5 JGI25151J46595_10017239 3300003187 Bacteria 3137
6 JGI25151J46595_10017262 3300003187 Bacteria 3135
7 rootH2_10048591 3300003320 Bacteria 3691
8 rootH2_10208993 3300003320 Bacteria 1758
9 rootL2_10170377 3300003322 Bacteria 3336
10 rootH1_10012992 3300003323 Bacteria 4230
11 rootH1_10047699 3300003323 Bacteria 9127
12 Ga0006562J51391_1000523 3300003578 Bacteria 9870
13 Ga0006562J51391_1000524 3300003578 Bacteria 3130
14 Ga0006562J51391_1013458 3300003578 Bacteria 1417
15 Ga0070670_100761329 3300005331 Bacteria 873
16 Ga0070671_100109360 3300005355 Bacteria 2321
17 Ga0070713_100809577 3300005436 Bacteria 898
18 Ga0070681_10816095 3300005458 Bacteria 850
19 Ga0070681_11491276 3300005458 Bacteria 601
20 Ga0068867_100071365 3300005459 Bacteria 2597
21 Ga0070684_101016670 3300005535 Bacteria 778
22 Ga0070693_100807401 3300005547 Bacteria 696
23 Ga0070715_10068707 3300006163 Bacteria 1576
24 Ga0070712_100062564 3300006175 Bacteria 2632
25 Ga0070712_100337221 3300006175 Bacteria 1230
26 Ga0068865_100710397 3300006881 Bacteria 860
27 Ga0079104_1000517 3300006946 Bacteria 41298
28 Ga0079104_1004810 3300006946 Bacteria 5623
29 Ga0079104_1018235 3300006946 Bacteria 1994
30 Ga0105251_10117485 3300009011 Bacteria 1209
31 Ga0105244_10034683 3300009036 Bacteria 2655
32 Ga0105244_10050460 3300009036 Bacteria 2122
33 Ga0105250_10089905 3300009092 Bacteria 1248
34 Ga0105245_10770647 3300009098 Bacteria 999
35 Ga0105247_10265934 3300009101 Bacteria 1178
36 Ga0105243_10041663 3300009148 Bacteria 3591
37 Ga0105242_10028086 3300009176 Bacteria 4475
38 Ga0157370_10041845 3300013104 Bacteria 4417
39 Ga0157374_10240317 3300013296 Bacteria 1781
40 Ga0157374_10755823 3300013296 Bacteria 987
41 Ga0157378_10202193 3300013297 Bacteria 1879
42 Ga0183365_10001 3300015684 Bacteria 2090444
43 Ga0197907_11048334 3300020069 Bacteria 1042
44 Ga0224712_10108077 3300022467 Bacteria 1189
45 Ga0209784_101380 3300025224 Bacteria 3338
46 Ga0209147_100261 3300025229 Bacteria 49049
47 Ga0209147_112092 3300025229 Bacteria 937
48 Ga0209673_1003298 3300025273 Bacteria 9689
49 Ga0209130_1000504 3300025284 Bacteria 39736
50 Ga0209025_1000067 3300025294 Bacteria 295690
51 Ga0209025_1002129 3300025294 Bacteria 22283
52 Ga0209025_1006888 3300025294 Bacteria 8666
53 Ga0209025_1007171 3300025294 Bacteria 8415
54 Ga0209025_1007917 3300025294 Bacteria 7782
55 Ga0207696_1002608 3300025711 Bacteria 8743
56 Ga0207655_1010525 3300025728 Bacteria 5600
57 Ga0207655_1032726 3300025728 Bacteria 2371
58 Ga0207713_1004529 3300025735 Bacteria 8998
59 Ga0207680_10025601 3300025903 Bacteria 3256
60 Ga0207685_10194515 3300025905 Bacteria 949
61 Ga0207645_10911295 3300025907 Bacteria 597
62 Ga0207693_10074424 3300025915 Bacteria 2660
63 Ga0207660_10713047 3300025917 Bacteria 818
64 Ga0207644_10951133 3300025931 Bacteria 720
65 Ga0207686_10030195 3300025934 Bacteria 3206
66 Ga0207669_10179481 3300025937 Bacteria 1516
67 Ga0207669_10231911 3300025937 Bacteria 1362
68 Ga0207704_10960225 3300025938 Bacteria 721
69 Ga0207658_10237211 3300025986 Bacteria 1543
70 Ga0207677_11612236 3300026023 Bacteria 601
71 Ga0207648_10029307 3300026089 Bacteria 4881
72 Ga0207676_10805513 3300026095 Bacteria 917
73 Ga0209281_1000280 3300027111 Bacteria 96704
74 Ga0209281_1000323 3300027111 Bacteria 84095
75 Ga0209281_1009471 3300027111 Bacteria 2287
76 Ga0209973_1019790 3300027252 Bacteria 884
77 Ga0210000_1022751 3300027462 Bacteria 963
78 Ga0209999_1039074 3300027543 Bacteria 888
79 Ga0307408_100009294 3300031548 Bacteria 6481
80 Ga0307408_100096918 3300031548 Bacteria 2239
81 Ga0307405_10022396 3300031731 Unclassified 3572
82 Ga0307405_10200994 3300031731 Bacteria 1447
83 Ga0307405_10559386 3300031731 Bacteria 927
84 Ga0307413_10000431 3300031824 Bacteria 13601
85 Ga0307410_10000444 3300031852 Bacteria 16606
86 Ga0307406_10001129 3300031901 Bacteria 14919
87 Ga0307406_10420952 3300031901 Bacteria 1064
88 Ga0307407_10000292 3300031903 Bacteria 14791
89 Ga0307412_10095482 3300031911 Unclassified 2090
90 Ga0307409_100000263 3300031995 Bacteria 21269
91 Ga0307409_100001182 3300031995 Bacteria 12492
92 Ga0307409_100154563 3300031995 Bacteria 1997
93 Ga0307409_100267413 3300031995 Bacteria 1573
94 Ga0307416_100000999 3300032002 Bacteria 14988
95 Ga0307416_100001316 3300032002 Bacteria 13373
96 Ga0307414_10000594 3300032004 Bacteria 18638
97 Ga0307414_10051600 3300032004 Bacteria 2856
98 Ga0307411_10002918 3300032005 Bacteria 7748
99 Ga0307411_10044951 3300032005 Bacteria 2837
100 Ga0307411_10093203 3300032005 Bacteria 2108
101 Ga0307415_100005546 3300032126 Bacteria 6714
102 Ga0307415_100011592 3300032126 Bacteria 5053
103 Ga0307415_100266719 3300032126 Bacteria 1400
104 Ga0373951_0166310 3300035091 Bacteria 627
105 Ga0395899_0008676 3300037312 Bacteria 7824
106 Ga0395899_0020735 3300037312 Bacteria 4984
107 Ga0395899_0028386 3300037312 Bacteria 4214
108 Ga0395899_0038872 3300037312 Bacteria 3563
109 Ga0395900_0020412 3300037418 Bacteria 6764
110 Ga0395900_0041106 3300037418 Bacteria 4767
111 Ga0395900_0070011 3300037418 Bacteria 3606
112 Ga0395898_0008606 3300037466 Bacteria 10769
113 Ga0395898_0083099 3300037466 Bacteria 3086
114 Ga0395898_1193120 3300037466 Bacteria 692
115 Ga0395905_0019204 3300037471 Bacteria 6481
116 Ga0395905_0055854 3300037471 Bacteria 3695
117 Ga0395905_1090803 3300037471 Bacteria 701
118 Ga0395901_0031520 3300038443 Bacteria 5467
119 Ga0395901_0055174 3300038443 Bacteria 4131
120 Ga0395901_0056099 3300038443 Bacteria 4098
121 Ga0395901_0088862 3300038443 Bacteria 3232
122 Ga0439458_0000449 3300042157 Bacteria 10415
123 Ga0466969_0045336 3300044656 Bacteria 2183
124 Ga0466961_0159099 3300044693 Bacteria 1408
125 Ga0466968_0009447 3300044735 Bacteria 3750
126 Ga0466959_0004656 3300045049 Bacteria 9231
127 Ga0495603_0049348 3300046455 Bacteria 2505
128 Ga0495603_0078879 3300046455 Bacteria 1930
129 Ga0495650_0048443 3300046471 Bacteria 1771
130 Ga0495585_0166676 3300046492 Bacteria 1140
131 Ga0495620_0095063 3300046515 Bacteria 1192
132 Ga0495631_0114634 3300046518 Bacteria 1159
133 Ga0495654_0075440 3300046530 Bacteria 1591
134 Ga0495598_0098268 3300046537 Bacteria 965
135 Ga0495661_0194524 3300046665 Bacteria 1066
136 Ga0495647_0191741 3300046681 Bacteria 893
137 Ga0495660_0012978 3300046810 Bacteria 4829
138 Ga0495660_0062557 3300046810 Bacteria 1995
139 Ga0495672_0002873 3300047320 Bacteria 15277
140 Ga0495676_0070254 3300047321 Bacteria 2698
141 Ga0495683_0158232 3300047323 Bacteria 1049
142 Ga0495686_0192776 3300047472 Bacteria 1174
143 Ga0496100_0023488 3300048903 Bacteria 3746
144 Ga0496101_0106486 3300048904 Bacteria 2105
145 Ga0496102_0065981 3300048905 Bacteria 3317
146 Ga0496103_0012597 3300048906 Bacteria 5015
147 Ga0496104_0089676 3300048907 Bacteria 2937
148 Ga0496105_0004789 3300048908 Bacteria 10217
149 Ga0496107_0009001 3300048910 Bacteria 6920
150 Ga0496108_0044621 3300048911 Bacteria 3700
151 Ga0496109_0030778 3300048912 Bacteria 4810
152 Ga0496111_0001501 3300048914 Bacteria 13368
153 Ga0496112_0117110 3300048915 Bacteria 2634
154 Ga0496115_0943697 3300048918 Bacteria 663
155 Ga0496116_0012437 3300048919 Bacteria 6957
156 Ga0496116_0029322 3300048919 Bacteria 3969
157 Ga0496116_0113837 3300048919 Bacteria 1582
158 Ga0496116_0255834 3300048919 Bacteria 868
159 Ga0496118_0353089 3300048921 Bacteria 783
160 Ga0496120_0078861 3300048923 Bacteria 1789
161 Ga0496120_0460965 3300048923 Bacteria 552
162 Ga0496121_0257158 3300048924 Bacteria 1208
163 Ga0496122_0020466 3300048925 Bacteria 5976
164 Ga0496122_0076767 3300048925 Bacteria 2349
165 Ga0496123_0003220 3300048926 Bacteria 18581
166 Ga0496124_0001311 3300048927 Bacteria 37570
167 Ga0496124_0206391 3300048927 Bacteria 1490
168 Ga0496125_0002116 3300048928 Bacteria 26683
169 Ga0496125_0061874 3300048928 Bacteria 2999
170 Ga0496125_0559461 3300048928 Bacteria 632
171 Ga0501343_004575 3300049132 Bacteria 1042
172 Ga0501305_016591 3300049161 Bacteria 1052
173 Ga0501300_018769 3300049523 Bacteria 1011
174 Ga0501311_008076 3300049527 Bacteria 1225
175 Ga0501312_012248 3300049528 Bacteria 1177
176 Ga0501313_026713 3300049529 Bacteria 735
177 Ga0501315_007593 3300049531 Bacteria 1239
178 Ga0501317_007450 3300049533 Bacteria 1235
179 Ga0501318_016960 3300049534 Bacteria 885
180 Ga0501321_012977 3300049537 Bacteria 951
181 Ga0501335_003922 3300049551 Bacteria 1281
182 Ga0501034_0003784 3300049571 Bacteria 17076
183 Ga0501047_0652004 3300049581 Bacteria 872
184 Ga0501067_0116114 3300049583 Bacteria 1489
185 Ga0501211_049252 3300049658 Unclassified 519
186 Ga0501221_072160 3300049704 Bacteria 817
187 Ga0501221_100255 3300049704 Bacteria 718
188 Ga0501234_040879 3300049707 Bacteria 759
189 nmdc:mga0qj67_128191_c1 3300050509 Bacteria 2053
190 nmdc:mga06r32_997638_c1 3300050510 Bacteria 790
191 Ga0500635_0000401 3300053080 Bacteria 13157
192 Ga0500608_000090 3300053122 Bacteria 37277
193 Ga0530510_0665251 3300061734 Bacteria 793

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031731 Ga0307405_10559386 Ga0307405_105593862 142
2 3300049658 Ga0501211_049252 Ga0501211_049252_47_502 142
3 3300042157 Ga0439458_0000449 Ga0439458_0000449_3728_4162 144
4 3300035091 Ga0373951_0166310 Ga0373951_0166310_19_456 145
5 3300037312 Ga0395899_0020735 Ga0395899_0020735_2066_2572 145
6 3300031995 Ga0307409_100267413 Ga0307409_1002674132 146
7 3300003323 rootH1_10047699 rootH1_100476998 148
8 3300005535 Ga0070684_101016670 Ga0070684_1010166701 148
9 3300020069 Ga0197907_11048334 Ga0197907_110483342 148
10 3300022467 Ga0224712_10108077 Ga0224712_101080772 148
11 3300049132 Ga0501343_004575 Ga0501343_004575_18_464 148
12 3300049527 Ga0501311_008076 Ga0501311_008076_761_1207 148
13 3300049528 Ga0501312_012248 Ga0501312_012248_30_476 148
14 3300049529 Ga0501313_026713 Ga0501313_026713_36_482 148
15 3300049531 Ga0501315_007593 Ga0501315_007593_777_1223 148
16 3300049533 Ga0501317_007450 Ga0501317_007450_755_1201 148
17 3300049534 Ga0501318_016960 Ga0501318_016960_421_867 148
18 3300049537 Ga0501321_012977 Ga0501321_012977_471_917 148
19 3300049551 Ga0501335_003922 Ga0501335_003922_809_1255 148
20 3300048919 Ga0496116_0113837 Ga0496116_0113837_764_1216 150
21 3300061734 Ga0530510_0665251 Ga0530510_0665251_133_633 150
22 iso_pu_bacteria 2791355222 2793185943 151
23 3300049571 Ga0501034_0003784 Ga0501034_0003784_12851_13312 153
24 3300050510 nmdc:mga06r32_997638_c1 nmdc:mga06r32_997638_c1_134_595 153
25 3300053080 Ga0500635_0000401 Ga0500635_0000401_4784_5245 153
26 iso_pu_bacteria 2563366752 2563928033 153
27 iso_pu_bacteria 2907202186 2907204839 153
28 iso_pu_bacteria 2571042588 2573036511 154
29 iso_pu_bacteria 2576861424 2578335554 154
30 iso_pu_bacteria 2865002811 2865008633 154
31 iso_pu_bacteria 2881636855 2881638253 154
32 iso_pu_bacteria 2889049205 2889053521 154
33 iso_pu_bacteria 2938649242 2938654405 154
34 iso_pu_bacteria 2968558590 2968563013 154
35 iso_pu_bacteria 2971403814 2971403904 154
36 iso_pu_bacteria 2971511577 2971513167 154
37 iso_pu_bacteria 2980176882 2980178629 154
38 iso_pu_bacteria 2988225383 2988230966 154
39 iso_pu_bacteria 2996632988 2996633225 154
40 iso_pu_bacteria 8054465665 8054466418 154
41 iso_pu_bacteria 8057473075 8057475109 154
42 iso_pu_bacteria 8057977335 8057977875 154
43 3300049704 Ga0501221_100255 Ga0501221_100255_103_582 155
44 iso_pu_bacteria 2600255286 2601639820 155
45 iso_pu_bacteria 2728369359 2730138742 155
46 iso_pu_bacteria 2802428803 2802438908 155
47 iso_pu_bacteria 2889276214 2889278727 155
48 iso_pu_bacteria 2904595352 2904598668 155
49 iso_pu_bacteria 2996706504 2996709131 155
50 iso_pu_bacteria 648028048 648169110 155
51 3300048919 Ga0496116_0029322 Ga0496116_0029322_2202_2753 156
52 3300048925 Ga0496122_0020466 Ga0496122_0020466_151_681 156
53 3300048926 Ga0496123_0003220 Ga0496123_0003220_8551_9102 156
54 3300048927 Ga0496124_0001311 Ga0496124_0001311_14485_15036 156
55 3300048928 Ga0496125_0002116 Ga0496125_0002116_18864_19415 156
56 3300049523 Ga0501300_018769 Ga0501300_018769_486_986 156
57 3300049704 Ga0501221_072160 Ga0501221_072160_256_756 156
58 iso_pu_bacteria 8057632132 8057632734 156
59 3300003320 rootH2_10048591 rootH2_100485912 157
60 3300003323 rootH1_10012992 rootH1_100129922 157
61 3300025229 Ga0209147_112092 Ga0209147_1120921 157
62 3300047472 Ga0495686_0192776 Ga0495686_0192776_247_720 157
63 iso_pu_bacteria 2579778775 2580933257 157
64 iso_pu_bacteria 2619619294 2621273778 157
65 iso_pu_bacteria 8055632911 8055637016 157
66 3300025903 Ga0207680_10025601 Ga0207680_100256015 158
67 3300025986 Ga0207658_10237211 Ga0207658_102372113 158
68 3300026023 Ga0207677_11612236 Ga0207677_116122361 158
69 3300032004 Ga0307414_10051600 Ga0307414_100516002 158
70 3300032005 Ga0307411_10044951 Ga0307411_100449512 158
71 3300032126 Ga0307415_100005546 Ga0307415_1000055466 158
72 3300037312 Ga0395899_0008676 Ga0395899_0008676_4049_4525 158
73 3300037312 Ga0395899_0028386 Ga0395899_0028386_374_850 158
74 3300037418 Ga0395900_0020412 Ga0395900_0020412_4558_5034 158
75 3300037418 Ga0395900_0041106 Ga0395900_0041106_3365_3841 158
76 3300037418 Ga0395900_0070011 Ga0395900_0070011_1478_1954 158
77 3300037466 Ga0395898_0008606 Ga0395898_0008606_5470_5946 158
78 3300037466 Ga0395898_0083099 Ga0395898_0083099_1822_2298 158
79 3300037466 Ga0395898_1193120 Ga0395898_1193120_153_629 158
80 3300037471 Ga0395905_0019204 Ga0395905_0019204_928_1404 158
81 3300037471 Ga0395905_0055854 Ga0395905_0055854_2846_3322 158
82 3300037471 Ga0395905_1090803 Ga0395905_1090803_76_552 158
83 3300038443 Ga0395901_0031520 Ga0395901_0031520_4616_5092 158
84 3300038443 Ga0395901_0055174 Ga0395901_0055174_2720_3196 158
85 3300038443 Ga0395901_0056099 Ga0395901_0056099_1677_2153 158
86 3300038443 Ga0395901_0088862 Ga0395901_0088862_374_850 158
87 3300046810 Ga0495660_0012978 Ga0495660_0012978_4295_4771 158
88 3300046810 Ga0495660_0062557 Ga0495660_0062557_542_1018 158
89 3300053122 Ga0500608_000090 Ga0500608_000090_125_604 158
90 iso_pu_bacteria 2554235283 2555469469 158
91 iso_pu_bacteria 2643221731 2644716517 158
92 iso_pu_bacteria 2643221732 2644723615 158
93 iso_pu_bacteria 2643221735 2644740950 158
94 iso_pu_bacteria 2671180694 2673819509 158
95 iso_pu_bacteria 2684623153 2686995822 158
96 iso_pu_bacteria 2687453109 2687497043 158
97 iso_pu_bacteria 2703719227 2705993603 158
98 iso_pu_bacteria 2738543006 2739211137 158
99 iso_pu_bacteria 2738543010 2739234165 158
100 iso_pu_bacteria 2808606399 2809056652 158
101 iso_pu_bacteria 2811994870 2812314940 158
102 iso_pu_bacteria 2816332295 2817478718 158
103 iso_pu_bacteria 2818991459 2819671328 158
104 iso_pu_bacteria 2818991465 2819709990 158
105 iso_pu_bacteria 2818991468 2819725624 158
106 iso_pu_bacteria 2823526263 2823526910 158
107 iso_pu_bacteria 2842882022 2842883727 158
108 iso_pu_bacteria 2860837431 2860838096 158
109 iso_pu_bacteria 2904524088 2904525244 158
110 iso_pu_bacteria 2908665501 2908668978 158
111 iso_pu_bacteria 2919093281 2919096727 158
112 iso_pu_bacteria 2919143609 2919146168 158
113 iso_pu_bacteria 2919517244 2919518090 158
114 iso_pu_bacteria 2919720352 2919722450 158
115 iso_pu_bacteria 2919726948 2919730591 158
116 iso_pu_bacteria 2928093941 2928096990 158
117 iso_pu_bacteria 2929004312 2929005609 158
118 iso_pu_bacteria 2954773129 2954775605 158
119 iso_pu_bacteria 2956897341 2956900959 158
120 iso_pu_bacteria 2960319331 2960320077 158
121 iso_pu_bacteria 2960375949 2960381805 158
122 iso_pu_bacteria 2962290636 2962291435 158
123 iso_pu_bacteria 2969136845 2969137517 158
124 iso_pu_bacteria 2969765954 2969769528 158
125 iso_pu_bacteria 2969770375 2969774064 158
126 iso_pu_bacteria 2971410472 2971412396 158
127 iso_pu_bacteria 2980492589 2980493271 158
128 iso_pu_bacteria 3006858327 3006859041 158
129 iso_pu_bacteria 3006879489 3006879614 158
130 iso_pu_bacteria 8022653035 8022653647 158
131 iso_pu_bacteria 8022893055 8022895637 158
132 iso_pu_bacteria 8022914991 8022916587 158
133 iso_pu_bacteria 8054280661 8054282691 158
134 iso_pu_bacteria 8054795415 8054801472 158
135 iso_pu_bacteria 8056533031 8056533135 158
136 3300003322 rootL2_10170377 rootL2_101703772 159
137 3300005458 Ga0070681_10816095 Ga0070681_108160951 159
138 3300005458 Ga0070681_11491276 Ga0070681_114912761 159
139 3300005547 Ga0070693_100807401 Ga0070693_1008074011 159
140 3300006175 Ga0070712_100337221 Ga0070712_1003372212 159
141 3300006946 Ga0079104_1000517 Ga0079104_100051714 159
142 3300006946 Ga0079104_1004810 Ga0079104_10048104 159
143 3300006946 Ga0079104_1018235 Ga0079104_10182353 159
144 3300013104 Ga0157370_10041845 Ga0157370_100418456 159
145 3300015684 Ga0183365_10001 Ga0183365_100011530 159
146 3300025224 Ga0209784_101380 Ga0209784_1013804 159
147 3300027111 Ga0209281_1000280 Ga0209281_100028035 159
148 3300027111 Ga0209281_1000323 Ga0209281_100032374 159
149 3300027111 Ga0209281_1009471 Ga0209281_10094712 159
150 3300031731 Ga0307405_10200994 Ga0307405_102009942 159
151 3300031901 Ga0307406_10420952 Ga0307406_104209522 159
152 3300031995 Ga0307409_100000263 Ga0307409_10000026318 159
153 3300032002 Ga0307416_100000999 Ga0307416_1000009993 159
154 3300032005 Ga0307411_10093203 Ga0307411_100932032 159
155 3300032126 Ga0307415_100266719 Ga0307415_1002667191 159
156 3300037312 Ga0395899_0038872 Ga0395899_0038872_726_1232 159
157 3300044656 Ga0466969_0045336 Ga0466969_0045336_1237_1743 159
158 3300044693 Ga0466961_0159099 Ga0466961_0159099_703_1209 159
159 3300044735 Ga0466968_0009447 Ga0466968_0009447_2721_3227 159
160 3300045049 Ga0466959_0004656 Ga0466959_0004656_6716_7222 159
161 3300046471 Ga0495650_0048443 Ga0495650_0048443_828_1361 159
162 3300046515 Ga0495620_0095063 Ga0495620_0095063_212_691 159
163 3300046530 Ga0495654_0075440 Ga0495654_0075440_515_994 159
164 3300047320 Ga0495672_0002873 Ga0495672_0002873_969_1448 159
165 3300048919 Ga0496116_0255834 Ga0496116_0255834_283_774 159
166 3300049581 Ga0501047_0652004 Ga0501047_0652004_14_493 159
167 3300049583 Ga0501067_0116114 Ga0501067_0116114_99_578 159
168 3300050509 nmdc:mga0qj67_128191_c1 nmdc:mga0qj67_128191_c1_1319_1798 159
169 iso_pu_bacteria 2864997549 2864999879 159
170 iso_pu_bacteria 2889295896 2889299724 159
171 iso_pu_bacteria 2981284811 2981287195 159
172 iso_pu_bacteria 2981289755 2981292143 159
173 iso_pu_bacteria 2981980479 2981982825 159
174 iso_pu_bacteria 2981985349 2981987385 159
175 3300005355 Ga0070671_100109360 Ga0070671_1001093602 160
176 3300005436 Ga0070713_100809577 Ga0070713_1008095771 160
177 3300005459 Ga0068867_100071365 Ga0068867_1000713652 160
178 3300006175 Ga0070712_100062564 Ga0070712_1000625642 160
179 3300006881 Ga0068865_100710397 Ga0068865_1007103972 160
180 3300009176 Ga0105242_10028086 Ga0105242_100280862 160
181 3300013297 Ga0157378_10202193 Ga0157378_102021931 160
182 3300025915 Ga0207693_10074424 Ga0207693_100744243 160
183 3300025917 Ga0207660_10713047 Ga0207660_107130472 160
184 3300025931 Ga0207644_10951133 Ga0207644_109511331 160
185 3300025934 Ga0207686_10030195 Ga0207686_100301953 160
186 3300025937 Ga0207669_10179481 Ga0207669_101794812 160
187 3300025937 Ga0207669_10231911 Ga0207669_102319112 160
188 3300025938 Ga0207704_10960225 Ga0207704_109602251 160
189 3300026089 Ga0207648_10029307 Ga0207648_100293076 160
190 3300031548 Ga0307408_100009294 Ga0307408_1000092945 160
191 3300031731 Ga0307405_10022396 Ga0307405_100223966 160
192 3300031824 Ga0307413_10000431 Ga0307413_1000043114 160
193 3300031852 Ga0307410_10000444 Ga0307410_1000044412 160
194 3300031901 Ga0307406_10001129 Ga0307406_1000112910 160
195 3300031903 Ga0307407_10000292 Ga0307407_1000029216 160
196 3300031911 Ga0307412_10095482 Ga0307412_100954822 160
197 3300031995 Ga0307409_100001182 Ga0307409_1000011826 160
198 3300031995 Ga0307409_100154563 Ga0307409_1001545632 160
199 3300032002 Ga0307416_100001316 Ga0307416_1000013167 160
200 3300032004 Ga0307414_10000594 Ga0307414_1000059410 160
201 3300032005 Ga0307411_10002918 Ga0307411_100029188 160
202 3300032126 Ga0307415_100011592 Ga0307415_1000115925 160
203 3300046537 Ga0495598_0098268 Ga0495598_0098268_340_897 160
204 3300046681 Ga0495647_0191741 Ga0495647_0191741_329_811 160
205 3300027543 Ga0209999_1039074 Ga0209999_10390742 161
206 3300002987 JGI25159J45721_1001297 JGI25159J45721_10012979 162
207 3300003187 JGI25151J46595_10000236 JGI25151J46595_100002368 162
208 3300003187 JGI25151J46595_10001304 JGI25151J46595_1000130417 162
209 3300003187 JGI25151J46595_10001336 JGI25151J46595_1000133624 162
210 3300003187 JGI25151J46595_10017239 JGI25151J46595_100172394 162
211 3300003187 JGI25151J46595_10017262 JGI25151J46595_100172622 162
212 3300003320 rootH2_10208993 rootH2_102089933 162
213 3300003578 Ga0006562J51391_1000523 Ga0006562J51391_10005239 162
214 3300003578 Ga0006562J51391_1000524 Ga0006562J51391_10005241 162
215 3300003578 Ga0006562J51391_1013458 Ga0006562J51391_10134582 162
216 3300005331 Ga0070670_100761329 Ga0070670_1007613291 162
217 3300006163 Ga0070715_10068707 Ga0070715_100687072 162
218 3300009011 Ga0105251_10117485 Ga0105251_101174853 162
219 3300009036 Ga0105244_10034683 Ga0105244_100346833 162
220 3300009036 Ga0105244_10050460 Ga0105244_100504602 162
221 3300009092 Ga0105250_10089905 Ga0105250_100899053 162
222 3300009098 Ga0105245_10770647 Ga0105245_107706471 162
223 3300009101 Ga0105247_10265934 Ga0105247_102659342 162
224 3300009148 Ga0105243_10041663 Ga0105243_100416633 162
225 3300013296 Ga0157374_10240317 Ga0157374_102403172 162
226 3300013296 Ga0157374_10755823 Ga0157374_107558231 162
227 3300025229 Ga0209147_100261 Ga0209147_1002614 162
228 3300025273 Ga0209673_1003298 Ga0209673_10032984 162
229 3300025284 Ga0209130_1000504 Ga0209130_100050441 162
230 3300025294 Ga0209025_1000067 Ga0209025_10000678 162
231 3300025294 Ga0209025_1002129 Ga0209025_10021298 162
232 3300025294 Ga0209025_1006888 Ga0209025_10068887 162
233 3300025294 Ga0209025_1007171 Ga0209025_10071716 162
234 3300025294 Ga0209025_1007917 Ga0209025_10079178 162
235 3300025711 Ga0207696_1002608 Ga0207696_10026086 162
236 3300025728 Ga0207655_1010525 Ga0207655_10105256 162
237 3300025728 Ga0207655_1032726 Ga0207655_10327263 162
238 3300025735 Ga0207713_1004529 Ga0207713_10045297 162
239 3300025905 Ga0207685_10194515 Ga0207685_101945152 162
240 3300025907 Ga0207645_10911295 Ga0207645_109112951 162
241 3300026095 Ga0207676_10805513 Ga0207676_108055132 162
242 3300027252 Ga0209973_1019790 Ga0209973_10197902 162
243 3300027462 Ga0210000_1022751 Ga0210000_10227512 162
244 3300031548 Ga0307408_100096918 Ga0307408_1000969181 162
245 3300046455 Ga0495603_0049348 Ga0495603_0049348_1621_2121 162
246 3300046455 Ga0495603_0078879 Ga0495603_0078879_377_877 162
247 3300046492 Ga0495585_0166676 Ga0495585_0166676_77_577 162
248 3300046518 Ga0495631_0114634 Ga0495631_0114634_611_1111 162
249 3300046665 Ga0495661_0194524 Ga0495661_0194524_374_874 162
250 3300047321 Ga0495676_0070254 Ga0495676_0070254_1120_1620 162
251 3300047323 Ga0495683_0158232 Ga0495683_0158232_105_605 162
252 3300048903 Ga0496100_0023488 Ga0496100_0023488_78_578 162
253 3300048904 Ga0496101_0106486 Ga0496101_0106486_757_1257 162
254 3300048905 Ga0496102_0065981 Ga0496102_0065981_1053_1553 162
255 3300048906 Ga0496103_0012597 Ga0496103_0012597_1694_2194 162
256 3300048907 Ga0496104_0089676 Ga0496104_0089676_1847_2347 162
257 3300048908 Ga0496105_0004789 Ga0496105_0004789_8648_9148 162
258 3300048910 Ga0496107_0009001 Ga0496107_0009001_1610_2110 162
259 3300048911 Ga0496108_0044621 Ga0496108_0044621_77_577 162
260 3300048912 Ga0496109_0030778 Ga0496109_0030778_2375_2875 162
261 3300048914 Ga0496111_0001501 Ga0496111_0001501_11984_12484 162
262 3300048915 Ga0496112_0117110 Ga0496112_0117110_1053_1553 162
263 3300048918 Ga0496115_0943697 Ga0496115_0943697_129_629 162
264 3300048919 Ga0496116_0012437 Ga0496116_0012437_450_950 162
265 3300048921 Ga0496118_0353089 Ga0496118_0353089_180_680 162
266 3300048923 Ga0496120_0078861 Ga0496120_0078861_484_984 162
267 3300048923 Ga0496120_0460965 Ga0496120_0460965_37_528 162
268 3300048924 Ga0496121_0257158 Ga0496121_0257158_139_639 162
269 3300048925 Ga0496122_0076767 Ga0496122_0076767_1272_1772 162
270 3300048927 Ga0496124_0206391 Ga0496124_0206391_371_871 162
271 3300048928 Ga0496125_0061874 Ga0496125_0061874_938_1438 162
272 3300048928 Ga0496125_0559461 Ga0496125_0559461_102_593 162
273 3300049161 Ga0501305_016591 Ga0501305_016591_114_602 162
274 3300049707 Ga0501234_040879 Ga0501234_040879_103_591 162
275 iso_pu_bacteria 2540341094 2540605701 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01967

MoaC

MoaC family

42

176

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pyd-assembly1.cif.gz_A moac in complex with cpmp crystallized in space group p212121 0.9604 15 159
4fdf-assembly1.cif.gz_B structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv 0.9586 12 149
2eey-assembly1.cif.gz_A structure of gk0241 protein from geobacillus kaustophilus 0.9564 2 161
1ekr-assembly1.cif.gz_A moac protein from e. coli 0.9552 11 157
4pyd-assembly1.cif.gz_D moac in complex with cpmp crystallized in space group p212121 0.9545 6 153
ID Description Score Start End Superfamily
af_Q2FVX9_1_163_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9792 1 162 3.30.70.640
af_Q2FVX9_1_163_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9733 1 162 3.30.70.640
af_Q20624_440_595_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.968 4 160 3.30.70.640
af_B4FJH5_64_220_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9582 4 160 3.30.70.640
1ekrA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9552 11 157 3.30.70.640
ID Description Score Start End GO Terms
AF-A0A2T7YXV4-F1-model_v4 deleted 0.9868 15 161
AF-A0A2P8H1Y3-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9864 15 160 GO:0006777
GO:0061799
AF-A0A178A2D0-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9841 15 159 GO:0006777
GO:0061798
GO:0061799
AF-W7ZQT7-F1-model_v4 deleted 0.9836 1 134
AF-A0A0F7HJC8-F1-model_v4 Cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) (Molybdenum cofactor biosynthesis protein C) 0.9835 1 160 GO:0006777
GO:0061799

Feature Viewer

pLDDT pTM Quality
91.55 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map