F381111

General Info

Members Datasets Scaffolds Average Seq Length
276 160 550 249

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10023761|Ga0157370_100237612
Length 275
Sequence VFICVHPRLNGRAGVVKNPYLNNIHYSMMRAVLIDDEISNLENLQALLQKHCPQVTIIATAQNVSDGVNAIQKYLPDLVFLDIQMGDETGFEVLKQLPTRNFEVIFVTAYDQYGIQAVKFAALDYLLKPVDIEELKDAVIKADRKLATQTAAQLDFLLQQLKKPETNLSKIALQMQSEIRYVTLSEIVRCEADNTYTHFFLAGNEKILVSKSLKEYADLLRPNGFLRTHQSHLVNPRYVKSWLKEDGGVLLLSSGEKIPISKQNKETVKKALQQL

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
48 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
51 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
53 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
72 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
73 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
74 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
75 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
89 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
90 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
91 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
92 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
95 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
104 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
107 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
108 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
111 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
112 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
113 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
116 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
117 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
118 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
119 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
120 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
124 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
125 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
126 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
127 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
128 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
129 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
130 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
131 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
132 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
133 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
134 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
135 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
136 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
137 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
138 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
141 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
142 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
143 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
144 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
145 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
146 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
147 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
148 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
149 2738541278 Niastella sp. CF465 Isolate Unclassified
150 2738541283 Pedobacter sp. OK701 Isolate Unclassified
151 2739367651 Pedobacter sp. OK291 Isolate Unclassified
152 2739367663 Pedobacter sp. YR510 Isolate Unclassified
153 2818991437 Pedobacter terrae 518 Isolate Unclassified
154 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
155 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
156 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
157 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
158 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
159 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
160 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.39
Metatranscriptomes 0
Isolates 7.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.22
Nodule 0
Rhizoplane 0
Rhizosphere 70.29
Stem 0
Stem Tuber 0
Unclassified 10.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10023761 3300013104 Bacteria 6082
2 rootH2_10023887 3300003320 Bacteria 21951
3 rootH2_10078537 3300003320 Bacteria 5562
4 rootH2_10168598 3300003320 Bacteria 2847
5 rootL2_10051238 3300003322 Unclassified 4017
6 rootL2_10069665 3300003322 Bacteria 2429
7 rootL2_10341996 3300003322 Bacteria 1365
8 rootL2_10372363 3300003322 Unclassified 1623
9 rootH1_10012489 3300003323 Bacteria 43167
10 rootH1_10188757 3300003323 Bacteria 5745
11 rootH1_10391337 3300003323 Bacteria 2202
12 JGI25160J50197_1006635 3300003354 Unclassified 4659
13 Ga0055535_1004229 3300003761 Bacteria 3594
14 Ga0055542_1008377 3300003762 Bacteria 2029
15 Ga0055536_1000001 3300003781 Bacteria 630663
16 Ga0055536_1001266 3300003781 Bacteria 15565
17 Ga0055530_10001525 3300003791 Bacteria 16697
18 Ga0065165_1003121 3300005262 Bacteria 12285
19 Ga0065714_10003494 3300005288 Bacteria 8468
20 Ga0065714_10069347 3300005288 Bacteria 4212
21 Ga0065704_10127578 3300005289 Unclassified 1673
22 Ga0070666_10160661 3300005335 Bacteria 1570
23 Ga0068868_100119047 3300005338 Bacteria 2153
24 Ga0070674_100012556 3300005356 Bacteria 5206
25 Ga0070667_100254638 3300005367 Bacteria 1570
26 Ga0070667_100334682 3300005367 Bacteria 1368
27 Ga0070681_10090347 3300005458 Bacteria 3013
28 Ga0070679_100005624 3300005530 Bacteria 11610
29 Ga0068855_100006640 3300005563 Bacteria 14051
30 Ga0068855_100730085 3300005563 Unclassified 1058
31 Ga0068859_100105587 3300005617 Bacteria 2876
32 Ga0068860_100000024 3300005843 Bacteria 271902
33 Ga0068860_100013878 3300005843 Bacteria 7900
34 Ga0068860_100110142 3300005843 Bacteria 2632
35 Ga0068862_100600671 3300005844 Unclassified 1056
36 Ga0075366_10196925 3300006195 Bacteria 1225
37 Ga0075370_10272043 3300006353 Unclassified 1006
38 Ga0097620_100105584 3300006931 Bacteria 2876
39 Ga0105244_10006427 3300009036 Bacteria 7608
40 Ga0105240_10000670 3300009093 Bacteria 62864
41 Ga0105240_10001259 3300009093 Bacteria 43960
42 Ga0105240_10045517 3300009093 Bacteria 5565
43 Ga0105240_10073690 3300009093 Bacteria 4216
44 Ga0105240_10182498 3300009093 Unclassified 2475
45 Ga0105240_10683764 3300009093 Unclassified 1122
46 Ga0111539_10145088 3300009094 Unclassified 2779
47 Ga0114129_10002084 3300009147 Bacteria 27490
48 Ga0105241_10003192 3300009174 Bacteria 12201
49 Ga0105241_10016477 3300009174 Bacteria 5422
50 Ga0105241_10036253 3300009174 Bacteria 3710
51 Ga0105241_10280881 3300009174 Bacteria 1422
52 Ga0105241_10415089 3300009174 Bacteria 1183
53 Ga0105241_10423470 3300009174 Bacteria 1172
54 Ga0105237_10001472 3300009545 Bacteria 31032
55 Ga0105237_10002733 3300009545 Bacteria 21511
56 Ga0105237_10005678 3300009545 Bacteria 14036
57 Ga0105237_10009779 3300009545 Bacteria 10254
58 Ga0105237_10056675 3300009545 Viruses 3922
59 Ga0105237_10197841 3300009545 Bacteria 2009
60 Ga0105237_10620190 3300009545 Bacteria 1088
61 Ga0105238_10052154 3300009551 Bacteria 4113
62 Ga0105238_10084790 3300009551 Unclassified 3158
63 Ga0105249_10128447 3300009553 Bacteria 2417
64 Ga0105239_10000004 3300010375 Bacteria 532483
65 Ga0105239_10000754 3300010375 Bacteria 45868
66 Ga0105239_10000930 3300010375 Bacteria 41477
67 Ga0105239_10003809 3300010375 Bacteria 18339
68 Ga0105239_10014908 3300010375 Bacteria 8616
69 Ga0105239_10066811 3300010375 Bacteria 3950
70 Ga0105239_10066846 3300010375 Viruses 3949
71 Ga0105239_10074971 3300010375 Bacteria 3720
72 Ga0105239_10359099 3300010375 Bacteria 1645
73 Ga0157373_10042165 3300013100 Bacteria 3262
74 Ga0157371_10000296 3300013102 Bacteria 66267
75 Ga0157370_10007019 3300013104 Bacteria 12300
76 Ga0157370_10024373 3300013104 Bacteria 5992
77 Ga0157370_10033806 3300013104 Bacteria 4983
78 Ga0157370_10047113 3300013104 Bacteria 4133
79 Ga0157370_10110260 3300013104 Bacteria 2573
80 Ga0157370_10211487 3300013104 Bacteria 1797
81 Ga0157370_10211914 3300013104 Bacteria 1795
82 Ga0157370_10349294 3300013104 Bacteria 1363
83 Ga0157369_10000164 3300013105 Bacteria 94229
84 Ga0157374_10000003 3300013296 Bacteria 854471
85 Ga0157374_10032076 3300013296 Bacteria 4781
86 Ga0157378_10414954 3300013297 Bacteria 1329
87 Ga0163162_10000300 3300013306 Bacteria 45491
88 Ga0163162_10002109 3300013306 Bacteria 18677
89 Ga0157372_10018111 3300013307 Bacteria 7571
90 Ga0157372_10020836 3300013307 Bacteria 7080
91 Ga0157372_10062975 3300013307 Unclassified 4157
92 Ga0157375_10046520 3300013308 Bacteria 4231
93 Ga0163163_10081401 3300014325 Bacteria 3240
94 Ga0157380_10005041 3300014326 Bacteria 9210
95 Ga0182008_10000167 3300014497 Bacteria 51397
96 Ga0182008_10000267 3300014497 Bacteria 41024
97 Ga0157376_10003782 3300014969 Bacteria 10465
98 Ga0157376_10478302 3300014969 Bacteria 1220
99 Ga0182006_1000324 3300015261 Bacteria 41463
100 Ga0182006_1002827 3300015261 Bacteria 9254
101 Ga0182006_1004498 3300015261 Bacteria 6864
102 Ga0182007_10000005 3300015262 Bacteria 442702
103 Ga0182007_10020729 3300015262 Bacteria 2344
104 Ga0163161_10000135 3300017792 Bacteria 69859
105 Ga0163161_10000470 3300017792 Bacteria 33480
106 Ga0163161_10003275 3300017792 Bacteria 11382
107 Ga0163161_10003490 3300017792 Bacteria 11013
108 Ga0163161_10093822 3300017792 Bacteria 2224
109 Ga0209436_103495 3300025208 Unclassified 4159
110 Ga0209258_100691 3300025242 Bacteria 23257
111 Ga0209026_1005542 3300025250 Bacteria 3363
112 Ga0209148_1000357 3300025254 Bacteria 58732
113 Ga0209130_1003434 3300025284 Bacteria 6733
114 Ga0209676_1000008 3300025292 Bacteria 991778
115 Ga0209676_1001014 3300025292 Bacteria 32843
116 Ga0209050_1000343 3300025298 Bacteria 92045
117 Ga0209050_1031335 3300025298 Bacteria 1659
118 Ga0207426_1000345 3300025302 Bacteria 85840
119 Ga0207655_1019459 3300025728 Bacteria 3545
120 Ga0207654_10003046 3300025911 Bacteria 8493
121 Ga0207654_10011912 3300025911 Bacteria 4446
122 Ga0207654_10103724 3300025911 Bacteria 1756
123 Ga0207654_10130228 3300025911 Bacteria 1591
124 Ga0207654_10228294 3300025911 Bacteria 1238
125 Ga0207707_10167399 3300025912 Bacteria 1921
126 Ga0207695_10000183 3300025913 Bacteria 181350
127 Ga0207695_10002398 3300025913 Bacteria 27780
128 Ga0207695_10083392 3300025913 Bacteria 3229
129 Ga0207695_10269597 3300025913 Bacteria 1598
130 Ga0207695_10356863 3300025913 Bacteria 1348
131 Ga0207671_10003846 3300025914 Bacteria 14685
132 Ga0207671_10004136 3300025914 Bacteria 14032
133 Ga0207671_10005973 3300025914 Bacteria 11024
134 Ga0207671_10008146 3300025914 Bacteria 8942
135 Ga0207671_10028198 3300025914 Bacteria 4197
136 Ga0207671_10428800 3300025914 Bacteria 1052
137 Ga0207652_10000016 3300025921 Bacteria 188815
138 Ga0207694_10054129 3300025924 Unclassified 3113
139 Ga0207694_10066125 3300025924 Bacteria 2820
140 Ga0207689_10011780 3300025942 Bacteria 7493
141 Ga0207667_10008998 3300025949 Bacteria 11812
142 Ga0207658_10704990 3300025986 Bacteria 912
143 Ga0207648_10102134 3300026089 Bacteria 2513
144 Ga0268265_10812403 3300028380 Unclassified 912
145 Ga0268264_10000028 3300028381 Bacteria 426662
146 Ga0268264_10000143 3300028381 Bacteria 170031
147 Ga0268264_10009839 3300028381 Bacteria 7914
148 Ga0268264_10255195 3300028381 Bacteria 1631
149 Ga0307517_10036100 3300028786 Bacteria 5571
150 Ga0307515_10049568 3300028794 Bacteria 6312
151 Ga0307511_10000182 3300030521 Bacteria 62310
152 Ga0307511_10000211 3300030521 Bacteria 59246
153 Ga0265327_10000152 3300031251 Bacteria 149065
154 Ga0265327_10000456 3300031251 Bacteria 73362
155 Ga0265327_10023633 3300031251 Bacteria 3636
156 Ga0265327_10099049 3300031251 Bacteria 1409
157 Ga0265316_10366972 3300031344 Bacteria 1040
158 Ga0307513_10073196 3300031456 Bacteria 3568
159 Ga0307509_10038921 3300031507 Bacteria 5183
160 Ga0307509_10067868 3300031507 Bacteria 3734
161 Ga0307408_100002783 3300031548 Bacteria 12137
162 Ga0307408_100004578 3300031548 Bacteria 9365
163 Ga0307408_100014075 3300031548 Bacteria 5314
164 Ga0307408_100120637 3300031548 Bacteria 2030
165 Ga0307405_10000011 3300031731 Bacteria 241071
166 Ga0307413_10518192 3300031824 Bacteria 961
167 Ga0307407_10000001 3300031903 Bacteria 570048
168 Ga0307412_10011123 3300031911 Bacteria 5204
169 Ga0307409_100014755 3300031995 Bacteria 5097
170 Ga0307416_100000026 3300032002 Bacteria 172622
171 Ga0307414_10002196 3300032004 Bacteria 10181
172 Ga0307414_10616682 3300032004 Bacteria 975
173 Ga0307507_10002394 3300033179 Bacteria 39588
174 Ga0373927_0092734 3300035695 Bacteria 1962
175 Ga0400488_37193 3300038741 Unclassified 1967
176 Ga0439445_0023321 3300042004 Bacteria 1566
177 Ga0439449_0073297 3300042007 Bacteria 1262
178 Ga0439457_038372 3300042014 Bacteria 1066
179 Ga0439462_0049664 3300042015 Unclassified 1126
180 Ga0451577_0093257 3300042876 Bacteria 2689
181 Ga0451577_0250482 3300042876 Unclassified 1603
182 Ga0466969_0045012 3300044656 Bacteria 2192
183 Ga0453683_0007477 3300044673 Bacteria 7406
184 Ga0453683_0013389 3300044673 Bacteria 5358
185 Ga0453683_0016930 3300044673 Unclassified 4698
186 Ga0466961_0022239 3300044693 Bacteria 4079
187 Ga0453684_0042672 3300044712 Bacteria 6111
188 Ga0453684_0051778 3300044712 Bacteria 5376
189 Ga0453684_0466197 3300044712 Unclassified 1404
190 Ga0466971_0063844 3300044719 Bacteria 1667
191 Ga0466970_0061558 3300044765 Bacteria 2011
192 Ga0466957_0018776 3300044842 Unclassified 4063
193 Ga0466959_0000420 3300045049 Bacteria 24757
194 Ga0451576_0011730 3300045051 Bacteria 9927
195 Ga0451576_0230954 3300045051 Unclassified 1932
196 Ga0495606_0003772 3300046507 Bacteria 15754
197 Ga0495606_0006333 3300046507 Bacteria 10954
198 Ga0495606_0064449 3300046507 Bacteria 2332
199 Ga0495610_0000048 3300046512 Bacteria 150249
200 Ga0495610_0000367 3300046512 Bacteria 46922
201 Ga0495628_0412247 3300046516 Bacteria 986
202 Ga0495648_0013080 3300046524 Bacteria 6155
203 Ga0495609_0009776 3300046538 Bacteria 4626
204 Ga0495633_0000012 3300046558 Bacteria 267875
205 Ga0495633_0000593 3300046558 Bacteria 35033
206 Ga0495633_0017635 3300046558 Bacteria 3645
207 Ga0495668_0045869 3300046616 Bacteria 2429
208 Ga0495611_0000337 3300046648 Bacteria 30560
209 Ga0495625_0001450 3300046660 Bacteria 28784
210 Ga0495625_0133755 3300046660 Bacteria 1678
211 Ga0495625_0213386 3300046660 Unclassified 1268
212 Ga0495625_0441054 3300046660 Bacteria 806
213 Ga0495658_0045938 3300046683 Bacteria 2453
214 Ga0495687_000261 3300047443 Bacteria 71090
215 Ga0495686_0001801 3300047472 Bacteria 21688
216 Ga0495686_0163556 3300047472 Unclassified 1299
217 Ga0496116_0001232 3300048919 Bacteria 29803
218 Ga0496117_0001753 3300048920 Bacteria 29865
219 Ga0496117_0010394 3300048920 Bacteria 8491
220 Ga0496118_0026783 3300048921 Bacteria 4901
221 Ga0496118_0093275 3300048921 Bacteria 2063
222 Ga0496122_0006098 3300048925 Bacteria 14037
223 Ga0496122_0009244 3300048925 Bacteria 10426
224 Ga0496123_0004042 3300048926 Bacteria 15814
225 Ga0496124_0220599 3300048927 Bacteria 1426
226 Ga0501033_0341248 3300049570 Bacteria 1050
227 Ga0501034_0043262 3300049571 Bacteria 4559
228 Ga0501223_000463 3300049663 Bacteria 9791
229 Ga0501257_036398 3300049686 Unclassified 1199
230 nmdc:mga0k408_22109_c1 3300050493 Bacteria 3579
231 nmdc:mga0k408_278594_c1 3300050493 Bacteria 998
232 nmdc:mga07m45_91328_c2 3300050496 Bacteria 1174
233 Ga0500644_0064191 3300053088 Bacteria 1304
234 Ga0500583_0006586 3300053092 Unclassified 4011
235 Ga0500583_0071299 3300053092 Bacteria 1662
236 Ga0500650_0069286 3300053098 Unclassified 1649
237 Ga0500556_0025929 3300053104 Bacteria 1942
238 Ga0500562_000117 3300053108 Bacteria 26644
239 Ga0500594_0008353 3300053118 Bacteria 2359
240 Ga0500618_000016 3300053125 Bacteria 164049
241 Ga0500642_0004302 3300053130 Unclassified 4439
242 Ga0500652_004119 3300053131 Bacteria 4464
243 Ga0500559_0128143 3300053136 Bacteria 1184
244 Ga0500577_0107927 3300053142 Unclassified 1146
245 Ga0500604_0001998 3300053151 Bacteria 5650
246 Ga0500616_0133533 3300053153 Bacteria 1170
247 Ga0500622_0000176 3300053156 Bacteria 69125
248 Ga0500622_0004840 3300053156 Bacteria 8263
249 Ga0500636_0113742 3300053177 Bacteria 1526
250 Ga0500637_0085231 3300053178 Bacteria 1827
251 Ga0500611_000001 3300053727 Bacteria 385744
252 Ga0500645_016536 3300053730 Bacteria 2322
253 Ga0500661_002422 3300055283 Bacteria 3515
254 Ga0466962_0011049 3300061719 Bacteria 4347
255 2586208858 2585427687 Bacteria 5544917
256 2586209912 2585427687 Bacteria 5544917
257 2722730268 2721755487 Bacteria 6357185
258 2738727927 2738541278 Bacteria 9755573
259 2738731150 2738541278 Bacteria 9755573
260 2738754729 2738541283 Bacteria 7222293
261 2738758672 2738541283 Bacteria 7222293
262 2739586875 2739367651 Bacteria 6359826
263 2739587289 2739367651 Bacteria 6359826
264 2739590488 2739367651 Bacteria 6359826
265 2739646170 2739367663 Bacteria 5040914
266 2819547329 2818991437 Bacteria 5805520
267 2842727460 2842722452 Bacteria 6263924
268 2842913857 2842909656 Bacteria 6185908
269 2849283451 2849281842 Bacteria 6065644
270 2896318462 2896317667 Bacteria 4606601
271 2904447800 2904445276 Bacteria 5310396
272 2919189804 2919186247 Bacteria 6244071
273 2919191180 2919186247 Bacteria 6244071
274 2939668082 2939664404 Bacteria 6364494
275 2939669459 2939664404 Bacteria 6364494
276 Ga0157370_10023761
277 rootH2_10023887
278 rootH2_10078537
279 rootH2_10168598
280 rootL2_10051238
281 rootL2_10069665
282 rootL2_10341996
283 rootL2_10372363
284 rootH1_10012489
285 rootH1_10188757
286 rootH1_10391337
287 JGI25160J50197_1006635
288 Ga0055535_1004229
289 Ga0055542_1008377
290 Ga0055536_1000001
291 Ga0055536_1001266
292 Ga0055530_10001525
293 Ga0065165_1003121
294 Ga0065714_10003494
295 Ga0065714_10069347
296 Ga0065704_10127578
297 Ga0070666_10160661
298 Ga0068868_100119047
299 Ga0070674_100012556
300 Ga0070667_100254638
301 Ga0070667_100334682
302 Ga0070681_10090347
303 Ga0070679_100005624
304 Ga0068855_100006640
305 Ga0068855_100730085
306 Ga0068859_100105587
307 Ga0068860_100000024
308 Ga0068860_100013878
309 Ga0068860_100110142
310 Ga0068862_100600671
311 Ga0075366_10196925
312 Ga0075370_10272043
313 Ga0097620_100105584
314 Ga0105244_10006427
315 Ga0105240_10000670
316 Ga0105240_10001259
317 Ga0105240_10045517
318 Ga0105240_10073690
319 Ga0105240_10182498
320 Ga0105240_10683764
321 Ga0111539_10145088
322 Ga0114129_10002084
323 Ga0105241_10003192
324 Ga0105241_10016477
325 Ga0105241_10036253
326 Ga0105241_10280881
327 Ga0105241_10415089
328 Ga0105241_10423470
329 Ga0105237_10001472
330 Ga0105237_10002733
331 Ga0105237_10005678
332 Ga0105237_10009779
333 Ga0105237_10056675
334 Ga0105237_10197841
335 Ga0105237_10620190
336 Ga0105238_10052154
337 Ga0105238_10084790
338 Ga0105249_10128447
339 Ga0105239_10000004
340 Ga0105239_10000754
341 Ga0105239_10000930
342 Ga0105239_10003809
343 Ga0105239_10014908
344 Ga0105239_10066811
345 Ga0105239_10066846
346 Ga0105239_10074971
347 Ga0105239_10359099
348 Ga0157373_10042165
349 Ga0157371_10000296
350 Ga0157370_10007019
351 Ga0157370_10024373
352 Ga0157370_10033806
353 Ga0157370_10047113
354 Ga0157370_10110260
355 Ga0157370_10211487
356 Ga0157370_10211914
357 Ga0157370_10349294
358 Ga0157369_10000164
359 Ga0157374_10000003
360 Ga0157374_10032076
361 Ga0157378_10414954
362 Ga0163162_10000300
363 Ga0163162_10002109
364 Ga0157372_10018111
365 Ga0157372_10020836
366 Ga0157372_10062975
367 Ga0157375_10046520
368 Ga0163163_10081401
369 Ga0157380_10005041
370 Ga0182008_10000167
371 Ga0182008_10000267
372 Ga0157376_10003782
373 Ga0157376_10478302
374 Ga0182006_1000324
375 Ga0182006_1002827
376 Ga0182006_1004498
377 Ga0182007_10000005
378 Ga0182007_10020729
379 Ga0163161_10000135
380 Ga0163161_10000470
381 Ga0163161_10003275
382 Ga0163161_10003490
383 Ga0163161_10093822
384 Ga0209436_103495
385 Ga0209258_100691
386 Ga0209026_1005542
387 Ga0209148_1000357
388 Ga0209130_1003434
389 Ga0209676_1000008
390 Ga0209676_1001014
391 Ga0209050_1000343
392 Ga0209050_1031335
393 Ga0207426_1000345
394 Ga0207655_1019459
395 Ga0207654_10003046
396 Ga0207654_10011912
397 Ga0207654_10103724
398 Ga0207654_10130228
399 Ga0207654_10228294
400 Ga0207707_10167399
401 Ga0207695_10000183
402 Ga0207695_10002398
403 Ga0207695_10083392
404 Ga0207695_10269597
405 Ga0207695_10356863
406 Ga0207671_10003846
407 Ga0207671_10004136
408 Ga0207671_10005973
409 Ga0207671_10008146
410 Ga0207671_10028198
411 Ga0207671_10428800
412 Ga0207652_10000016
413 Ga0207694_10054129
414 Ga0207694_10066125
415 Ga0207689_10011780
416 Ga0207667_10008998
417 Ga0207658_10704990
418 Ga0207648_10102134
419 Ga0268265_10812403
420 Ga0268264_10000028
421 Ga0268264_10000143
422 Ga0268264_10009839
423 Ga0268264_10255195
424 Ga0307517_10036100
425 Ga0307515_10049568
426 Ga0307511_10000182
427 Ga0307511_10000211
428 Ga0265327_10000152
429 Ga0265327_10000456
430 Ga0265327_10023633
431 Ga0265327_10099049
432 Ga0265316_10366972
433 Ga0307513_10073196
434 Ga0307509_10038921
435 Ga0307509_10067868
436 Ga0307408_100002783
437 Ga0307408_100004578
438 Ga0307408_100014075
439 Ga0307408_100120637
440 Ga0307405_10000011
441 Ga0307413_10518192
442 Ga0307407_10000001
443 Ga0307412_10011123
444 Ga0307409_100014755
445 Ga0307416_100000026
446 Ga0307414_10002196
447 Ga0307414_10616682
448 Ga0307507_10002394
449 Ga0373927_0092734
450 Ga0400488_37193
451 Ga0439445_0023321
452 Ga0439449_0073297
453 Ga0439457_038372
454 Ga0439462_0049664
455 Ga0451577_0093257
456 Ga0451577_0250482
457 Ga0466969_0045012
458 Ga0453683_0007477
459 Ga0453683_0013389
460 Ga0453683_0016930
461 Ga0466961_0022239
462 Ga0453684_0042672
463 Ga0453684_0051778
464 Ga0453684_0466197
465 Ga0466971_0063844
466 Ga0466970_0061558
467 Ga0466957_0018776
468 Ga0466959_0000420
469 Ga0451576_0011730
470 Ga0451576_0230954
471 Ga0495606_0003772
472 Ga0495606_0006333
473 Ga0495606_0064449
474 Ga0495610_0000048
475 Ga0495610_0000367
476 Ga0495628_0412247
477 Ga0495648_0013080
478 Ga0495609_0009776
479 Ga0495633_0000012
480 Ga0495633_0000593
481 Ga0495633_0017635
482 Ga0495668_0045869
483 Ga0495611_0000337
484 Ga0495625_0001450
485 Ga0495625_0133755
486 Ga0495625_0213386
487 Ga0495625_0441054
488 Ga0495658_0045938
489 Ga0495687_000261
490 Ga0495686_0001801
491 Ga0495686_0163556
492 Ga0496116_0001232
493 Ga0496117_0001753
494 Ga0496117_0010394
495 Ga0496118_0026783
496 Ga0496118_0093275
497 Ga0496122_0006098
498 Ga0496122_0009244
499 Ga0496123_0004042
500 Ga0496124_0220599
501 Ga0501033_0341248
502 Ga0501034_0043262
503 Ga0501223_000463
504 Ga0501257_036398
505 nmdc:mga0k408_22109_c1
506 nmdc:mga0k408_278594_c1
507 nmdc:mga07m45_91328_c2
508 Ga0500644_0064191
509 Ga0500583_0006586
510 Ga0500583_0071299
511 Ga0500650_0069286
512 Ga0500556_0025929
513 Ga0500562_000117
514 Ga0500594_0008353
515 Ga0500618_000016
516 Ga0500642_0004302
517 Ga0500652_004119
518 Ga0500559_0128143
519 Ga0500577_0107927
520 Ga0500604_0001998
521 Ga0500616_0133533
522 Ga0500622_0000176
523 Ga0500622_0004840
524 Ga0500636_0113742
525 Ga0500637_0085231
526 Ga0500611_000001
527 Ga0500645_016536
528 Ga0500661_002422
529 Ga0466962_0011049
530 2586208858
531 2586209912
532 2722730268
533 2738727927
534 2738731150
535 2738754729
536 2738758672
537 2739586875
538 2739587289
539 2739590488
540 2739646170
541 2819547329
542 2842727460
543 2842913857
544 2849283451
545 2896318462
546 2904447800
547 2919189804
548 2919191180
549 2939668082
550 2939669459

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

31

140

0.94

PF04397

LytTR

LytTr DNA-binding domain

177

273

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6swl-assembly2.cif.gz_B the rec domain of xync, a response regulator from geobacillus stearothermophilus 0.8866 2 124
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.8861 2 117
2qv0-assembly1.cif.gz_A crystal structure of the response regulatory domain of protein mrke from klebsiella pneumoniae 0.8849 3 122
3f6c-assembly2.cif.gz_A crystal structure of n-terminal domain of positive transcription regulator evga from escherichia coli 0.881 2 102
5m7n-assembly1.cif.gz_A crystal structure of ntrx from brucella abortus in complex with atp processed with the crystaldirect automated mounting and cryo-cooling technology 0.8809 1 129
ID Description Score Start End Superfamily
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.93 1 69 3.40.50.2300
af_P0AFT5_1_126_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9104 3 116 3.40.50.2300
af_P60611_1_129_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.901 3 123 3.40.50.2300
af_P0AE39_136_205_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8991 144 211 2.40.50.40
af_P60611_135_244_2.40.50.1020 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain 0.896 144 249 2.40.50.1020
ID Description Score Start End GO Terms
AF-A0A1W9QX15-F1-model_v4 Response regulatory domain-containing protein 0.9857 3 111 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A520D1L7-F1-model_v4 LytTR family transcriptional regulator 0.9731 145 249 GO:0000156
GO:0003677
AF-A0A561IVV6-F1-model_v4 deleted 0.9671 144 249
AF-A0A7C5R727-F1-model_v4 Response regulator transcription factor 0.9619 2 84 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A090QBL6-F1-model_v4 Two-component system response regulator 0.9618 2 95 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map