F382013

General Info

Members Datasets Scaffolds Average Seq Length
277 250 554 313

Family's Representative Sequence

Representative Sequence 3300048919|Ga0496116_0087496|Ga0496116_0087496_831_1820
Length 329
Sequence MEGCSLFHHITVLKAEATEGLRIKPDGIYVDCTLGGGGHSSVILSKLSPKGRLIAFDQDDWALNNAKQLLASYTEQLYLIKSNFENLEEKLSELDWVPKRNGIPQVDGILFDLGVSSPQFDEGERGFSYNADAVLDMRMDQGAELTAKHIINEWSESEIARILFQYGEEKFSRRIAKVIVKRREESPINTTGELVELIKEGIPAAARRTGGHPAKRSFQALRIAVNDELGVLEKALHASVRCLAPEGRVSVITFHSLEDRICKQIFASYVEKCTCPPDFPLCVCGASGELKLINRKPLIPSDEEIALNPRARSAKLRVAEKLHLVAEDS

Samples

Sample ID Description Type Environment
1 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
133 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
134 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
135 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
136 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
137 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
140 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
141 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
150 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
154 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
155 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
156 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
157 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
188 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
193 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
194 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
195 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
196 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
197 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
198 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
199 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
200 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
201 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
202 2600255229 Lactobacillus acidophilus A 16 Isolate Rhizosphere
203 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
204 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
205 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
206 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
207 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
208 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
209 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
210 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
211 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
212 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
213 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
214 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
215 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
216 2881633906 Lactiplantibacillus garii FI11369 Isolate Unclassified
217 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
218 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
219 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
220 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
221 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
222 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
223 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
224 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
225 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
226 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
227 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
228 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
229 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
230 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
231 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
232 2939615513 Lactococcus lactis 1925 Isolate Rhizosphere
233 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
234 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
235 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
236 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
237 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
238 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
239 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
240 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
241 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
242 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
243 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
244 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
245 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
246 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
247 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
248 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
249 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
250 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 79.06
Metatranscriptomes 0
Isolates 20.94

Biome Distribution

Category Percentage (%)
Aerial Root 0.72
Bulb 0
Endosphere 3.25
Nodule 0
Rhizoplane 0.72
Rhizosphere 80.14
Stem 0
Stem Tuber 0
Unclassified 3.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496116_0087496 3300048919 Bacteria 1906
2 JGI25151J46595_10013555 3300003187 Bacteria 3664
3 Ga0055541_1000095 3300003841 Bacteria 74451
4 Ga0065715_10018434 3300005293 Bacteria 2408
5 Ga0065707_10000785 3300005295 Bacteria 19949
6 Ga0070676_10001513 3300005328 Bacteria 11761
7 Ga0070683_100041507 3300005329 Bacteria 4233
8 Ga0070690_100004237 3300005330 Bacteria 7939
9 Ga0070670_100179071 3300005331 Bacteria 1840
10 Ga0068869_100002363 3300005334 Bacteria 11363
11 Ga0070666_10011423 3300005335 Bacteria 5572
12 Ga0070680_100007748 3300005336 Bacteria 8186
13 Ga0068868_100059951 3300005338 Bacteria 3011
14 Ga0070660_100003884 3300005339 Bacteria 10327
15 Ga0070691_10002235 3300005341 Bacteria 8560
16 Ga0070687_100004130 3300005343 Bacteria 5741
17 Ga0070661_100001616 3300005344 Bacteria 15591
18 Ga0070661_100100072 3300005344 Bacteria 2155
19 Ga0070692_10004193 3300005345 Bacteria 5978
20 Ga0070668_100021045 3300005347 Bacteria 4929
21 Ga0070669_100001304 3300005353 Bacteria 17993
22 Ga0070675_100016304 3300005354 Bacteria 5894
23 Ga0070674_100000416 3300005356 Bacteria 21452
24 Ga0070673_100035520 3300005364 Bacteria 3780
25 Ga0070688_100104495 3300005365 Bacteria 1873
26 Ga0070659_100033765 3300005366 Bacteria 3976
27 Ga0070667_100007693 3300005367 Bacteria 8934
28 Ga0070711_100060879 3300005439 Bacteria 2626
29 Ga0070694_100002612 3300005444 Bacteria 10649
30 Ga0070663_100125535 3300005455 Bacteria 1944
31 Ga0070681_10018585 3300005458 Bacteria 6950
32 Ga0068867_100001801 3300005459 Bacteria 14908
33 Ga0070685_10205368 3300005466 Bacteria 1283
34 Ga0070707_100068049 3300005468 Bacteria 3426
35 Ga0070698_100309445 3300005471 Bacteria 1510
36 Ga0070679_100049895 3300005530 Bacteria 4168
37 Ga0070684_100280685 3300005535 Bacteria 1526
38 Ga0070672_100001793 3300005543 Bacteria 13435
39 Ga0070672_100081992 3300005543 Bacteria 2587
40 Ga0070686_100038596 3300005544 Bacteria 2969
41 Ga0070695_100006717 3300005545 Bacteria 6807
42 Ga0070665_100190658 3300005548 Bacteria 2051
43 Ga0070664_100001149 3300005564 Bacteria 20973
44 Ga0070664_100003306 3300005564 Bacteria 13026
45 Ga0068854_100041819 3300005578 Bacteria 3240
46 Ga0070702_100001235 3300005615 Bacteria 10353
47 Ga0068852_100199185 3300005616 Bacteria 1894
48 Ga0068864_100040282 3300005618 Bacteria 3997
49 Ga0068861_100425887 3300005719 Bacteria 1184
50 Ga0068870_10003287 3300005840 Bacteria 6829
51 Ga0068860_100217058 3300005843 Bacteria 1856
52 Ga0068862_100027245 3300005844 Bacteria 4809
53 Ga0081455_10003131 3300005937 Bacteria 19255
54 Ga0097621_100045489 3300006237 Bacteria 3546
55 Ga0068871_100004792 3300006358 Bacteria 9458
56 Ga0075431_100010928 3300006847 Bacteria 9133
57 Ga0075433_10019570 3300006852 Bacteria 5643
58 Ga0075429_100031010 3300006880 Bacteria 4646
59 Ga0068865_100000516 3300006881 Bacteria 21585
60 Ga0075436_100064434 3300006914 Bacteria 2533
61 Ga0105244_10007587 3300009036 Bacteria 6877
62 Ga0105240_10035294 3300009093 Bacteria 6445
63 Ga0111539_10232021 3300009094 Bacteria 2149
64 Ga0105245_10003582 3300009098 Bacteria 13863
65 Ga0114129_10106210 3300009147 Bacteria 3879
66 Ga0105243_10003345 3300009148 Bacteria 13008
67 Ga0105241_10265606 3300009174 Bacteria 1460
68 Ga0105242_10002043 3300009176 Bacteria 15905
69 Ga0105237_10344402 3300009545 Bacteria 1495
70 Ga0105238_10100504 3300009551 Bacteria 2875
71 Ga0105249_10011977 3300009553 Bacteria 7628
72 Ga0105239_10028695 3300010375 Bacteria 6119
73 Ga0105239_10065931 3300010375 Unclassified 3978
74 Ga0105246_10003699 3300011119 Bacteria 9255
75 Ga0157371_10001288 3300013102 Bacteria 26430
76 Ga0157371_10086692 3300013102 Bacteria 2217
77 Ga0157371_10321131 3300013102 Bacteria 1124
78 Ga0157374_10014693 3300013296 Bacteria 6855
79 Ga0157374_10109972 3300013296 Bacteria 2650
80 Ga0157378_10002668 3300013297 Bacteria 15883
81 Ga0157378_10225284 3300013297 Bacteria 1784
82 Ga0163162_10070751 3300013306 Bacteria 3540
83 Ga0157372_10746891 3300013307 Bacteria 1138
84 Ga0157376_10001946 3300014969 Bacteria 13802
85 Ga0209784_100135 3300025224 Bacteria 70506
86 Ga0209566_100058 3300025225 Bacteria 201317
87 Ga0209437_100743 3300025233 Bacteria 16153
88 Ga0209676_1039008 3300025292 Bacteria 1354
89 Ga0209025_1034081 3300025294 Bacteria 2335
90 Ga0207680_10179966 3300025903 Bacteria 1429
91 Ga0207645_10000808 3300025907 Bacteria 26186
92 Ga0207707_10023762 3300025912 Bacteria 5360
93 Ga0207662_10032577 3300025918 Bacteria 3035
94 Ga0207657_10002541 3300025919 Bacteria 19730
95 Ga0207649_10005602 3300025920 Bacteria 6791
96 Ga0207652_10015003 3300025921 Bacteria 6285
97 Ga0207646_10067501 3300025922 Bacteria 3193
98 Ga0207659_10016002 3300025926 Bacteria 4874
99 Ga0207687_10004974 3300025927 Bacteria 8812
100 Ga0207690_10218410 3300025932 Bacteria 1457
101 Ga0207706_10001096 3300025933 Bacteria 27537
102 Ga0207686_10004095 3300025934 Bacteria 7821
103 Ga0207670_10005545 3300025936 Bacteria 6936
104 Ga0207704_10002944 3300025938 Bacteria 7689
105 Ga0207691_10001064 3300025940 Bacteria 27290
106 Ga0207691_10066912 3300025940 Bacteria 3250
107 Ga0207689_10001346 3300025942 Bacteria 23649
108 Ga0207679_10006533 3300025945 Bacteria 7370
109 Ga0207679_10051860 3300025945 Bacteria 3006
110 Ga0207651_10010707 3300025960 Bacteria 5095
111 Ga0207651_10025504 3300025960 Bacteria 3675
112 Ga0207668_10013072 3300025972 Bacteria 5101
113 Ga0207640_10213395 3300025981 Bacteria 1472
114 Ga0207658_10312190 3300025986 Bacteria 1358
115 Ga0207677_10033893 3300026023 Bacteria 3300
116 Ga0207678_10201896 3300026067 Bacteria 1700
117 Ga0207708_10000051 3300026075 Bacteria 108519
118 Ga0207648_10000101 3300026089 Bacteria 82654
119 Ga0207676_10342818 3300026095 Bacteria 1379
120 Ga0207675_100342771 3300026118 Bacteria 1463
121 Ga0207683_10000229 3300026121 Bacteria 49529
122 Ga0207698_10207895 3300026142 Bacteria 1758
123 Ga0209973_1004369 3300027252 Bacteria 1449
124 Ga0209969_1000130 3300027360 Bacteria 9692
125 Ga0209967_1000043 3300027364 Bacteria 16255
126 Ga0209981_1000074 3300027378 Bacteria 10839
127 Ga0209996_1000042 3300027395 Bacteria 18590
128 Ga0209984_1000052 3300027424 Bacteria 12095
129 Ga0210000_1000039 3300027462 Bacteria 19582
130 Ga0209995_1000154 3300027471 Bacteria 11047
131 Ga0209968_1000027 3300027526 Bacteria 28287
132 Ga0209999_1000034 3300027543 Bacteria 14819
133 Ga0210002_1000137 3300027617 Bacteria 11250
134 Ga0209983_1000188 3300027665 Bacteria 12020
135 Ga0209971_1000154 3300027682 Bacteria 20300
136 Ga0209966_1000016 3300027695 Bacteria 73256
137 Ga0209998_10000021 3300027717 Bacteria 70520
138 Ga0209974_10000003 3300027876 Bacteria 65938
139 Ga0207428_10003604 3300027907 Bacteria 14954
140 Ga0268266_10147207 3300028379 Bacteria 2119
141 Ga0268265_10016490 3300028380 Bacteria 5077
142 Ga0268264_10120310 3300028381 Bacteria 2313
143 Ga0316579_10094884 3300031691 Bacteria 1426
144 Ga0316579_10108331 3300031691 Bacteria 1333
145 Ga0316576_10005299 3300031727 Bacteria 7854
146 Ga0316576_10030940 3300031727 Bacteria 3794
147 Ga0316578_10023830 3300031728 Bacteria 3429
148 Ga0316574_0023317 3300035398 Bacteria 3695
149 Ga0316582_0085138 3300036647 Bacteria 2071
150 Ga0316584_0041884 3300036712 Bacteria 3414
151 Ga0316584_0050445 3300036712 Bacteria 3111
152 Ga0395901_0582965 3300038443 Bacteria 1130
153 Ga0439449_0005984 3300042007 Bacteria 4647
154 Ga0439462_0003455 3300042015 Bacteria 3791
155 Ga0450901_003388 3300042533 Bacteria 1667
156 Ga0451577_0000075 3300042876 Bacteria 229905
157 Ga0453683_0115579 3300044673 Bacteria 1688
158 Ga0466961_0024696 3300044693 Bacteria 3866
159 Ga0453684_0000033 3300044712 Bacteria 734012
160 Ga0466968_0004472 3300044735 Bacteria 5228
161 Ga0466959_0076252 3300045049 Bacteria 2421
162 Ga0451576_0003322 3300045051 Bacteria 22294
163 Ga0495659_0066390 3300046664 Unclassified 1344
164 Ga0495660_0023950 3300046810 Bacteria 3479
165 Ga0496106_0204276 3300048909 Bacteria 1573
166 Ga0496116_0054687 3300048919 Bacteria 2627
167 Ga0496116_0096617 3300048919 Bacteria 1779
168 Ga0496116_0099140 3300048919 Bacteria 1746
169 Ga0496117_0000040 3300048920 Bacteria 318616
170 Ga0496117_0018212 3300048920 Bacteria 5832
171 Ga0496117_0044193 3300048920 Bacteria 3229
172 Ga0496117_0198470 3300048920 Bacteria 1136
173 Ga0496119_0002002 3300048922 Bacteria 23093
174 Ga0496119_0065749 3300048922 Bacteria 2146
175 Ga0496119_0080046 3300048922 Bacteria 1885
176 Ga0496120_0000215 3300048923 Bacteria 99455
177 Ga0496120_0020927 3300048923 Bacteria 4143
178 Ga0496121_0223067 3300048924 Bacteria 1326
179 Ga0496122_0001699 3300048925 Bacteria 34129
180 Ga0496122_0003724 3300048925 Bacteria 19679
181 Ga0496122_0018522 3300048925 Bacteria 6427
182 Ga0496122_0058499 3300048925 Bacteria 2853
183 Ga0496123_0013934 3300048926 Bacteria 6699
184 Ga0496124_0001252 3300048927 Bacteria 38851
185 Ga0496125_0004166 3300048928 Bacteria 16856
186 Ga0496126_0002983 3300048929 Bacteria 21977
187 Ga0496126_0239742 3300048929 Bacteria 1515
188 Ga0501031_0089676 3300049568 Bacteria 2005
189 Ga0501033_0002037 3300049570 Bacteria 17571
190 Ga0501036_0181930 3300049572 Bacteria 1769
191 Ga0501039_0108052 3300049575 Unclassified 2174
192 Ga0501042_0052878 3300049578 Unclassified 2897
193 Ga0501048_0048429 3300049582 Bacteria 3031
194 Ga0501067_0267123 3300049583 Bacteria 952
195 Ga0501068_0032252 3300049584 Bacteria 3115
196 Ga0501069_0145201 3300049585 Bacteria 1362
197 Ga0501072_0013356 3300049588 Bacteria 6286
198 Ga0501073_0066830 3300049589 Unclassified 2506
199 Ga0501074_0055452 3300049590 Bacteria 2856
200 Ga0501075_0009877 3300049591 Bacteria 6687
201 Ga0501076_0047551 3300049592 Unclassified 3392
202 Ga0501077_0087729 3300049593 Unclassified 1971
203 Ga0501080_0038419 3300049742 Bacteria 4469
204 Ga0501035_0228532 3300049822 Bacteria 1586
205 Ga0501045_0114799 3300049824 Unclassified 1997
206 nmdc:mga05p37_67360_c1 3300050507 Bacteria 4405
207 nmdc:mga09592_16010_c1 3300050508 Bacteria 6129
208 nmdc:mga0qj67_8497_c1 3300050509 Bacteria 7621
209 nmdc:mga06r32_10889_c1 3300050510 Bacteria 8190
210 nmdc:mga08y16_22535_c1 3300050511 Bacteria 6650
211 nmdc:mga0n895_99282_c1 3300050512 Bacteria 2920
212 nmdc:mga0rr50_50620_c1 3300050513 Bacteria 3079
213 nmdc:mga0a205_76504_c1 3300050515 Bacteria 3235
214 Ga0500555_032839 3300053103 Bacteria 1465
215 Ga0500637_0006213 3300053178 Bacteria 5863
216 Ga0501084_0266100 3300054114 Bacteria 1447
217 Ga0590075_030711 3300059424 Bacteria 1360
218 Ga0501082_0133343 3300060353 Unclassified 2155
219 Ga0530510_0053334 3300061734 Unclassified 2922
220 2512734965 2512564039 Bacteria 8739048
221 2524186579 2524023129 Bacteria 6762600
222 2550906257 2548877040 Bacteria 7507281
223 2556063250 2554235469 Bacteria 3590176
224 2563926975 2563366752 Bacteria 4961801
225 2571532824 2571042143 Bacteria 6986194
226 2573039734 2571042588 Bacteria 5045676
227 2578338013 2576861424 Bacteria 5270569
228 2580935429 2579778775 Bacteria 5360914
229 2601445436 2600255229 Bacteria 1988965
230 2601639119 2600255286 Bacteria 5390125
231 2621276389 2619619294 Bacteria 5575484
232 2643738011 2643221543 Bacteria 6628015
233 2644423101 2643221676 Bacteria 8119172
234 2712199506 2711768088 Bacteria 3195027
235 2728534230 2728368933 Bacteria 7044283
236 2730135631 2728369359 Bacteria 5621728
237 2753810967 2751185905 Bacteria 6142767
238 2791212205 2788500588 Bacteria 4584915
239 2802437301 2802428803 Bacteria 5806948
240 2821114693 2821111986 Bacteria 6894338
241 2864735367 2864733723 Bacteria 6770668
242 2865003459 2865002811 Bacteria 6333767
243 2881635661 2881633906 Bacteria 2972201
244 2881640938 2881636855 Bacteria 5205297
245 2885527949 2885526491 Bacteria 7164189
246 2888580935 2888578766 Bacteria 6743310
247 2889046851 2889042446 Bacteria 7618936
248 2889050383 2889049205 Bacteria 7524325
249 2889280900 2889276214 Bacteria 5979355
250 2904163175 2904162308 Bacteria 7086713
251 2904493757 2904490793 Bacteria 7046938
252 2904598321 2904595352 Bacteria 6124848
253 2904608289 2904606771 Bacteria 4684500
254 2907205789 2907202186 Bacteria 6632024
255 2919162837 2919160200 Bacteria 6929020
256 2925326888 2925326138 Bacteria 9652120
257 2931390299 2931384279 Bacteria 7299545
258 2938650204 2938649242 Bacteria 7118381
259 2939616723 2939615513 Bacteria 2384962
260 2939679682 2939679117 Bacteria 6921672
261 2939704646 2939702853 Bacteria 5139229
262 2945997476 2945991243 Bacteria 7008369
263 2946053688 2946053406 Bacteria 6978655
264 2968564063 2968558590 Bacteria 6956864
265 2971407258 2971403814 Bacteria 7370929
266 2971512613 2971511577 Bacteria 5404012
267 2980125812 2980125574 Bacteria 5567337
268 2980177676 2980176882 Bacteria 5397533
269 2984530349 2984527788 Bacteria 5288478
270 2984536457 2984532647 Bacteria 5288506
271 2988228609 2988225383 Bacteria 7221625
272 2996635991 2996632988 Bacteria 6921523
273 2996709708 2996706504 Bacteria 5757485
274 648171055 648028048 Bacteria 5394884
275 8054470218 8054465665 Bacteria 7323556
276 8057737611 8057733483 Bacteria 6578323
277 8057979117 8057977335 Bacteria 5694872
278 Ga0496116_0087496
279 JGI25151J46595_10013555
280 Ga0055541_1000095
281 Ga0065715_10018434
282 Ga0065707_10000785
283 Ga0070676_10001513
284 Ga0070683_100041507
285 Ga0070690_100004237
286 Ga0070670_100179071
287 Ga0068869_100002363
288 Ga0070666_10011423
289 Ga0070680_100007748
290 Ga0068868_100059951
291 Ga0070660_100003884
292 Ga0070691_10002235
293 Ga0070687_100004130
294 Ga0070661_100001616
295 Ga0070661_100100072
296 Ga0070692_10004193
297 Ga0070668_100021045
298 Ga0070669_100001304
299 Ga0070675_100016304
300 Ga0070674_100000416
301 Ga0070673_100035520
302 Ga0070688_100104495
303 Ga0070659_100033765
304 Ga0070667_100007693
305 Ga0070711_100060879
306 Ga0070694_100002612
307 Ga0070663_100125535
308 Ga0070681_10018585
309 Ga0068867_100001801
310 Ga0070685_10205368
311 Ga0070707_100068049
312 Ga0070698_100309445
313 Ga0070679_100049895
314 Ga0070684_100280685
315 Ga0070672_100001793
316 Ga0070672_100081992
317 Ga0070686_100038596
318 Ga0070695_100006717
319 Ga0070665_100190658
320 Ga0070664_100001149
321 Ga0070664_100003306
322 Ga0068854_100041819
323 Ga0070702_100001235
324 Ga0068852_100199185
325 Ga0068864_100040282
326 Ga0068861_100425887
327 Ga0068870_10003287
328 Ga0068860_100217058
329 Ga0068862_100027245
330 Ga0081455_10003131
331 Ga0097621_100045489
332 Ga0068871_100004792
333 Ga0075431_100010928
334 Ga0075433_10019570
335 Ga0075429_100031010
336 Ga0068865_100000516
337 Ga0075436_100064434
338 Ga0105244_10007587
339 Ga0105240_10035294
340 Ga0111539_10232021
341 Ga0105245_10003582
342 Ga0114129_10106210
343 Ga0105243_10003345
344 Ga0105241_10265606
345 Ga0105242_10002043
346 Ga0105237_10344402
347 Ga0105238_10100504
348 Ga0105249_10011977
349 Ga0105239_10028695
350 Ga0105239_10065931
351 Ga0105246_10003699
352 Ga0157371_10001288
353 Ga0157371_10086692
354 Ga0157371_10321131
355 Ga0157374_10014693
356 Ga0157374_10109972
357 Ga0157378_10002668
358 Ga0157378_10225284
359 Ga0163162_10070751
360 Ga0157372_10746891
361 Ga0157376_10001946
362 Ga0209784_100135
363 Ga0209566_100058
364 Ga0209437_100743
365 Ga0209676_1039008
366 Ga0209025_1034081
367 Ga0207680_10179966
368 Ga0207645_10000808
369 Ga0207707_10023762
370 Ga0207662_10032577
371 Ga0207657_10002541
372 Ga0207649_10005602
373 Ga0207652_10015003
374 Ga0207646_10067501
375 Ga0207659_10016002
376 Ga0207687_10004974
377 Ga0207690_10218410
378 Ga0207706_10001096
379 Ga0207686_10004095
380 Ga0207670_10005545
381 Ga0207704_10002944
382 Ga0207691_10001064
383 Ga0207691_10066912
384 Ga0207689_10001346
385 Ga0207679_10006533
386 Ga0207679_10051860
387 Ga0207651_10010707
388 Ga0207651_10025504
389 Ga0207668_10013072
390 Ga0207640_10213395
391 Ga0207658_10312190
392 Ga0207677_10033893
393 Ga0207678_10201896
394 Ga0207708_10000051
395 Ga0207648_10000101
396 Ga0207676_10342818
397 Ga0207675_100342771
398 Ga0207683_10000229
399 Ga0207698_10207895
400 Ga0209973_1004369
401 Ga0209969_1000130
402 Ga0209967_1000043
403 Ga0209981_1000074
404 Ga0209996_1000042
405 Ga0209984_1000052
406 Ga0210000_1000039
407 Ga0209995_1000154
408 Ga0209968_1000027
409 Ga0209999_1000034
410 Ga0210002_1000137
411 Ga0209983_1000188
412 Ga0209971_1000154
413 Ga0209966_1000016
414 Ga0209998_10000021
415 Ga0209974_10000003
416 Ga0207428_10003604
417 Ga0268266_10147207
418 Ga0268265_10016490
419 Ga0268264_10120310
420 Ga0316579_10094884
421 Ga0316579_10108331
422 Ga0316576_10005299
423 Ga0316576_10030940
424 Ga0316578_10023830
425 Ga0316574_0023317
426 Ga0316582_0085138
427 Ga0316584_0041884
428 Ga0316584_0050445
429 Ga0395901_0582965
430 Ga0439449_0005984
431 Ga0439462_0003455
432 Ga0450901_003388
433 Ga0451577_0000075
434 Ga0453683_0115579
435 Ga0466961_0024696
436 Ga0453684_0000033
437 Ga0466968_0004472
438 Ga0466959_0076252
439 Ga0451576_0003322
440 Ga0495659_0066390
441 Ga0495660_0023950
442 Ga0496106_0204276
443 Ga0496116_0054687
444 Ga0496116_0096617
445 Ga0496116_0099140
446 Ga0496117_0000040
447 Ga0496117_0018212
448 Ga0496117_0044193
449 Ga0496117_0198470
450 Ga0496119_0002002
451 Ga0496119_0065749
452 Ga0496119_0080046
453 Ga0496120_0000215
454 Ga0496120_0020927
455 Ga0496121_0223067
456 Ga0496122_0001699
457 Ga0496122_0003724
458 Ga0496122_0018522
459 Ga0496122_0058499
460 Ga0496123_0013934
461 Ga0496124_0001252
462 Ga0496125_0004166
463 Ga0496126_0002983
464 Ga0496126_0239742
465 Ga0501031_0089676
466 Ga0501033_0002037
467 Ga0501036_0181930
468 Ga0501039_0108052
469 Ga0501042_0052878
470 Ga0501048_0048429
471 Ga0501067_0267123
472 Ga0501068_0032252
473 Ga0501069_0145201
474 Ga0501072_0013356
475 Ga0501073_0066830
476 Ga0501074_0055452
477 Ga0501075_0009877
478 Ga0501076_0047551
479 Ga0501077_0087729
480 Ga0501080_0038419
481 Ga0501035_0228532
482 Ga0501045_0114799
483 nmdc:mga05p37_67360_c1
484 nmdc:mga09592_16010_c1
485 nmdc:mga0qj67_8497_c1
486 nmdc:mga06r32_10889_c1
487 nmdc:mga08y16_22535_c1
488 nmdc:mga0n895_99282_c1
489 nmdc:mga0rr50_50620_c1
490 nmdc:mga0a205_76504_c1
491 Ga0500555_032839
492 Ga0500637_0006213
493 Ga0501084_0266100
494 Ga0590075_030711
495 Ga0501082_0133343
496 Ga0530510_0053334
497 2512734965
498 2524186579
499 2550906257
500 2556063250
501 2563926975
502 2571532824
503 2573039734
504 2578338013
505 2580935429
506 2601445436
507 2601639119
508 2621276389
509 2643738011
510 2644423101
511 2712199506
512 2728534230
513 2730135631
514 2753810967
515 2791212205
516 2802437301
517 2821114693
518 2864735367
519 2865003459
520 2881635661
521 2881640938
522 2885527949
523 2888580935
524 2889046851
525 2889050383
526 2889280900
527 2904163175
528 2904493757
529 2904598321
530 2904608289
531 2907205789
532 2919162837
533 2925326888
534 2931390299
535 2938650204
536 2939616723
537 2939679682
538 2939704646
539 2945997476
540 2946053688
541 2968564063
542 2971407258
543 2971512613
544 2980125812
545 2980177676
546 2984530349
547 2984536457
548 2988228609
549 2996635991
550 2996709708
551 648171055
552 8054470218
553 8057737611
554 8057979117

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01795

Methyltransf_5

MraW methylase family

6

322

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.9602 4 311
1n2x-assembly2.cif.gz_B crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.9543 4 308
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.9535 4 311
1n2x-assembly1.cif.gz_A crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.9532 4 310
1n2x-assembly2.cif.gz_B crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.951 4 308
ID Description Score Start End Superfamily
af_P60393_12_309_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9751 12 308 3.40.50.1000
af_P60393_12_309_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9687 12 308 3.40.50.1000
3tkaA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9686 112 214 1.10.150.170
1m6yB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9582 112 215 1.10.150.170
1wg8B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9489 4 311 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3C0HXJ8-F1-model_v4 deleted 0.9893 4 227
AF-A0A7X9GBZ0-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase RsmH 0.9888 4 247 GO:0005737
GO:0070475
GO:0071424
AF-A0A7C6TYK5-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase RsmH 0.9836 4 221 GO:0005737
GO:0070475
GO:0071424
AF-A0A840KK65-F1-model_v4 deleted 0.9831 37 310
AF-A0A355YN55-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase 0.9823 2 245 GO:0005737
GO:0070475
GO:0071424

Map