F380830

General Info

Members Datasets Scaffolds Average Seq Length
276 183 268 208

Family's Representative Sequence

Representative Sequence 3300002076|JGI24749J21850_1000175|JGI24749J21850_10001758
Length 224
Sequence VIVLGLTGSIGMGKSTVAAMFARAGVPVYDADAEVHRLQGRGGKLVAAIDAAFPGSAGAHGIDRAVLGKAVLGDRAALDRLERIVHPALAESRRLFLRRHRARALVVLDIPLLFEKGGWRRVDAVAVVSAPAWKQARRVLARPGMNPLKLRHIRSLQLPDHVKRARADFVIDNGGSIGRTRAAVHHLITCLRTHGVRYCRACVKSSSTPKRLDSTPPPGTGWSK

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
3 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
4 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
5 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
6 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
7 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
8 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
55 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
56 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
57 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
102 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
103 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
104 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
105 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
106 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
109 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
110 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
113 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
114 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
115 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
116 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
117 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
118 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
119 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
124 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
125 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
126 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
127 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
128 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
129 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
130 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
143 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
144 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
145 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
146 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
147 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
148 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
149 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
150 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
151 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
152 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
153 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
154 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
155 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
156 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
160 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
161 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
162 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
163 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
166 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
167 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
168 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
169 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
170 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
171 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
172 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
173 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
174 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
175 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
176 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
177 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
178 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
179 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
180 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
181 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
182 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.1
Metatranscriptomes 0
Isolates 2.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.46
Nodule 0.36
Rhizoplane 1.45
Rhizosphere 70.65
Stem 0
Stem Tuber 0
Unclassified 5.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1000175 3300002076 Bacteria 10173
2 JGI24751J29686_10000572 3300002459 Bacteria 9962
3 JGI24751J29686_10030215 3300002459 Bacteria 1124
4 JGI25151J46595_10028538 3300003187 Bacteria 2221
5 JGI25153J46596_10000073 3300003215 Bacteria 115166
6 Ga0055536_1012882 3300003781 Bacteria 3063
7 Ga0055536_1020743 3300003781 Bacteria 2017
8 Ga0055530_10005156 3300003791 Bacteria 6368
9 Ga0055530_10012590 3300003791 Bacteria 2940
10 Ga0055530_10042852 3300003791 Bacteria 1095
11 Ga0055540_1000681 3300003792 Bacteria 23535
12 Ga0055531_10009125 3300003794 Bacteria 5112
13 Ga0055531_10009462 3300003794 Bacteria 4976
14 Ga0065704_10228453 3300005289 Bacteria 1051
15 Ga0065707_10081714 3300005295 Bacteria 75872
16 Ga0065707_10093096 3300005295 Bacteria 3676
17 Ga0065707_10117631 3300005295 Bacteria 2181
18 Ga0065707_10135257 3300005295 Bacteria 1848
19 Ga0070670_100000158 3300005331 Bacteria 62049
20 Ga0070670_100002129 3300005331 Bacteria 16246
21 Ga0070666_10024671 3300005335 Bacteria 3919
22 Ga0070666_10026936 3300005335 Bacteria 3761
23 Ga0070666_10244167 3300005335 Bacteria 1270
24 Ga0070668_100000001 3300005347 Bacteria 275905
25 Ga0070668_100034767 3300005347 Bacteria 3841
26 Ga0070669_100000031 3300005353 Bacteria 154042
27 Ga0070669_100011473 3300005353 Bacteria 6292
28 Ga0070671_100000106 3300005355 Bacteria 53385
29 Ga0070671_100614220 3300005355 Bacteria 940
30 Ga0070667_100000006 3300005367 Bacteria 336732
31 Ga0070667_100000066 3300005367 Bacteria 134529
32 Ga0070667_100003426 3300005367 Bacteria 13510
33 Ga0070679_100492677 3300005530 Bacteria 1170
34 Ga0068853_100187459 3300005539 Bacteria 1878
35 Ga0070665_100171595 3300005548 Bacteria 2170
36 Ga0068855_100000468 3300005563 Bacteria 49550
37 Ga0068857_100019222 3300005577 Bacteria 5998
38 Ga0068857_100095886 3300005577 Bacteria 2658
39 Ga0068854_100020800 3300005578 Bacteria 4446
40 Ga0068856_100039601 3300005614 Bacteria 4627
41 Ga0068859_100009268 3300005617 Bacteria 9941
42 Ga0068859_100030308 3300005617 Bacteria 5428
43 Ga0068859_100033910 3300005617 Bacteria 5125
44 Ga0068864_100000123 3300005618 Bacteria 75407
45 Ga0068864_100000306 3300005618 Bacteria 43501
46 Ga0068863_100008301 3300005841 Bacteria 10148
47 Ga0068863_100012079 3300005841 Bacteria 8343
48 Ga0068863_100078264 3300005841 Bacteria 3131
49 Ga0068863_100368772 3300005841 Bacteria 1401
50 Ga0068858_100000348 3300005842 Bacteria 48656
51 Ga0068860_100000013 3300005843 Bacteria 323055
52 Ga0068860_100000074 3300005843 Bacteria 173022
53 Ga0068860_100494712 3300005843 Bacteria 1220
54 Ga0068862_100000043 3300005844 Bacteria 164356
55 Ga0068862_100000898 3300005844 Bacteria 28838
56 Ga0075368_10001003 3300006042 Bacteria 8827
57 Ga0075363_100177119 3300006048 Bacteria 1212
58 Ga0075366_10111101 3300006195 Bacteria 1648
59 Ga0075370_10071092 3300006353 Bacteria 1991
60 Ga0075431_100075691 3300006847 Bacteria 3473
61 Ga0097620_100009268 3300006931 Bacteria 9941
62 Ga0097620_100030305 3300006931 Bacteria 5428
63 Ga0097620_100033910 3300006931 Bacteria 5125
64 Ga0079104_1075367 3300006946 Bacteria 701
65 Ga0105240_10054262 3300009093 Bacteria 5023
66 Ga0105240_10261427 3300009093 Bacteria 1996
67 Ga0105240_10516262 3300009093 Bacteria 1326
68 Ga0105241_11136617 3300009174 Bacteria 737
69 Ga0105248_10000081 3300009177 Bacteria 111105
70 Ga0105248_10002998 3300009177 Bacteria 18724
71 Ga0105238_10035160 3300009551 Bacteria 5095
72 Ga0157326_1000003 3300012513 Bacteria 18872
73 Ga0157370_10143178 3300013104 Bacteria 2227
74 Ga0163163_10407025 3300014325 Bacteria 1419
75 Ga0157380_10000040 3300014326 Bacteria 76401
76 Ga0157380_10000292 3300014326 Bacteria 30110
77 Ga0163161_10117015 3300017792 Bacteria 1999
78 Ga0213875_10000166 3300021388 Bacteria 68786
79 Ga0207425_1000005 3300025245 Bacteria 900502
80 Ga0209129_1000701 3300025258 Bacteria 21860
81 Ga0209565_1012712 3300025263 Bacteria 1998
82 Ga0209675_1000638 3300025291 Bacteria 24903
83 Ga0209676_1001537 3300025292 Bacteria 20872
84 Ga0209676_1018923 3300025292 Bacteria 2384
85 Ga0209676_1028255 3300025292 Bacteria 1750
86 Ga0209025_1001007 3300025294 Bacteria 41722
87 Ga0209758_1000002 3300025297 Bacteria 1400310
88 Ga0209050_1000001 3300025298 Bacteria 3563507
89 Ga0209050_1000113 3300025298 Bacteria 209222
90 Ga0209050_1014459 3300025298 Bacteria 3395
91 Ga0209051_1000472 3300025303 Bacteria 52350
92 Ga0209257_1000083 3300025304 Bacteria 296207
93 Ga0209257_1000330 3300025304 Bacteria 99167
94 Ga0209257_1001563 3300025304 Bacteria 26461
95 Ga0209257_1006687 3300025304 Bacteria 7302
96 Ga0209257_1006698 3300025304 Bacteria 7292
97 Ga0207680_10126412 3300025903 Bacteria 1679
98 Ga0207680_10434878 3300025903 Bacteria 930
99 Ga0207681_10000014 3300025923 Bacteria 353422
100 Ga0207681_10031885 3300025923 Bacteria 3445
101 Ga0207681_10133346 3300025923 Bacteria 1839
102 Ga0207694_10027280 3300025924 Bacteria 4348
103 Ga0207650_10000015 3300025925 Bacteria 369173
104 Ga0207650_10003426 3300025925 Bacteria 10905
105 Ga0207644_10000047 3300025931 Bacteria 103158
106 Ga0207644_10490802 3300025931 Bacteria 1012
107 Ga0207711_10004385 3300025941 Bacteria 12034
108 Ga0207711_10006037 3300025941 Bacteria 10237
109 Ga0207667_10007908 3300025949 Bacteria 12697
110 Ga0207668_10000009 3300025972 Bacteria 188071
111 Ga0207668_10024009 3300025972 Bacteria 3929
112 Ga0207640_10689872 3300025981 Bacteria 874
113 Ga0207658_10000010 3300025986 Bacteria 240224
114 Ga0207658_10000132 3300025986 Bacteria 80078
115 Ga0207658_10001234 3300025986 Bacteria 20208
116 Ga0207703_10000368 3300026035 Bacteria 48197
117 Ga0207702_10029623 3300026078 Bacteria 4556
118 Ga0207641_10000584 3300026088 Bacteria 40125
119 Ga0207641_10001281 3300026088 Bacteria 25019
120 Ga0207641_10004714 3300026088 Bacteria 11760
121 Ga0207676_10000021 3300026095 Bacteria 296572
122 Ga0207676_10001450 3300026095 Bacteria 17632
123 Ga0207674_10010801 3300026116 Bacteria 10296
124 Ga0207674_10041523 3300026116 Bacteria 4757
125 Ga0207674_10052220 3300026116 Bacteria 4169
126 Ga0207674_10166639 3300026116 Bacteria 2157
127 Ga0207675_100021606 3300026118 Bacteria 5993
128 Ga0207698_11210117 3300026142 Bacteria 769
129 Ga0209813_10000029 3300027866 Bacteria 68229
130 Ga0268266_11010151 3300028379 Bacteria 805
131 Ga0268265_10000013 3300028380 Bacteria 341536
132 Ga0268265_10002177 3300028380 Bacteria 15159
133 Ga0268264_10000039 3300028381 Bacteria 376641
134 Ga0268264_10000070 3300028381 Bacteria 268524
135 Ga0265338_10041738 3300028800 Bacteria 4287
136 Ga0307408_100006528 3300031548 Bacteria 7731
137 Ga0307405_10157606 3300031731 Bacteria 1604
138 Ga0307405_10272952 3300031731 Bacteria 1269
139 Ga0307410_10064285 3300031852 Bacteria 2521
140 Ga0307406_10088523 3300031901 Bacteria 2078
141 Ga0307406_10285798 3300031901 Bacteria 1260
142 Ga0307412_10004545 3300031911 Bacteria 7730
143 Ga0307412_10015076 3300031911 Bacteria 4572
144 Ga0307412_10016556 3300031911 Bacteria 4395
145 Ga0307412_10020466 3300031911 Bacteria 4027
146 Ga0307412_10097394 3300031911 Bacteria 2073
147 Ga0307412_10274131 3300031911 Bacteria 1321
148 Ga0307412_10708129 3300031911 Bacteria 865
149 Ga0307416_100106362 3300032002 Bacteria 2459
150 Ga0307416_100152851 3300032002 Bacteria 2120
151 Ga0307414_10000212 3300032004 Bacteria 38895
152 Ga0307414_11030273 3300032004 Bacteria 758
153 Ga0307411_11326814 3300032005 Bacteria 656
154 Ga0373927_0087532 3300035695 Bacteria 2022
155 Ga0373927_0276244 3300035695 Bacteria 1105
156 Ga0395905_0524210 3300037471 Bacteria 1085
157 Ga0436364_0545952 3300037853 Bacteria 79385
158 Ga0436364_0736268 3300037853 Bacteria 3261
159 Ga0436365_1521972 3300039437 Bacteria 2494
160 Ga0451807_0952868 3300041486 Bacteria 1028
161 Ga0466970_0140047 3300044765 Bacteria 1332
162 Ga0495638_0069970 3300046460 Bacteria 2149
163 Ga0495584_0264677 3300046491 Bacteria 874
164 Ga0495583_0000279 3300046506 Bacteria 82827
165 Ga0495606_0000406 3300046507 Bacteria 72668
166 Ga0495606_0143904 3300046507 Bacteria 1406
167 Ga0495610_0079212 3300046512 Bacteria 1513
168 Ga0495643_0011737 3300046522 Bacteria 5316
169 Ga0495643_0040067 3300046522 Bacteria 2559
170 Ga0495643_0171817 3300046522 Bacteria 1059
171 Ga0495648_0041650 3300046524 Bacteria 2898
172 Ga0495648_0124757 3300046524 Bacteria 1378
173 Ga0495654_0010230 3300046530 Bacteria 5109
174 Ga0495654_0223101 3300046530 Bacteria 796
175 Ga0495609_0077701 3300046538 Bacteria 1453
176 Ga0495597_0048924 3300046542 Bacteria 1869
177 Ga0495668_0000234 3300046616 Bacteria 79147
178 Ga0495668_0002012 3300046616 Bacteria 17752
179 Ga0495668_0008222 3300046616 Bacteria 6545
180 Ga0495611_0046050 3300046648 Bacteria 1955
181 Ga0495625_0000195 3300046660 Bacteria 96493
182 Ga0495625_0151547 3300046660 Bacteria 1558
183 Ga0495661_0028793 3300046665 Bacteria 3551
184 Ga0495669_0215592 3300046684 Bacteria 919
185 Ga0495670_0034858 3300046691 Bacteria 2507
186 Ga0495670_0280641 3300046691 Bacteria 891
187 Ga0495671_0006295 3300046692 Bacteria 6871
188 Ga0495660_0332795 3300046810 Bacteria 679
189 Ga0495686_0001947 3300047472 Bacteria 20548
190 Ga0496102_0062996 3300048905 Bacteria 3395
191 Ga0496108_0014447 3300048911 Bacteria 6448
192 Ga0496109_0545374 3300048912 Bacteria 1094
193 Ga0496117_0038144 3300048920 Bacteria 3569
194 Ga0496118_0034563 3300048921 Bacteria 4121
195 Ga0496125_0035714 3300048928 Bacteria 4354
196 Ga0495682_0002704 3300049460 Bacteria 8233
197 Ga0501290_000432 3300049513 Bacteria 6576
198 Ga0501292_000013 3300049515 Bacteria 65866
199 Ga0501294_000215 3300049517 Bacteria 7124
200 Ga0501300_003476 3300049523 Bacteria 2354
201 Ga0501031_0394101 3300049568 Bacteria 896
202 Ga0501032_0033728 3300049569 Bacteria 3506
203 Ga0501032_0064366 3300049569 Bacteria 2454
204 Ga0501033_0082055 3300049570 Bacteria 2364
205 Ga0501033_0101295 3300049570 Bacteria 2101
206 Ga0501034_0028784 3300049571 Bacteria 5652
207 Ga0501034_0069510 3300049571 Bacteria 3532
208 Ga0501036_0046291 3300049572 Bacteria 3683
209 Ga0501036_0258734 3300049572 Bacteria 1458
210 Ga0501037_0021339 3300049573 Bacteria 4784
211 Ga0501038_0210741 3300049574 Bacteria 1554
212 Ga0501043_0080443 3300049579 Bacteria 2560
213 Ga0501047_0001071 3300049581 Bacteria 27278
214 Ga0501047_0238586 3300049581 Bacteria 1669
215 Ga0501048_0218734 3300049582 Bacteria 1351
216 Ga0501073_0353401 3300049589 Bacteria 1015
217 Ga0501222_000462 3300049662 Bacteria 6083
218 Ga0501223_001010 3300049663 Bacteria 6648
219 Ga0501224_000280 3300049664 Bacteria 5910
220 Ga0501235_040477 3300049669 Bacteria 1065
221 Ga0501243_053222 3300049675 Bacteria 735
222 Ga0501249_001898 3300049679 Bacteria 4246
223 Ga0501257_000010 3300049686 Bacteria 53242
224 Ga0501257_052871 3300049686 Bacteria 1015
225 Ga0501259_000447 3300049688 Bacteria 6547
226 Ga0501261_000126 3300049690 Bacteria 11424
227 Ga0501225_0034389 3300049705 Bacteria 1395
228 Ga0501279_000004 3300049775 Bacteria 175612
229 Ga0501280_000314 3300049776 Bacteria 12170
230 Ga0501280_000948 3300049776 Bacteria 6063
231 Ga0501281_00073 3300049777 Bacteria 11764
232 Ga0501282_000150 3300049778 Bacteria 8371
233 Ga0501283_032444 3300049779 Bacteria 880
234 Ga0501035_0019392 3300049822 Bacteria 6254
235 Ga0501035_0028457 3300049822 Bacteria 5099
236 Ga0501044_0144609 3300049823 Bacteria 2364
237 Ga0501044_0202341 3300049823 Bacteria 1943
238 nmdc:mga03n38_109448_c1 3300050490 Bacteria 1343
239 nmdc:mga0k408_99042_c1 3300050493 Bacteria 1718
240 nmdc:mga06z11_18_c1 3300050494 Bacteria 78477
241 nmdc:mga04h51_133_c1 3300050495 Bacteria 21746
242 nmdc:mga07m45_27880_c1 3300050496 Bacteria 1506
243 nmdc:mga06r32_24417_c1 3300050510 Bacteria 5611
244 Ga0500643_000403 3300053087 Bacteria 33015
245 Ga0500643_002054 3300053087 Bacteria 10775
246 Ga0500643_019122 3300053087 Bacteria 2261
247 Ga0500647_0008473 3300053091 Bacteria 4464
248 Ga0500555_000414 3300053103 Bacteria 17859
249 Ga0500569_084663 3300053109 Bacteria 1019
250 Ga0500592_000772 3300053116 Bacteria 5263
251 Ga0500594_0001241 3300053118 Bacteria 5515
252 Ga0500614_010560 3300053123 Bacteria 1985
253 Ga0500642_0028578 3300053130 Bacteria 2301
254 Ga0500655_000383 3300053133 Bacteria 9498
255 Ga0500658_0000032 3300053134 Bacteria 90863
256 Ga0500559_0012288 3300053136 Bacteria 3643
257 Ga0500559_0147321 3300053136 Bacteria 1104
258 Ga0500568_0001218 3300053139 Bacteria 17161
259 Ga0500577_0040517 3300053142 Bacteria 1694
260 Ga0500590_001839 3300053148 Bacteria 9001
261 Ga0500604_0021847 3300053151 Bacteria 1812
262 Ga0500622_0004156 3300053156 Bacteria 9264
263 Ga0500627_0000070 3300053158 Bacteria 41863
264 Ga0500627_0000152 3300053158 Bacteria 20430
265 Ga0500627_0034394 3300053158 Bacteria 2148
266 Ga0500627_0076433 3300053158 Bacteria 1489
267 Ga0500570_001639 3300053724 Bacteria 10510
268 Ga0501084_0838730 3300054114 Bacteria 774

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046530 Ga0495654_0223101 Ga0495654_0223101_18_569 183
2 3300048912 Ga0496109_0545374 Ga0496109_0545374_25_600 183
3 3300037853 Ga0436364_0736268 Ga0436364_0736268_540_1172 189
4 3300035695 Ga0373927_0276244 Ga0373927_0276244_348_932 190
5 3300049675 Ga0501243_053222 Ga0501243_053222_10_585 191
6 3300054114 Ga0501084_0838730 Ga0501084_0838730_14_595 191
7 3300003781 Ga0055536_1012882 Ga0055536_10128823 194
8 3300003781 Ga0055536_1020743 Ga0055536_10207431 194
9 3300003791 Ga0055530_10005156 Ga0055530_100051567 194
10 3300003791 Ga0055530_10042852 Ga0055530_100428522 194
11 3300003794 Ga0055531_10009125 Ga0055531_100091252 194
12 3300003794 Ga0055531_10009462 Ga0055531_100094622 194
13 3300006946 Ga0079104_1075367 Ga0079104_10753671 194
14 3300013104 Ga0157370_10143178 Ga0157370_101431782 194
15 3300025291 Ga0209675_1000638 Ga0209675_100063815 194
16 3300025292 Ga0209676_1001537 Ga0209676_100153718 194
17 3300025298 Ga0209050_1000113 Ga0209050_10001133 194
18 3300025298 Ga0209050_1014459 Ga0209050_10144593 194
19 3300025304 Ga0209257_1000083 Ga0209257_100008312 194
20 3300025304 Ga0209257_1000330 Ga0209257_10003302 194
21 3300025304 Ga0209257_1001563 Ga0209257_100156328 194
22 3300031731 Ga0307405_10157606 Ga0307405_101576062 194
23 3300031901 Ga0307406_10088523 Ga0307406_100885232 194
24 3300031901 Ga0307406_10285798 Ga0307406_102857982 194
25 3300031911 Ga0307412_10004545 Ga0307412_1000454511 194
26 3300031911 Ga0307412_10020466 Ga0307412_100204663 194
27 3300032004 Ga0307414_10000212 Ga0307414_100002123 194
28 3300032004 Ga0307414_11030273 Ga0307414_110302731 194
29 3300041486 Ga0451807_0952868 Ga0451807_0952868_351_974 194
30 3300046507 Ga0495606_0000406 Ga0495606_0000406_37870_38457 194
31 3300046512 Ga0495610_0079212 Ga0495610_0079212_309_932 194
32 3300046522 Ga0495643_0011737 Ga0495643_0011737_3792_4415 194
33 3300046542 Ga0495597_0048924 Ga0495597_0048924_14_598 194
34 3300046616 Ga0495668_0000234 Ga0495668_0000234_11686_12309 194
35 3300046660 Ga0495625_0000195 Ga0495625_0000195_19716_20342 194
36 3300046660 Ga0495625_0151547 Ga0495625_0151547_395_1018 194
37 3300049568 Ga0501031_0394101 Ga0501031_0394101_201_824 194
38 3300049569 Ga0501032_0033728 Ga0501032_0033728_1965_2588 194
39 3300049569 Ga0501032_0064366 Ga0501032_0064366_434_1057 194
40 3300049570 Ga0501033_0082055 Ga0501033_0082055_809_1432 194
41 3300049570 Ga0501033_0101295 Ga0501033_0101295_933_1556 194
42 3300049571 Ga0501034_0028784 Ga0501034_0028784_4245_4868 194
43 3300049571 Ga0501034_0069510 Ga0501034_0069510_925_1548 194
44 3300049572 Ga0501036_0046291 Ga0501036_0046291_2044_2667 194
45 3300049572 Ga0501036_0258734 Ga0501036_0258734_799_1422 194
46 3300049573 Ga0501037_0021339 Ga0501037_0021339_4064_4687 194
47 3300049574 Ga0501038_0210741 Ga0501038_0210741_141_764 194
48 3300049579 Ga0501043_0080443 Ga0501043_0080443_806_1429 194
49 3300049581 Ga0501047_0238586 Ga0501047_0238586_142_765 194
50 3300049688 Ga0501259_000447 Ga0501259_000447_5609_6193 194
51 3300049822 Ga0501035_0019392 Ga0501035_0019392_509_1132 194
52 3300049822 Ga0501035_0028457 Ga0501035_0028457_4279_4902 194
53 3300049823 Ga0501044_0144609 Ga0501044_0144609_937_1560 194
54 3300049823 Ga0501044_0202341 Ga0501044_0202341_1207_1830 194
55 3300053139 Ga0500568_0001218 Ga0500568_0001218_5195_5821 194
56 3300053158 Ga0500627_0000070 Ga0500627_0000070_9410_10033 194
57 3300053158 Ga0500627_0034394 Ga0500627_0034394_789_1412 194
58 iso_pu_bacteria 2643221560 2643819217 194
59 iso_pu_bacteria 2643221563 2643835080 194
60 iso_pu_bacteria 2643221608 2644056007 194
61 3300053136 Ga0500559_0012288 Ga0500559_0012288_2679_3278 196
62 3300003187 JGI25151J46595_10028538 JGI25151J46595_100285381 197
63 3300003215 JGI25153J46596_10000073 JGI25153J46596_100000737 197
64 3300003791 Ga0055530_10012590 Ga0055530_100125903 197
65 3300003792 Ga0055540_1000681 Ga0055540_100068116 197
66 3300005289 Ga0065704_10228453 Ga0065704_102284532 197
67 3300005295 Ga0065707_10081714 Ga0065707_1008171437 197
68 3300006042 Ga0075368_10001003 Ga0075368_1000100312 197
69 3300006048 Ga0075363_100177119 Ga0075363_1001771192 197
70 3300014326 Ga0157380_10000292 Ga0157380_100002925 197
71 3300025245 Ga0207425_1000005 Ga0207425_1000005816 197
72 3300025258 Ga0209129_1000701 Ga0209129_10007016 197
73 3300025263 Ga0209565_1012712 Ga0209565_10127122 197
74 3300025292 Ga0209676_1018923 Ga0209676_10189234 197
75 3300025292 Ga0209676_1028255 Ga0209676_10282552 197
76 3300025294 Ga0209025_1001007 Ga0209025_100100719 197
77 3300025297 Ga0209758_1000002 Ga0209758_1000002529 197
78 3300025298 Ga0209050_1000001 Ga0209050_1000001478 197
79 3300025303 Ga0209051_1000472 Ga0209051_100047226 197
80 3300025304 Ga0209257_1006687 Ga0209257_10066874 197
81 3300025304 Ga0209257_1006698 Ga0209257_10066984 197
82 3300026116 Ga0207674_10052220 Ga0207674_100522202 197
83 3300027866 Ga0209813_10000029 Ga0209813_1000002938 197
84 3300031852 Ga0307410_10064285 Ga0307410_100642852 197
85 3300037471 Ga0395905_0524210 Ga0395905_0524210_325_918 197
86 3300044765 Ga0466970_0140047 Ga0466970_0140047_193_786 197
87 3300046460 Ga0495638_0069970 Ga0495638_0069970_579_1175 197
88 3300046506 Ga0495583_0000279 Ga0495583_0000279_51131_51727 197
89 3300046507 Ga0495606_0143904 Ga0495606_0143904_652_1245 197
90 3300046616 Ga0495668_0002012 Ga0495668_0002012_13728_14321 197
91 3300046648 Ga0495611_0046050 Ga0495611_0046050_217_813 197
92 3300046665 Ga0495661_0028793 Ga0495661_0028793_1042_1638 197
93 3300046691 Ga0495670_0034858 Ga0495670_0034858_119_715 197
94 3300047472 Ga0495686_0001947 Ga0495686_0001947_14931_15527 197
95 3300048905 Ga0496102_0062996 Ga0496102_0062996_1381_1974 197
96 3300048911 Ga0496108_0014447 Ga0496108_0014447_4324_4917 197
97 3300048920 Ga0496117_0038144 Ga0496117_0038144_1692_2285 197
98 3300049460 Ga0495682_0002704 Ga0495682_0002704_5873_6469 197
99 3300049589 Ga0501073_0353401 Ga0501073_0353401_190_783 197
100 3300049686 Ga0501257_000010 Ga0501257_000010_3132_3725 197
101 3300049705 Ga0501225_0034389 Ga0501225_0034389_776_1369 197
102 3300049776 Ga0501280_000314 Ga0501280_000314_6778_7371 197
103 3300050490 nmdc:mga03n38_109448_c1 nmdc:mga03n38_109448_c1_171_764 197
104 3300050494 nmdc:mga06z11_18_c1 nmdc:mga06z11_18_c1_70552_71145 197
105 3300050495 nmdc:mga04h51_133_c1 nmdc:mga04h51_133_c1_14367_14960 197
106 3300053103 Ga0500555_000414 Ga0500555_000414_2533_3129 197
107 3300053134 Ga0500658_0000032 Ga0500658_0000032_21518_22111 197
108 3300009551 Ga0105238_10035160 Ga0105238_100351608 198
109 3300025924 Ga0207694_10027280 Ga0207694_100272808 198
110 3300028800 Ga0265338_10041738 Ga0265338_100417383 198
111 3300039437 Ga0436365_1521972 Ga0436365_1521972_1613_2254 198
112 iso_pu_bacteria 2643221541 2643726801 198
113 iso_pu_bacteria 2643221605 2644040307 198
114 iso_pu_bacteria 2643221606 2644046158 198
115 iso_pu_bacteria 2643221671 2644393031 198
116 3300021388 Ga0213875_10000166 Ga0213875_1000016631 199
117 3300037853 Ga0436364_0545952 Ga0436364_0545952_26519_27160 199
118 3300049686 Ga0501257_052871 Ga0501257_052871_94_693 199
119 3300005295 Ga0065707_10135257 Ga0065707_101352572 202
120 3300005347 Ga0070668_100034767 Ga0070668_1000347673 202
121 3300005577 Ga0068857_100019222 Ga0068857_1000192227 202
122 3300005843 Ga0068860_100494712 Ga0068860_1004947122 202
123 3300009093 Ga0105240_10516262 Ga0105240_105162622 202
124 3300025972 Ga0207668_10024009 Ga0207668_100240093 202
125 3300026116 Ga0207674_10010801 Ga0207674_1001080113 202
126 3300031911 Ga0307412_10016556 Ga0307412_100165562 202
127 3300032005 Ga0307411_11326814 Ga0307411_113268141 202
128 3300048921 Ga0496118_0034563 Ga0496118_0034563_1115_1726 202
129 3300049581 Ga0501047_0001071 Ga0501047_0001071_4985_5593 202
130 3300049582 Ga0501048_0218734 Ga0501048_0218734_342_950 202
131 3300005548 Ga0070665_100171595 Ga0070665_1001715952 204
132 3300031911 Ga0307412_10097394 Ga0307412_100973942 204
133 3300032002 Ga0307416_100106362 Ga0307416_1001063622 204
134 3300046524 Ga0495648_0041650 Ga0495648_0041650_1628_2242 204
135 3300046692 Ga0495671_0006295 Ga0495671_0006295_1539_2153 204
136 3300053087 Ga0500643_019122 Ga0500643_019122_1452_2066 204
137 3300053118 Ga0500594_0001241 Ga0500594_0001241_4206_4820 204
138 3300006847 Ga0075431_100075691 Ga0075431_1000756913 208
139 3300009093 Ga0105240_10261427 Ga0105240_102614272 208
140 3300050510 nmdc:mga06r32_24417_c1 nmdc:mga06r32_24417_c1_3701_4333 208
141 iso_pu_bacteria 2582581305 2585261819 209
142 3300002459 JGI24751J29686_10030215 JGI24751J29686_100302152 213
143 3300005295 Ga0065707_10117631 Ga0065707_101176312 213
144 3300005331 Ga0070670_100002129 Ga0070670_1000021296 213
145 3300005335 Ga0070666_10024671 Ga0070666_100246714 213
146 3300005335 Ga0070666_10244167 Ga0070666_102441672 213
147 3300005347 Ga0070668_100000001 Ga0070668_10000000199 213
148 3300005353 Ga0070669_100011473 Ga0070669_1000114734 213
149 3300005355 Ga0070671_100000106 Ga0070671_1000001067 213
150 3300005355 Ga0070671_100614220 Ga0070671_1006142201 213
151 3300005367 Ga0070667_100000006 Ga0070667_100000006194 213
152 3300005367 Ga0070667_100000066 Ga0070667_10000006660 213
153 3300005530 Ga0070679_100492677 Ga0070679_1004926772 213
154 3300005539 Ga0068853_100187459 Ga0068853_1001874592 213
155 3300005563 Ga0068855_100000468 Ga0068855_10000046824 213
156 3300005577 Ga0068857_100095886 Ga0068857_1000958863 213
157 3300005578 Ga0068854_100020800 Ga0068854_1000208002 213
158 3300005614 Ga0068856_100039601 Ga0068856_1000396014 213
159 3300005617 Ga0068859_100009268 Ga0068859_1000092686 213
160 3300005617 Ga0068859_100033910 Ga0068859_1000339104 213
161 3300005618 Ga0068864_100000306 Ga0068864_10000030638 213
162 3300005841 Ga0068863_100008301 Ga0068863_10000830110 213
163 3300005841 Ga0068863_100012079 Ga0068863_1000120795 213
164 3300005841 Ga0068863_100078264 Ga0068863_1000782643 213
165 3300005841 Ga0068863_100368772 Ga0068863_1003687722 213
166 3300005842 Ga0068858_100000348 Ga0068858_10000034825 213
167 3300005843 Ga0068860_100000013 Ga0068860_100000013179 213
168 3300005843 Ga0068860_100000074 Ga0068860_10000007435 213
169 3300005844 Ga0068862_100000898 Ga0068862_10000089819 213
170 3300006195 Ga0075366_10111101 Ga0075366_101111012 213
171 3300006353 Ga0075370_10071092 Ga0075370_100710921 213
172 3300006931 Ga0097620_100009268 Ga0097620_1000092686 213
173 3300006931 Ga0097620_100033910 Ga0097620_1000339104 213
174 3300009093 Ga0105240_10054262 Ga0105240_100542623 213
175 3300009174 Ga0105241_11136617 Ga0105241_111366171 213
176 3300009177 Ga0105248_10002998 Ga0105248_1000299819 213
177 3300012513 Ga0157326_1000003 Ga0157326_10000037 213
178 3300025903 Ga0207680_10126412 Ga0207680_101264123 213
179 3300025923 Ga0207681_10031885 Ga0207681_100318856 213
180 3300025923 Ga0207681_10133346 Ga0207681_101333462 213
181 3300025925 Ga0207650_10003426 Ga0207650_1000342612 213
182 3300025931 Ga0207644_10000047 Ga0207644_10000047100 213
183 3300025931 Ga0207644_10490802 Ga0207644_104908022 213
184 3300025941 Ga0207711_10004385 Ga0207711_100043854 213
185 3300025949 Ga0207667_10007908 Ga0207667_1000790812 213
186 3300025972 Ga0207668_10000009 Ga0207668_1000000958 213
187 3300025981 Ga0207640_10689872 Ga0207640_106898722 213
188 3300025986 Ga0207658_10000010 Ga0207658_10000010191 213
189 3300025986 Ga0207658_10000132 Ga0207658_1000013249 213
190 3300026035 Ga0207703_10000368 Ga0207703_1000036837 213
191 3300026078 Ga0207702_10029623 Ga0207702_100296235 213
192 3300026088 Ga0207641_10000584 Ga0207641_100005843 213
193 3300026088 Ga0207641_10001281 Ga0207641_1000128118 213
194 3300026088 Ga0207641_10004714 Ga0207641_1000471415 213
195 3300026095 Ga0207676_10001450 Ga0207676_1000145015 213
196 3300026116 Ga0207674_10041523 Ga0207674_100415235 213
197 3300026116 Ga0207674_10166639 Ga0207674_101666393 213
198 3300026142 Ga0207698_11210117 Ga0207698_112101172 213
199 3300028379 Ga0268266_11010151 Ga0268266_110101512 213
200 3300028380 Ga0268265_10002177 Ga0268265_100021775 213
201 3300028381 Ga0268264_10000039 Ga0268264_10000039177 213
202 3300028381 Ga0268264_10000070 Ga0268264_10000070131 213
203 3300031548 Ga0307408_100006528 Ga0307408_1000065285 213
204 3300031731 Ga0307405_10272952 Ga0307405_102729522 213
205 3300031911 Ga0307412_10015076 Ga0307412_100150764 213
206 3300031911 Ga0307412_10274131 Ga0307412_102741312 213
207 3300031911 Ga0307412_10708129 Ga0307412_107081292 213
208 3300032002 Ga0307416_100152851 Ga0307416_1001528512 213
209 3300035695 Ga0373927_0087532 Ga0373927_0087532_1022_1663 213
210 3300046491 Ga0495584_0264677 Ga0495584_0264677_80_721 213
211 3300046522 Ga0495643_0040067 Ga0495643_0040067_1157_1798 213
212 3300046522 Ga0495643_0171817 Ga0495643_0171817_204_845 213
213 3300046524 Ga0495648_0124757 Ga0495648_0124757_173_814 213
214 3300046530 Ga0495654_0010230 Ga0495654_0010230_2388_3029 213
215 3300046538 Ga0495609_0077701 Ga0495609_0077701_439_1080 213
216 3300046616 Ga0495668_0008222 Ga0495668_0008222_271_912 213
217 3300046684 Ga0495669_0215592 Ga0495669_0215592_224_865 213
218 3300046691 Ga0495670_0280641 Ga0495670_0280641_104_745 213
219 3300046810 Ga0495660_0332795 Ga0495660_0332795_23_664 213
220 3300048928 Ga0496125_0035714 Ga0496125_0035714_1748_2389 213
221 3300049513 Ga0501290_000432 Ga0501290_000432_1084_1725 213
222 3300049515 Ga0501292_000013 Ga0501292_000013_59608_60249 213
223 3300049517 Ga0501294_000215 Ga0501294_000215_227_868 213
224 3300049523 Ga0501300_003476 Ga0501300_003476_384_1025 213
225 3300049662 Ga0501222_000462 Ga0501222_000462_4662_5303 213
226 3300049663 Ga0501223_001010 Ga0501223_001010_747_1388 213
227 3300049664 Ga0501224_000280 Ga0501224_000280_3474_4115 213
228 3300049669 Ga0501235_040477 Ga0501235_040477_311_952 213
229 3300049679 Ga0501249_001898 Ga0501249_001898_2322_2963 213
230 3300049690 Ga0501261_000126 Ga0501261_000126_503_1144 213
231 3300049775 Ga0501279_000004 Ga0501279_000004_64478_65119 213
232 3300049776 Ga0501280_000948 Ga0501280_000948_74_715 213
233 3300049777 Ga0501281_00073 Ga0501281_00073_965_1606 213
234 3300049778 Ga0501282_000150 Ga0501282_000150_3182_3823 213
235 3300049779 Ga0501283_032444 Ga0501283_032444_67_708 213
236 3300050493 nmdc:mga0k408_99042_c1 nmdc:mga0k408_99042_c1_300_941 213
237 3300050496 nmdc:mga07m45_27880_c1 nmdc:mga07m45_27880_c1_835_1476 213
238 3300053087 Ga0500643_000403 Ga0500643_000403_19438_20079 213
239 3300053087 Ga0500643_002054 Ga0500643_002054_5565_6206 213
240 3300053091 Ga0500647_0008473 Ga0500647_0008473_1453_2094 213
241 3300053109 Ga0500569_084663 Ga0500569_084663_328_969 213
242 3300053116 Ga0500592_000772 Ga0500592_000772_3922_4563 213
243 3300053123 Ga0500614_010560 Ga0500614_010560_505_1146 213
244 3300053130 Ga0500642_0028578 Ga0500642_0028578_1272_1913 213
245 3300053133 Ga0500655_000383 Ga0500655_000383_2487_3128 213
246 3300053136 Ga0500559_0147321 Ga0500559_0147321_181_822 213
247 3300053142 Ga0500577_0040517 Ga0500577_0040517_23_664 213
248 3300053148 Ga0500590_001839 Ga0500590_001839_5313_5954 213
249 3300053151 Ga0500604_0021847 Ga0500604_0021847_989_1630 213
250 3300053156 Ga0500622_0004156 Ga0500622_0004156_3205_3846 213
251 3300053158 Ga0500627_0000152 Ga0500627_0000152_11714_12355 213
252 3300053158 Ga0500627_0076433 Ga0500627_0076433_121_762 213
253 3300053724 Ga0500570_001639 Ga0500570_001639_4738_5379 213
254 3300002076 JGI24749J21850_1000175 JGI24749J21850_10001758 224
255 3300002459 JGI24751J29686_10000572 JGI24751J29686_100005729 224
256 3300005295 Ga0065707_10093096 Ga0065707_100930964 224
257 3300005331 Ga0070670_100000158 Ga0070670_10000015821 224
258 3300005335 Ga0070666_10026936 Ga0070666_100269363 224
259 3300005353 Ga0070669_100000031 Ga0070669_10000003197 224
260 3300005367 Ga0070667_100003426 Ga0070667_1000034268 224
261 3300005617 Ga0068859_100030308 Ga0068859_1000303087 224
262 3300005618 Ga0068864_100000123 Ga0068864_10000012321 224
263 3300005844 Ga0068862_100000043 Ga0068862_100000043113 224
264 3300006931 Ga0097620_100030305 Ga0097620_1000303053 224
265 3300009177 Ga0105248_10000081 Ga0105248_1000008120 224
266 3300014325 Ga0163163_10407025 Ga0163163_104070252 224
267 3300014326 Ga0157380_10000040 Ga0157380_1000004058 224
268 3300017792 Ga0163161_10117015 Ga0163161_101170153 224
269 3300025903 Ga0207680_10434878 Ga0207680_104348781 224
270 3300025923 Ga0207681_10000014 Ga0207681_10000014302 224
271 3300025925 Ga0207650_10000015 Ga0207650_10000015315 224
272 3300025941 Ga0207711_10006037 Ga0207711_100060378 224
273 3300025986 Ga0207658_10001234 Ga0207658_1000123415 224
274 3300026095 Ga0207676_10000021 Ga0207676_1000002187 224
275 3300026118 Ga0207675_100021606 Ga0207675_1000216067 224
276 3300028380 Ga0268265_10000013 Ga0268265_1000001358 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01121

CoaE

Dephospho-CoA kinase

2

178

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2if2-assembly3.cif.gz_C crystal structure of the putative dephospho-coa kinase from aquifex aeolicus, northeast structural genomics target qr72. 0.8786 1 192
2if2-assembly2.cif.gz_B crystal structure of the putative dephospho-coa kinase from aquifex aeolicus, northeast structural genomics target qr72. 0.8718 1 192
2if2-assembly3.cif.gz_C crystal structure of the putative dephospho-coa kinase from aquifex aeolicus, northeast structural genomics target qr72. 0.8687 1 192
6n39-assembly1.cif.gz_A crystal structure of an dephospho-coa kinase coae from mycobacterium paratuberculosis 0.8606 2 193
2if2-assembly2.cif.gz_B crystal structure of the putative dephospho-coa kinase from aquifex aeolicus, northeast structural genomics target qr72. 0.8596 1 192
ID Description Score Start End Superfamily
af_Q5AK15_1_205_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9275 1 189 3.40.50.300
af_O74414_1_201_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9208 1 189 3.40.50.300
af_P34558_5_214_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9106 2 198 3.40.50.300
af_P9WPA3_1_200_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9054 1 199 3.40.50.300
af_A0A1D6FIF3_118_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9042 75 189 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0Q8Q5E2-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9912 1 201 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A4Q3A1U0-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) 0.9894 1 179 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A1X9YGW4-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9881 1 190 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A2W6TGY6-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.982 2 192 GO:0004140
GO:0005524
GO:0005737
GO:0015937
AF-A0A0Q8Q5E2-F1-model_v4 Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) 0.9815 1 201 GO:0004140
GO:0005524
GO:0005737
GO:0015937

Feature Viewer

pLDDT pTM Quality
87 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map