F381111
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 276 | 160 | 550 | 249 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10023761|Ga0157370_100237612 |
| Length | 275 |
| Sequence | VFICVHPRLNGRAGVVKNPYLNNIHYSMMRAVLIDDEISNLENLQALLQKHCPQVTIIATAQNVSDGVNAIQKYLPDLVFLDIQMGDETGFEVLKQLPTRNFEVIFVTAYDQYGIQAVKFAALDYLLKPVDIEELKDAVIKADRKLATQTAAQLDFLLQQLKKPETNLSKIALQMQSEIRYVTLSEIVRCEADNTYTHFFLAGNEKILVSKSLKEYADLLRPNGFLRTHQSHLVNPRYVKSWLKEDGGVLLLSSGEKIPISKQNKETVKKALQQL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 7 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 20 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 21 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 22 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 23 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 24 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 25 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 46 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 48 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 49 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 53 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 72 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 73 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 74 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 75 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 76 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 77 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 78 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 79 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 80 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 81 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 82 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 83 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 84 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 85 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 86 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 87 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 88 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 89 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 90 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 91 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 92 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 93 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 94 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 95 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 96 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 97 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 98 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 99 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 100 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 101 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 102 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 103 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 116 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 117 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 118 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 119 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 120 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 121 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 122 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 124 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 125 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 126 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 127 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 128 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 129 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 130 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 131 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 132 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 133 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 134 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 135 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 136 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 137 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 138 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 139 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 140 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 141 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 142 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 143 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 144 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 145 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 146 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 147 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 148 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 149 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 150 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 151 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 152 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 153 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 154 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 155 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 156 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 157 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 158 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 159 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 160 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.39 |
| Metatranscriptomes | 0 |
| Isolates | 7.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.22 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 70.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157370_10023761 | 3300013104 | Bacteria | 6082 |
| 2 | rootH2_10023887 | 3300003320 | Bacteria | 21951 |
| 3 | rootH2_10078537 | 3300003320 | Bacteria | 5562 |
| 4 | rootH2_10168598 | 3300003320 | Bacteria | 2847 |
| 5 | rootL2_10051238 | 3300003322 | Unclassified | 4017 |
| 6 | rootL2_10069665 | 3300003322 | Bacteria | 2429 |
| 7 | rootL2_10341996 | 3300003322 | Bacteria | 1365 |
| 8 | rootL2_10372363 | 3300003322 | Unclassified | 1623 |
| 9 | rootH1_10012489 | 3300003323 | Bacteria | 43167 |
| 10 | rootH1_10188757 | 3300003323 | Bacteria | 5745 |
| 11 | rootH1_10391337 | 3300003323 | Bacteria | 2202 |
| 12 | JGI25160J50197_1006635 | 3300003354 | Unclassified | 4659 |
| 13 | Ga0055535_1004229 | 3300003761 | Bacteria | 3594 |
| 14 | Ga0055542_1008377 | 3300003762 | Bacteria | 2029 |
| 15 | Ga0055536_1000001 | 3300003781 | Bacteria | 630663 |
| 16 | Ga0055536_1001266 | 3300003781 | Bacteria | 15565 |
| 17 | Ga0055530_10001525 | 3300003791 | Bacteria | 16697 |
| 18 | Ga0065165_1003121 | 3300005262 | Bacteria | 12285 |
| 19 | Ga0065714_10003494 | 3300005288 | Bacteria | 8468 |
| 20 | Ga0065714_10069347 | 3300005288 | Bacteria | 4212 |
| 21 | Ga0065704_10127578 | 3300005289 | Unclassified | 1673 |
| 22 | Ga0070666_10160661 | 3300005335 | Bacteria | 1570 |
| 23 | Ga0068868_100119047 | 3300005338 | Bacteria | 2153 |
| 24 | Ga0070674_100012556 | 3300005356 | Bacteria | 5206 |
| 25 | Ga0070667_100254638 | 3300005367 | Bacteria | 1570 |
| 26 | Ga0070667_100334682 | 3300005367 | Bacteria | 1368 |
| 27 | Ga0070681_10090347 | 3300005458 | Bacteria | 3013 |
| 28 | Ga0070679_100005624 | 3300005530 | Bacteria | 11610 |
| 29 | Ga0068855_100006640 | 3300005563 | Bacteria | 14051 |
| 30 | Ga0068855_100730085 | 3300005563 | Unclassified | 1058 |
| 31 | Ga0068859_100105587 | 3300005617 | Bacteria | 2876 |
| 32 | Ga0068860_100000024 | 3300005843 | Bacteria | 271902 |
| 33 | Ga0068860_100013878 | 3300005843 | Bacteria | 7900 |
| 34 | Ga0068860_100110142 | 3300005843 | Bacteria | 2632 |
| 35 | Ga0068862_100600671 | 3300005844 | Unclassified | 1056 |
| 36 | Ga0075366_10196925 | 3300006195 | Bacteria | 1225 |
| 37 | Ga0075370_10272043 | 3300006353 | Unclassified | 1006 |
| 38 | Ga0097620_100105584 | 3300006931 | Bacteria | 2876 |
| 39 | Ga0105244_10006427 | 3300009036 | Bacteria | 7608 |
| 40 | Ga0105240_10000670 | 3300009093 | Bacteria | 62864 |
| 41 | Ga0105240_10001259 | 3300009093 | Bacteria | 43960 |
| 42 | Ga0105240_10045517 | 3300009093 | Bacteria | 5565 |
| 43 | Ga0105240_10073690 | 3300009093 | Bacteria | 4216 |
| 44 | Ga0105240_10182498 | 3300009093 | Unclassified | 2475 |
| 45 | Ga0105240_10683764 | 3300009093 | Unclassified | 1122 |
| 46 | Ga0111539_10145088 | 3300009094 | Unclassified | 2779 |
| 47 | Ga0114129_10002084 | 3300009147 | Bacteria | 27490 |
| 48 | Ga0105241_10003192 | 3300009174 | Bacteria | 12201 |
| 49 | Ga0105241_10016477 | 3300009174 | Bacteria | 5422 |
| 50 | Ga0105241_10036253 | 3300009174 | Bacteria | 3710 |
| 51 | Ga0105241_10280881 | 3300009174 | Bacteria | 1422 |
| 52 | Ga0105241_10415089 | 3300009174 | Bacteria | 1183 |
| 53 | Ga0105241_10423470 | 3300009174 | Bacteria | 1172 |
| 54 | Ga0105237_10001472 | 3300009545 | Bacteria | 31032 |
| 55 | Ga0105237_10002733 | 3300009545 | Bacteria | 21511 |
| 56 | Ga0105237_10005678 | 3300009545 | Bacteria | 14036 |
| 57 | Ga0105237_10009779 | 3300009545 | Bacteria | 10254 |
| 58 | Ga0105237_10056675 | 3300009545 | Viruses | 3922 |
| 59 | Ga0105237_10197841 | 3300009545 | Bacteria | 2009 |
| 60 | Ga0105237_10620190 | 3300009545 | Bacteria | 1088 |
| 61 | Ga0105238_10052154 | 3300009551 | Bacteria | 4113 |
| 62 | Ga0105238_10084790 | 3300009551 | Unclassified | 3158 |
| 63 | Ga0105249_10128447 | 3300009553 | Bacteria | 2417 |
| 64 | Ga0105239_10000004 | 3300010375 | Bacteria | 532483 |
| 65 | Ga0105239_10000754 | 3300010375 | Bacteria | 45868 |
| 66 | Ga0105239_10000930 | 3300010375 | Bacteria | 41477 |
| 67 | Ga0105239_10003809 | 3300010375 | Bacteria | 18339 |
| 68 | Ga0105239_10014908 | 3300010375 | Bacteria | 8616 |
| 69 | Ga0105239_10066811 | 3300010375 | Bacteria | 3950 |
| 70 | Ga0105239_10066846 | 3300010375 | Viruses | 3949 |
| 71 | Ga0105239_10074971 | 3300010375 | Bacteria | 3720 |
| 72 | Ga0105239_10359099 | 3300010375 | Bacteria | 1645 |
| 73 | Ga0157373_10042165 | 3300013100 | Bacteria | 3262 |
| 74 | Ga0157371_10000296 | 3300013102 | Bacteria | 66267 |
| 75 | Ga0157370_10007019 | 3300013104 | Bacteria | 12300 |
| 76 | Ga0157370_10024373 | 3300013104 | Bacteria | 5992 |
| 77 | Ga0157370_10033806 | 3300013104 | Bacteria | 4983 |
| 78 | Ga0157370_10047113 | 3300013104 | Bacteria | 4133 |
| 79 | Ga0157370_10110260 | 3300013104 | Bacteria | 2573 |
| 80 | Ga0157370_10211487 | 3300013104 | Bacteria | 1797 |
| 81 | Ga0157370_10211914 | 3300013104 | Bacteria | 1795 |
| 82 | Ga0157370_10349294 | 3300013104 | Bacteria | 1363 |
| 83 | Ga0157369_10000164 | 3300013105 | Bacteria | 94229 |
| 84 | Ga0157374_10000003 | 3300013296 | Bacteria | 854471 |
| 85 | Ga0157374_10032076 | 3300013296 | Bacteria | 4781 |
| 86 | Ga0157378_10414954 | 3300013297 | Bacteria | 1329 |
| 87 | Ga0163162_10000300 | 3300013306 | Bacteria | 45491 |
| 88 | Ga0163162_10002109 | 3300013306 | Bacteria | 18677 |
| 89 | Ga0157372_10018111 | 3300013307 | Bacteria | 7571 |
| 90 | Ga0157372_10020836 | 3300013307 | Bacteria | 7080 |
| 91 | Ga0157372_10062975 | 3300013307 | Unclassified | 4157 |
| 92 | Ga0157375_10046520 | 3300013308 | Bacteria | 4231 |
| 93 | Ga0163163_10081401 | 3300014325 | Bacteria | 3240 |
| 94 | Ga0157380_10005041 | 3300014326 | Bacteria | 9210 |
| 95 | Ga0182008_10000167 | 3300014497 | Bacteria | 51397 |
| 96 | Ga0182008_10000267 | 3300014497 | Bacteria | 41024 |
| 97 | Ga0157376_10003782 | 3300014969 | Bacteria | 10465 |
| 98 | Ga0157376_10478302 | 3300014969 | Bacteria | 1220 |
| 99 | Ga0182006_1000324 | 3300015261 | Bacteria | 41463 |
| 100 | Ga0182006_1002827 | 3300015261 | Bacteria | 9254 |
| 101 | Ga0182006_1004498 | 3300015261 | Bacteria | 6864 |
| 102 | Ga0182007_10000005 | 3300015262 | Bacteria | 442702 |
| 103 | Ga0182007_10020729 | 3300015262 | Bacteria | 2344 |
| 104 | Ga0163161_10000135 | 3300017792 | Bacteria | 69859 |
| 105 | Ga0163161_10000470 | 3300017792 | Bacteria | 33480 |
| 106 | Ga0163161_10003275 | 3300017792 | Bacteria | 11382 |
| 107 | Ga0163161_10003490 | 3300017792 | Bacteria | 11013 |
| 108 | Ga0163161_10093822 | 3300017792 | Bacteria | 2224 |
| 109 | Ga0209436_103495 | 3300025208 | Unclassified | 4159 |
| 110 | Ga0209258_100691 | 3300025242 | Bacteria | 23257 |
| 111 | Ga0209026_1005542 | 3300025250 | Bacteria | 3363 |
| 112 | Ga0209148_1000357 | 3300025254 | Bacteria | 58732 |
| 113 | Ga0209130_1003434 | 3300025284 | Bacteria | 6733 |
| 114 | Ga0209676_1000008 | 3300025292 | Bacteria | 991778 |
| 115 | Ga0209676_1001014 | 3300025292 | Bacteria | 32843 |
| 116 | Ga0209050_1000343 | 3300025298 | Bacteria | 92045 |
| 117 | Ga0209050_1031335 | 3300025298 | Bacteria | 1659 |
| 118 | Ga0207426_1000345 | 3300025302 | Bacteria | 85840 |
| 119 | Ga0207655_1019459 | 3300025728 | Bacteria | 3545 |
| 120 | Ga0207654_10003046 | 3300025911 | Bacteria | 8493 |
| 121 | Ga0207654_10011912 | 3300025911 | Bacteria | 4446 |
| 122 | Ga0207654_10103724 | 3300025911 | Bacteria | 1756 |
| 123 | Ga0207654_10130228 | 3300025911 | Bacteria | 1591 |
| 124 | Ga0207654_10228294 | 3300025911 | Bacteria | 1238 |
| 125 | Ga0207707_10167399 | 3300025912 | Bacteria | 1921 |
| 126 | Ga0207695_10000183 | 3300025913 | Bacteria | 181350 |
| 127 | Ga0207695_10002398 | 3300025913 | Bacteria | 27780 |
| 128 | Ga0207695_10083392 | 3300025913 | Bacteria | 3229 |
| 129 | Ga0207695_10269597 | 3300025913 | Bacteria | 1598 |
| 130 | Ga0207695_10356863 | 3300025913 | Bacteria | 1348 |
| 131 | Ga0207671_10003846 | 3300025914 | Bacteria | 14685 |
| 132 | Ga0207671_10004136 | 3300025914 | Bacteria | 14032 |
| 133 | Ga0207671_10005973 | 3300025914 | Bacteria | 11024 |
| 134 | Ga0207671_10008146 | 3300025914 | Bacteria | 8942 |
| 135 | Ga0207671_10028198 | 3300025914 | Bacteria | 4197 |
| 136 | Ga0207671_10428800 | 3300025914 | Bacteria | 1052 |
| 137 | Ga0207652_10000016 | 3300025921 | Bacteria | 188815 |
| 138 | Ga0207694_10054129 | 3300025924 | Unclassified | 3113 |
| 139 | Ga0207694_10066125 | 3300025924 | Bacteria | 2820 |
| 140 | Ga0207689_10011780 | 3300025942 | Bacteria | 7493 |
| 141 | Ga0207667_10008998 | 3300025949 | Bacteria | 11812 |
| 142 | Ga0207658_10704990 | 3300025986 | Bacteria | 912 |
| 143 | Ga0207648_10102134 | 3300026089 | Bacteria | 2513 |
| 144 | Ga0268265_10812403 | 3300028380 | Unclassified | 912 |
| 145 | Ga0268264_10000028 | 3300028381 | Bacteria | 426662 |
| 146 | Ga0268264_10000143 | 3300028381 | Bacteria | 170031 |
| 147 | Ga0268264_10009839 | 3300028381 | Bacteria | 7914 |
| 148 | Ga0268264_10255195 | 3300028381 | Bacteria | 1631 |
| 149 | Ga0307517_10036100 | 3300028786 | Bacteria | 5571 |
| 150 | Ga0307515_10049568 | 3300028794 | Bacteria | 6312 |
| 151 | Ga0307511_10000182 | 3300030521 | Bacteria | 62310 |
| 152 | Ga0307511_10000211 | 3300030521 | Bacteria | 59246 |
| 153 | Ga0265327_10000152 | 3300031251 | Bacteria | 149065 |
| 154 | Ga0265327_10000456 | 3300031251 | Bacteria | 73362 |
| 155 | Ga0265327_10023633 | 3300031251 | Bacteria | 3636 |
| 156 | Ga0265327_10099049 | 3300031251 | Bacteria | 1409 |
| 157 | Ga0265316_10366972 | 3300031344 | Bacteria | 1040 |
| 158 | Ga0307513_10073196 | 3300031456 | Bacteria | 3568 |
| 159 | Ga0307509_10038921 | 3300031507 | Bacteria | 5183 |
| 160 | Ga0307509_10067868 | 3300031507 | Bacteria | 3734 |
| 161 | Ga0307408_100002783 | 3300031548 | Bacteria | 12137 |
| 162 | Ga0307408_100004578 | 3300031548 | Bacteria | 9365 |
| 163 | Ga0307408_100014075 | 3300031548 | Bacteria | 5314 |
| 164 | Ga0307408_100120637 | 3300031548 | Bacteria | 2030 |
| 165 | Ga0307405_10000011 | 3300031731 | Bacteria | 241071 |
| 166 | Ga0307413_10518192 | 3300031824 | Bacteria | 961 |
| 167 | Ga0307407_10000001 | 3300031903 | Bacteria | 570048 |
| 168 | Ga0307412_10011123 | 3300031911 | Bacteria | 5204 |
| 169 | Ga0307409_100014755 | 3300031995 | Bacteria | 5097 |
| 170 | Ga0307416_100000026 | 3300032002 | Bacteria | 172622 |
| 171 | Ga0307414_10002196 | 3300032004 | Bacteria | 10181 |
| 172 | Ga0307414_10616682 | 3300032004 | Bacteria | 975 |
| 173 | Ga0307507_10002394 | 3300033179 | Bacteria | 39588 |
| 174 | Ga0373927_0092734 | 3300035695 | Bacteria | 1962 |
| 175 | Ga0400488_37193 | 3300038741 | Unclassified | 1967 |
| 176 | Ga0439445_0023321 | 3300042004 | Bacteria | 1566 |
| 177 | Ga0439449_0073297 | 3300042007 | Bacteria | 1262 |
| 178 | Ga0439457_038372 | 3300042014 | Bacteria | 1066 |
| 179 | Ga0439462_0049664 | 3300042015 | Unclassified | 1126 |
| 180 | Ga0451577_0093257 | 3300042876 | Bacteria | 2689 |
| 181 | Ga0451577_0250482 | 3300042876 | Unclassified | 1603 |
| 182 | Ga0466969_0045012 | 3300044656 | Bacteria | 2192 |
| 183 | Ga0453683_0007477 | 3300044673 | Bacteria | 7406 |
| 184 | Ga0453683_0013389 | 3300044673 | Bacteria | 5358 |
| 185 | Ga0453683_0016930 | 3300044673 | Unclassified | 4698 |
| 186 | Ga0466961_0022239 | 3300044693 | Bacteria | 4079 |
| 187 | Ga0453684_0042672 | 3300044712 | Bacteria | 6111 |
| 188 | Ga0453684_0051778 | 3300044712 | Bacteria | 5376 |
| 189 | Ga0453684_0466197 | 3300044712 | Unclassified | 1404 |
| 190 | Ga0466971_0063844 | 3300044719 | Bacteria | 1667 |
| 191 | Ga0466970_0061558 | 3300044765 | Bacteria | 2011 |
| 192 | Ga0466957_0018776 | 3300044842 | Unclassified | 4063 |
| 193 | Ga0466959_0000420 | 3300045049 | Bacteria | 24757 |
| 194 | Ga0451576_0011730 | 3300045051 | Bacteria | 9927 |
| 195 | Ga0451576_0230954 | 3300045051 | Unclassified | 1932 |
| 196 | Ga0495606_0003772 | 3300046507 | Bacteria | 15754 |
| 197 | Ga0495606_0006333 | 3300046507 | Bacteria | 10954 |
| 198 | Ga0495606_0064449 | 3300046507 | Bacteria | 2332 |
| 199 | Ga0495610_0000048 | 3300046512 | Bacteria | 150249 |
| 200 | Ga0495610_0000367 | 3300046512 | Bacteria | 46922 |
| 201 | Ga0495628_0412247 | 3300046516 | Bacteria | 986 |
| 202 | Ga0495648_0013080 | 3300046524 | Bacteria | 6155 |
| 203 | Ga0495609_0009776 | 3300046538 | Bacteria | 4626 |
| 204 | Ga0495633_0000012 | 3300046558 | Bacteria | 267875 |
| 205 | Ga0495633_0000593 | 3300046558 | Bacteria | 35033 |
| 206 | Ga0495633_0017635 | 3300046558 | Bacteria | 3645 |
| 207 | Ga0495668_0045869 | 3300046616 | Bacteria | 2429 |
| 208 | Ga0495611_0000337 | 3300046648 | Bacteria | 30560 |
| 209 | Ga0495625_0001450 | 3300046660 | Bacteria | 28784 |
| 210 | Ga0495625_0133755 | 3300046660 | Bacteria | 1678 |
| 211 | Ga0495625_0213386 | 3300046660 | Unclassified | 1268 |
| 212 | Ga0495625_0441054 | 3300046660 | Bacteria | 806 |
| 213 | Ga0495658_0045938 | 3300046683 | Bacteria | 2453 |
| 214 | Ga0495687_000261 | 3300047443 | Bacteria | 71090 |
| 215 | Ga0495686_0001801 | 3300047472 | Bacteria | 21688 |
| 216 | Ga0495686_0163556 | 3300047472 | Unclassified | 1299 |
| 217 | Ga0496116_0001232 | 3300048919 | Bacteria | 29803 |
| 218 | Ga0496117_0001753 | 3300048920 | Bacteria | 29865 |
| 219 | Ga0496117_0010394 | 3300048920 | Bacteria | 8491 |
| 220 | Ga0496118_0026783 | 3300048921 | Bacteria | 4901 |
| 221 | Ga0496118_0093275 | 3300048921 | Bacteria | 2063 |
| 222 | Ga0496122_0006098 | 3300048925 | Bacteria | 14037 |
| 223 | Ga0496122_0009244 | 3300048925 | Bacteria | 10426 |
| 224 | Ga0496123_0004042 | 3300048926 | Bacteria | 15814 |
| 225 | Ga0496124_0220599 | 3300048927 | Bacteria | 1426 |
| 226 | Ga0501033_0341248 | 3300049570 | Bacteria | 1050 |
| 227 | Ga0501034_0043262 | 3300049571 | Bacteria | 4559 |
| 228 | Ga0501223_000463 | 3300049663 | Bacteria | 9791 |
| 229 | Ga0501257_036398 | 3300049686 | Unclassified | 1199 |
| 230 | nmdc:mga0k408_22109_c1 | 3300050493 | Bacteria | 3579 |
| 231 | nmdc:mga0k408_278594_c1 | 3300050493 | Bacteria | 998 |
| 232 | nmdc:mga07m45_91328_c2 | 3300050496 | Bacteria | 1174 |
| 233 | Ga0500644_0064191 | 3300053088 | Bacteria | 1304 |
| 234 | Ga0500583_0006586 | 3300053092 | Unclassified | 4011 |
| 235 | Ga0500583_0071299 | 3300053092 | Bacteria | 1662 |
| 236 | Ga0500650_0069286 | 3300053098 | Unclassified | 1649 |
| 237 | Ga0500556_0025929 | 3300053104 | Bacteria | 1942 |
| 238 | Ga0500562_000117 | 3300053108 | Bacteria | 26644 |
| 239 | Ga0500594_0008353 | 3300053118 | Bacteria | 2359 |
| 240 | Ga0500618_000016 | 3300053125 | Bacteria | 164049 |
| 241 | Ga0500642_0004302 | 3300053130 | Unclassified | 4439 |
| 242 | Ga0500652_004119 | 3300053131 | Bacteria | 4464 |
| 243 | Ga0500559_0128143 | 3300053136 | Bacteria | 1184 |
| 244 | Ga0500577_0107927 | 3300053142 | Unclassified | 1146 |
| 245 | Ga0500604_0001998 | 3300053151 | Bacteria | 5650 |
| 246 | Ga0500616_0133533 | 3300053153 | Bacteria | 1170 |
| 247 | Ga0500622_0000176 | 3300053156 | Bacteria | 69125 |
| 248 | Ga0500622_0004840 | 3300053156 | Bacteria | 8263 |
| 249 | Ga0500636_0113742 | 3300053177 | Bacteria | 1526 |
| 250 | Ga0500637_0085231 | 3300053178 | Bacteria | 1827 |
| 251 | Ga0500611_000001 | 3300053727 | Bacteria | 385744 |
| 252 | Ga0500645_016536 | 3300053730 | Bacteria | 2322 |
| 253 | Ga0500661_002422 | 3300055283 | Bacteria | 3515 |
| 254 | Ga0466962_0011049 | 3300061719 | Bacteria | 4347 |
| 255 | 2586208858 | 2585427687 | Bacteria | 5544917 |
| 256 | 2586209912 | 2585427687 | Bacteria | 5544917 |
| 257 | 2722730268 | 2721755487 | Bacteria | 6357185 |
| 258 | 2738727927 | 2738541278 | Bacteria | 9755573 |
| 259 | 2738731150 | 2738541278 | Bacteria | 9755573 |
| 260 | 2738754729 | 2738541283 | Bacteria | 7222293 |
| 261 | 2738758672 | 2738541283 | Bacteria | 7222293 |
| 262 | 2739586875 | 2739367651 | Bacteria | 6359826 |
| 263 | 2739587289 | 2739367651 | Bacteria | 6359826 |
| 264 | 2739590488 | 2739367651 | Bacteria | 6359826 |
| 265 | 2739646170 | 2739367663 | Bacteria | 5040914 |
| 266 | 2819547329 | 2818991437 | Bacteria | 5805520 |
| 267 | 2842727460 | 2842722452 | Bacteria | 6263924 |
| 268 | 2842913857 | 2842909656 | Bacteria | 6185908 |
| 269 | 2849283451 | 2849281842 | Bacteria | 6065644 |
| 270 | 2896318462 | 2896317667 | Bacteria | 4606601 |
| 271 | 2904447800 | 2904445276 | Bacteria | 5310396 |
| 272 | 2919189804 | 2919186247 | Bacteria | 6244071 |
| 273 | 2919191180 | 2919186247 | Bacteria | 6244071 |
| 274 | 2939668082 | 2939664404 | Bacteria | 6364494 |
| 275 | 2939669459 | 2939664404 | Bacteria | 6364494 |
| 276 | Ga0157370_10023761 | |||
| 277 | rootH2_10023887 | |||
| 278 | rootH2_10078537 | |||
| 279 | rootH2_10168598 | |||
| 280 | rootL2_10051238 | |||
| 281 | rootL2_10069665 | |||
| 282 | rootL2_10341996 | |||
| 283 | rootL2_10372363 | |||
| 284 | rootH1_10012489 | |||
| 285 | rootH1_10188757 | |||
| 286 | rootH1_10391337 | |||
| 287 | JGI25160J50197_1006635 | |||
| 288 | Ga0055535_1004229 | |||
| 289 | Ga0055542_1008377 | |||
| 290 | Ga0055536_1000001 | |||
| 291 | Ga0055536_1001266 | |||
| 292 | Ga0055530_10001525 | |||
| 293 | Ga0065165_1003121 | |||
| 294 | Ga0065714_10003494 | |||
| 295 | Ga0065714_10069347 | |||
| 296 | Ga0065704_10127578 | |||
| 297 | Ga0070666_10160661 | |||
| 298 | Ga0068868_100119047 | |||
| 299 | Ga0070674_100012556 | |||
| 300 | Ga0070667_100254638 | |||
| 301 | Ga0070667_100334682 | |||
| 302 | Ga0070681_10090347 | |||
| 303 | Ga0070679_100005624 | |||
| 304 | Ga0068855_100006640 | |||
| 305 | Ga0068855_100730085 | |||
| 306 | Ga0068859_100105587 | |||
| 307 | Ga0068860_100000024 | |||
| 308 | Ga0068860_100013878 | |||
| 309 | Ga0068860_100110142 | |||
| 310 | Ga0068862_100600671 | |||
| 311 | Ga0075366_10196925 | |||
| 312 | Ga0075370_10272043 | |||
| 313 | Ga0097620_100105584 | |||
| 314 | Ga0105244_10006427 | |||
| 315 | Ga0105240_10000670 | |||
| 316 | Ga0105240_10001259 | |||
| 317 | Ga0105240_10045517 | |||
| 318 | Ga0105240_10073690 | |||
| 319 | Ga0105240_10182498 | |||
| 320 | Ga0105240_10683764 | |||
| 321 | Ga0111539_10145088 | |||
| 322 | Ga0114129_10002084 | |||
| 323 | Ga0105241_10003192 | |||
| 324 | Ga0105241_10016477 | |||
| 325 | Ga0105241_10036253 | |||
| 326 | Ga0105241_10280881 | |||
| 327 | Ga0105241_10415089 | |||
| 328 | Ga0105241_10423470 | |||
| 329 | Ga0105237_10001472 | |||
| 330 | Ga0105237_10002733 | |||
| 331 | Ga0105237_10005678 | |||
| 332 | Ga0105237_10009779 | |||
| 333 | Ga0105237_10056675 | |||
| 334 | Ga0105237_10197841 | |||
| 335 | Ga0105237_10620190 | |||
| 336 | Ga0105238_10052154 | |||
| 337 | Ga0105238_10084790 | |||
| 338 | Ga0105249_10128447 | |||
| 339 | Ga0105239_10000004 | |||
| 340 | Ga0105239_10000754 | |||
| 341 | Ga0105239_10000930 | |||
| 342 | Ga0105239_10003809 | |||
| 343 | Ga0105239_10014908 | |||
| 344 | Ga0105239_10066811 | |||
| 345 | Ga0105239_10066846 | |||
| 346 | Ga0105239_10074971 | |||
| 347 | Ga0105239_10359099 | |||
| 348 | Ga0157373_10042165 | |||
| 349 | Ga0157371_10000296 | |||
| 350 | Ga0157370_10007019 | |||
| 351 | Ga0157370_10024373 | |||
| 352 | Ga0157370_10033806 | |||
| 353 | Ga0157370_10047113 | |||
| 354 | Ga0157370_10110260 | |||
| 355 | Ga0157370_10211487 | |||
| 356 | Ga0157370_10211914 | |||
| 357 | Ga0157370_10349294 | |||
| 358 | Ga0157369_10000164 | |||
| 359 | Ga0157374_10000003 | |||
| 360 | Ga0157374_10032076 | |||
| 361 | Ga0157378_10414954 | |||
| 362 | Ga0163162_10000300 | |||
| 363 | Ga0163162_10002109 | |||
| 364 | Ga0157372_10018111 | |||
| 365 | Ga0157372_10020836 | |||
| 366 | Ga0157372_10062975 | |||
| 367 | Ga0157375_10046520 | |||
| 368 | Ga0163163_10081401 | |||
| 369 | Ga0157380_10005041 | |||
| 370 | Ga0182008_10000167 | |||
| 371 | Ga0182008_10000267 | |||
| 372 | Ga0157376_10003782 | |||
| 373 | Ga0157376_10478302 | |||
| 374 | Ga0182006_1000324 | |||
| 375 | Ga0182006_1002827 | |||
| 376 | Ga0182006_1004498 | |||
| 377 | Ga0182007_10000005 | |||
| 378 | Ga0182007_10020729 | |||
| 379 | Ga0163161_10000135 | |||
| 380 | Ga0163161_10000470 | |||
| 381 | Ga0163161_10003275 | |||
| 382 | Ga0163161_10003490 | |||
| 383 | Ga0163161_10093822 | |||
| 384 | Ga0209436_103495 | |||
| 385 | Ga0209258_100691 | |||
| 386 | Ga0209026_1005542 | |||
| 387 | Ga0209148_1000357 | |||
| 388 | Ga0209130_1003434 | |||
| 389 | Ga0209676_1000008 | |||
| 390 | Ga0209676_1001014 | |||
| 391 | Ga0209050_1000343 | |||
| 392 | Ga0209050_1031335 | |||
| 393 | Ga0207426_1000345 | |||
| 394 | Ga0207655_1019459 | |||
| 395 | Ga0207654_10003046 | |||
| 396 | Ga0207654_10011912 | |||
| 397 | Ga0207654_10103724 | |||
| 398 | Ga0207654_10130228 | |||
| 399 | Ga0207654_10228294 | |||
| 400 | Ga0207707_10167399 | |||
| 401 | Ga0207695_10000183 | |||
| 402 | Ga0207695_10002398 | |||
| 403 | Ga0207695_10083392 | |||
| 404 | Ga0207695_10269597 | |||
| 405 | Ga0207695_10356863 | |||
| 406 | Ga0207671_10003846 | |||
| 407 | Ga0207671_10004136 | |||
| 408 | Ga0207671_10005973 | |||
| 409 | Ga0207671_10008146 | |||
| 410 | Ga0207671_10028198 | |||
| 411 | Ga0207671_10428800 | |||
| 412 | Ga0207652_10000016 | |||
| 413 | Ga0207694_10054129 | |||
| 414 | Ga0207694_10066125 | |||
| 415 | Ga0207689_10011780 | |||
| 416 | Ga0207667_10008998 | |||
| 417 | Ga0207658_10704990 | |||
| 418 | Ga0207648_10102134 | |||
| 419 | Ga0268265_10812403 | |||
| 420 | Ga0268264_10000028 | |||
| 421 | Ga0268264_10000143 | |||
| 422 | Ga0268264_10009839 | |||
| 423 | Ga0268264_10255195 | |||
| 424 | Ga0307517_10036100 | |||
| 425 | Ga0307515_10049568 | |||
| 426 | Ga0307511_10000182 | |||
| 427 | Ga0307511_10000211 | |||
| 428 | Ga0265327_10000152 | |||
| 429 | Ga0265327_10000456 | |||
| 430 | Ga0265327_10023633 | |||
| 431 | Ga0265327_10099049 | |||
| 432 | Ga0265316_10366972 | |||
| 433 | Ga0307513_10073196 | |||
| 434 | Ga0307509_10038921 | |||
| 435 | Ga0307509_10067868 | |||
| 436 | Ga0307408_100002783 | |||
| 437 | Ga0307408_100004578 | |||
| 438 | Ga0307408_100014075 | |||
| 439 | Ga0307408_100120637 | |||
| 440 | Ga0307405_10000011 | |||
| 441 | Ga0307413_10518192 | |||
| 442 | Ga0307407_10000001 | |||
| 443 | Ga0307412_10011123 | |||
| 444 | Ga0307409_100014755 | |||
| 445 | Ga0307416_100000026 | |||
| 446 | Ga0307414_10002196 | |||
| 447 | Ga0307414_10616682 | |||
| 448 | Ga0307507_10002394 | |||
| 449 | Ga0373927_0092734 | |||
| 450 | Ga0400488_37193 | |||
| 451 | Ga0439445_0023321 | |||
| 452 | Ga0439449_0073297 | |||
| 453 | Ga0439457_038372 | |||
| 454 | Ga0439462_0049664 | |||
| 455 | Ga0451577_0093257 | |||
| 456 | Ga0451577_0250482 | |||
| 457 | Ga0466969_0045012 | |||
| 458 | Ga0453683_0007477 | |||
| 459 | Ga0453683_0013389 | |||
| 460 | Ga0453683_0016930 | |||
| 461 | Ga0466961_0022239 | |||
| 462 | Ga0453684_0042672 | |||
| 463 | Ga0453684_0051778 | |||
| 464 | Ga0453684_0466197 | |||
| 465 | Ga0466971_0063844 | |||
| 466 | Ga0466970_0061558 | |||
| 467 | Ga0466957_0018776 | |||
| 468 | Ga0466959_0000420 | |||
| 469 | Ga0451576_0011730 | |||
| 470 | Ga0451576_0230954 | |||
| 471 | Ga0495606_0003772 | |||
| 472 | Ga0495606_0006333 | |||
| 473 | Ga0495606_0064449 | |||
| 474 | Ga0495610_0000048 | |||
| 475 | Ga0495610_0000367 | |||
| 476 | Ga0495628_0412247 | |||
| 477 | Ga0495648_0013080 | |||
| 478 | Ga0495609_0009776 | |||
| 479 | Ga0495633_0000012 | |||
| 480 | Ga0495633_0000593 | |||
| 481 | Ga0495633_0017635 | |||
| 482 | Ga0495668_0045869 | |||
| 483 | Ga0495611_0000337 | |||
| 484 | Ga0495625_0001450 | |||
| 485 | Ga0495625_0133755 | |||
| 486 | Ga0495625_0213386 | |||
| 487 | Ga0495625_0441054 | |||
| 488 | Ga0495658_0045938 | |||
| 489 | Ga0495687_000261 | |||
| 490 | Ga0495686_0001801 | |||
| 491 | Ga0495686_0163556 | |||
| 492 | Ga0496116_0001232 | |||
| 493 | Ga0496117_0001753 | |||
| 494 | Ga0496117_0010394 | |||
| 495 | Ga0496118_0026783 | |||
| 496 | Ga0496118_0093275 | |||
| 497 | Ga0496122_0006098 | |||
| 498 | Ga0496122_0009244 | |||
| 499 | Ga0496123_0004042 | |||
| 500 | Ga0496124_0220599 | |||
| 501 | Ga0501033_0341248 | |||
| 502 | Ga0501034_0043262 | |||
| 503 | Ga0501223_000463 | |||
| 504 | Ga0501257_036398 | |||
| 505 | nmdc:mga0k408_22109_c1 | |||
| 506 | nmdc:mga0k408_278594_c1 | |||
| 507 | nmdc:mga07m45_91328_c2 | |||
| 508 | Ga0500644_0064191 | |||
| 509 | Ga0500583_0006586 | |||
| 510 | Ga0500583_0071299 | |||
| 511 | Ga0500650_0069286 | |||
| 512 | Ga0500556_0025929 | |||
| 513 | Ga0500562_000117 | |||
| 514 | Ga0500594_0008353 | |||
| 515 | Ga0500618_000016 | |||
| 516 | Ga0500642_0004302 | |||
| 517 | Ga0500652_004119 | |||
| 518 | Ga0500559_0128143 | |||
| 519 | Ga0500577_0107927 | |||
| 520 | Ga0500604_0001998 | |||
| 521 | Ga0500616_0133533 | |||
| 522 | Ga0500622_0000176 | |||
| 523 | Ga0500622_0004840 | |||
| 524 | Ga0500636_0113742 | |||
| 525 | Ga0500637_0085231 | |||
| 526 | Ga0500611_000001 | |||
| 527 | Ga0500645_016536 | |||
| 528 | Ga0500661_002422 | |||
| 529 | Ga0466962_0011049 | |||
| 530 | 2586208858 | |||
| 531 | 2586209912 | |||
| 532 | 2722730268 | |||
| 533 | 2738727927 | |||
| 534 | 2738731150 | |||
| 535 | 2738754729 | |||
| 536 | 2738758672 | |||
| 537 | 2739586875 | |||
| 538 | 2739587289 | |||
| 539 | 2739590488 | |||
| 540 | 2739646170 | |||
| 541 | 2819547329 | |||
| 542 | 2842727460 | |||
| 543 | 2842913857 | |||
| 544 | 2849283451 | |||
| 545 | 2896318462 | |||
| 546 | 2904447800 | |||
| 547 | 2919189804 | |||
| 548 | 2919191180 | |||
| 549 | 2939668082 | |||
| 550 | 2939669459 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6swl-assembly2.cif.gz_B | the rec domain of xync, a response regulator from geobacillus stearothermophilus | 0.8866 | 2 | 124 |
| 2zwm-assembly1.cif.gz_B | crystal structure of yycf receiver domain from bacillus subtilis | 0.8861 | 2 | 117 |
| 2qv0-assembly1.cif.gz_A | crystal structure of the response regulatory domain of protein mrke from klebsiella pneumoniae | 0.8849 | 3 | 122 |
| 3f6c-assembly2.cif.gz_A | crystal structure of n-terminal domain of positive transcription regulator evga from escherichia coli | 0.881 | 2 | 102 |
| 5m7n-assembly1.cif.gz_A | crystal structure of ntrx from brucella abortus in complex with atp processed with the crystaldirect automated mounting and cryo-cooling technology | 0.8809 | 1 | 129 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGM1_5_87_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.93 | 1 | 69 | 3.40.50.2300 |
| af_P0AFT5_1_126_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9104 | 3 | 116 | 3.40.50.2300 |
| af_P60611_1_129_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.901 | 3 | 123 | 3.40.50.2300 |
| af_P0AE39_136_205_2.40.50.40 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.8991 | 144 | 211 | 2.40.50.40 |
| af_P60611_135_244_2.40.50.1020 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain | 0.896 | 144 | 249 | 2.40.50.1020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1W9QX15-F1-model_v4 | Response regulatory domain-containing protein | 0.9857 | 3 | 111 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A520D1L7-F1-model_v4 | LytTR family transcriptional regulator | 0.9731 | 145 | 249 |
GO:0000156
GO:0003677 |
| AF-A0A561IVV6-F1-model_v4 | deleted | 0.9671 | 144 | 249 |
|
| AF-A0A7C5R727-F1-model_v4 | Response regulator transcription factor | 0.9619 | 2 | 84 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A090QBL6-F1-model_v4 | Two-component system response regulator | 0.9618 | 2 | 95 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |