F382801
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 279 | 201 | 255 | 439 |
Family's Representative Sequence
| Representative Sequence | 3300003752|Ga0055539_1000588|Ga0055539_10005883 |
| Length | 478 |
| Sequence | VARLLLPARRTVYAVAAIAALLAAKWRDLANVPVATVGTSLAGALAALFVADVAMTLSQLRRHPIVFERQMPSAFALGQPHGLTVTLAHEGEQPWTLELFDHVPATMTQRLLPARVVLPARSRLDVRYEITPTQRGKVVFAPAAIRVRSRLGLADLQLRVGESQDVHVYPNFAALSRYAWLAGDRRLAEIGIKTYAARGAGTDFKQLGEYVPGMPTRHIDWNASMRHRRPVVREFQDDRDQSVVFLLDCGRRMRADEGPPLAGYREQPPKGARGLAPERPSAAAAGSRIGGSHFDQALNAAMLLAYVALKDGDAVGALTFGHDASEQRHFAPAKGMAALNTLVARLHDIEPSPTHSDYLAAARDLMLRVRRRSLIVVLTNFRDEDCEELEDALKLMRTRHLVLLASLREGVVAEIAAQPLDEPRDIVDVASAHWFENARAEAFRRLAGKNQLLVDTEPEHLPAALVNRYHAVKRARLL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 3 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 4 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 5 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 6 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 7 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 8 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 9 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 10 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 11 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 12 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 13 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 14 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 15 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 16 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 17 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 18 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 19 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 20 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 21 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 22 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 23 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 24 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 25 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 26 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 27 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 28 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 29 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 30 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 31 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 32 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 33 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 34 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 35 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 36 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 39 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 43 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 44 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 46 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 47 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 48 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 49 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 87 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 88 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 90 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 99 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 100 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 140 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 142 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 143 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 144 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 145 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 146 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 147 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 148 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 149 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 150 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 151 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 152 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 153 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 154 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 155 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 156 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 157 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 158 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 159 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 160 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 161 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 162 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 176 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 177 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 178 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 179 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 180 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 181 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 182 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 183 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 184 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 185 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 186 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 187 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 188 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 189 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 190 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 191 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 192 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 193 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 194 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 195 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 196 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 197 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 198 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 199 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 200 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 201 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.04 |
| Metatranscriptomes | 0.36 |
| Isolates | 8.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 37.63 |
| Nodule | 0.72 |
| Rhizoplane | 1.43 |
| Rhizosphere | 46.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10016709 | 3300001989 | Bacteria | 2652 |
| 2 | JGI25156J39149_1000459 | 3300002705 | Bacteria | 24817 |
| 3 | JGI25154J39366_1002135 | 3300002738 | Bacteria | 5531 |
| 4 | JGI25157J39369_1000021 | 3300002741 | Bacteria | 163907 |
| 5 | JGI25159J45721_1002044 | 3300002987 | Bacteria | 7985 |
| 6 | JGI25151J46595_10002148 | 3300003187 | Bacteria | 12247 |
| 7 | JGI25151J46595_10002546 | 3300003187 | Bacteria | 10815 |
| 8 | JGI25151J46595_10018393 | 3300003187 | Bacteria | 3002 |
| 9 | JGI25153J46596_10001619 | 3300003215 | Bacteria | 13360 |
| 10 | rootH2_10000408 | 3300003320 | Bacteria | 2761 |
| 11 | rootH1_10038643 | 3300003323 | Bacteria | 2572 |
| 12 | JGI25161J50226_1002036 | 3300003374 | Bacteria | 5502 |
| 13 | Ga0006562J51391_1097944 | 3300003578 | Bacteria | 4380 |
| 14 | Ga0055539_1000588 | 3300003752 | Bacteria | 10143 |
| 15 | Ga0055533_1000033 | 3300003756 | Bacteria | 265716 |
| 16 | Ga0055525_1000046 | 3300003759 | Bacteria | 261587 |
| 17 | Ga0055525_1002619 | 3300003759 | Bacteria | 1769 |
| 18 | Ga0055535_1000192 | 3300003761 | Bacteria | 64814 |
| 19 | Ga0055542_1000058 | 3300003762 | Bacteria | 162781 |
| 20 | Ga0055537_1000915 | 3300003773 | Bacteria | 13891 |
| 21 | Ga0055534_1001009 | 3300003784 | Bacteria | 12390 |
| 22 | Ga0055528_1001308 | 3300003790 | Bacteria | 15606 |
| 23 | Ga0055530_10000386 | 3300003791 | Bacteria | 39620 |
| 24 | Ga0055540_1001280 | 3300003792 | Bacteria | 15303 |
| 25 | Ga0055540_1003175 | 3300003792 | Bacteria | 8109 |
| 26 | Ga0055540_1010323 | 3300003792 | Bacteria | 3118 |
| 27 | Ga0055531_10000137 | 3300003794 | Bacteria | 83343 |
| 28 | Ga0055531_10001780 | 3300003794 | Bacteria | 15303 |
| 29 | Ga0055543_1001865 | 3300004625 | Bacteria | 7673 |
| 30 | Ga0065165_1000273 | 3300005262 | Bacteria | 87879 |
| 31 | Ga0065165_1005611 | 3300005262 | Bacteria | 6951 |
| 32 | Ga0070682_100043770 | 3300005337 | Bacteria | 2769 |
| 33 | Ga0070660_100039293 | 3300005339 | Bacteria | 3596 |
| 34 | Ga0070660_100099541 | 3300005339 | Bacteria | 2302 |
| 35 | Ga0070659_100143809 | 3300005366 | Bacteria | 1942 |
| 36 | Ga0070667_100100994 | 3300005367 | Bacteria | 2491 |
| 37 | Ga0070663_100074954 | 3300005455 | Bacteria | 2472 |
| 38 | Ga0070662_100059449 | 3300005457 | Bacteria | 2784 |
| 39 | Ga0068867_100160230 | 3300005459 | Bacteria | 1774 |
| 40 | Ga0070679_100067313 | 3300005530 | Bacteria | 3572 |
| 41 | Ga0068853_100125466 | 3300005539 | Bacteria | 2293 |
| 42 | Ga0070672_100019174 | 3300005543 | Bacteria | 4961 |
| 43 | Ga0070665_100002851 | 3300005548 | Bacteria | 18704 |
| 44 | Ga0070665_100029141 | 3300005548 | Bacteria | 5556 |
| 45 | Ga0068855_100009405 | 3300005563 | Bacteria | 11802 |
| 46 | Ga0068855_100088579 | 3300005563 | Bacteria | 3575 |
| 47 | Ga0068855_100128533 | 3300005563 | Bacteria | 2895 |
| 48 | Ga0070664_100004106 | 3300005564 | Bacteria | 11696 |
| 49 | Ga0068857_100005113 | 3300005577 | Bacteria | 11156 |
| 50 | Ga0068857_100010135 | 3300005577 | Bacteria | 8189 |
| 51 | Ga0068857_100045636 | 3300005577 | Bacteria | 3889 |
| 52 | Ga0068856_100000887 | 3300005614 | Bacteria | 32039 |
| 53 | Ga0068856_100107840 | 3300005614 | Bacteria | 2781 |
| 54 | Ga0068859_100141693 | 3300005617 | Bacteria | 2478 |
| 55 | Ga0068851_10019995 | 3300005834 | Bacteria | 3239 |
| 56 | Ga0068858_100001882 | 3300005842 | Bacteria | 21432 |
| 57 | Ga0068860_100013493 | 3300005843 | Bacteria | 8011 |
| 58 | Ga0068862_100032277 | 3300005844 | Bacteria | 4424 |
| 59 | Ga0081455_10009064 | 3300005937 | Bacteria | 10266 |
| 60 | Ga0075365_10046615 | 3300006038 | Bacteria | 2847 |
| 61 | Ga0075364_10008823 | 3300006051 | Bacteria | 6033 |
| 62 | Ga0075364_10046443 | 3300006051 | Bacteria | 2828 |
| 63 | Ga0075367_10030097 | 3300006178 | Bacteria | 3110 |
| 64 | Ga0075366_10013680 | 3300006195 | Bacteria | 4626 |
| 65 | Ga0075370_10001295 | 3300006353 | Bacteria | 10687 |
| 66 | Ga0075370_10020001 | 3300006353 | Bacteria | 3651 |
| 67 | Ga0097620_100141690 | 3300006931 | Bacteria | 2478 |
| 68 | Ga0105244_10004022 | 3300009036 | Bacteria | 10269 |
| 69 | Ga0105237_10011120 | 3300009545 | Bacteria | 9541 |
| 70 | Ga0105237_10021474 | 3300009545 | Bacteria | 6636 |
| 71 | Ga0105237_10094924 | 3300009545 | Bacteria | 2971 |
| 72 | Ga0105238_10048705 | 3300009551 | Bacteria | 4269 |
| 73 | Ga0105239_10024610 | 3300010375 | Bacteria | 6632 |
| 74 | Ga0105239_10030789 | 3300010375 | Bacteria | 5902 |
| 75 | Ga0105239_10079930 | 3300010375 | Bacteria | 3598 |
| 76 | Ga0157371_10041745 | 3300013102 | Bacteria | 3272 |
| 77 | Ga0157369_10006986 | 3300013105 | Bacteria | 13022 |
| 78 | Ga0157369_10082661 | 3300013105 | Unclassified | 3436 |
| 79 | Ga0157375_10013989 | 3300013308 | Bacteria | 7155 |
| 80 | Ga0163163_10032224 | 3300014325 | Bacteria | 5062 |
| 81 | Ga0182008_10005126 | 3300014497 | Bacteria | 7520 |
| 82 | Ga0157379_10063964 | 3300014968 | Bacteria | 3288 |
| 83 | Ga0157379_10122665 | 3300014968 | Bacteria | 2338 |
| 84 | Ga0182006_1001206 | 3300015261 | Bacteria | 16155 |
| 85 | Ga0182007_10001393 | 3300015262 | Bacteria | 13006 |
| 86 | Ga0163161_10029173 | 3300017792 | Bacteria | 3922 |
| 87 | Ga0213872_10000161 | 3300021361 | Bacteria | 61406 |
| 88 | Ga0213872_10000177 | 3300021361 | Bacteria | 56798 |
| 89 | Ga0209436_104069 | 3300025208 | Bacteria | 3689 |
| 90 | Ga0209674_100064 | 3300025226 | Bacteria | 265769 |
| 91 | Ga0209672_100539 | 3300025228 | Bacteria | 20575 |
| 92 | Ga0209147_102021 | 3300025229 | Bacteria | 5849 |
| 93 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 94 | Ga0209563_100126 | 3300025230 | Bacteria | 113122 |
| 95 | Ga0207427_100197 | 3300025231 | Bacteria | 57629 |
| 96 | Ga0209258_100147 | 3300025242 | Bacteria | 162823 |
| 97 | Ga0209258_100905 | 3300025242 | Bacteria | 15234 |
| 98 | Ga0207425_1000518 | 3300025245 | Bacteria | 23516 |
| 99 | Ga0207425_1002887 | 3300025245 | Bacteria | 5767 |
| 100 | Ga0209646_1000060 | 3300025246 | Bacteria | 256386 |
| 101 | Ga0209026_1000049 | 3300025250 | Bacteria | 255273 |
| 102 | Ga0209677_100411 | 3300025253 | Bacteria | 25661 |
| 103 | Ga0209677_100792 | 3300025253 | Bacteria | 15906 |
| 104 | Ga0209677_101222 | 3300025253 | Bacteria | 11674 |
| 105 | Ga0209148_1000122 | 3300025254 | Bacteria | 186071 |
| 106 | Ga0209759_1000069 | 3300025256 | Bacteria | 182437 |
| 107 | Ga0209759_1001428 | 3300025256 | Bacteria | 13546 |
| 108 | Ga0209129_1000601 | 3300025258 | Bacteria | 24463 |
| 109 | Ga0209129_1003026 | 3300025258 | Bacteria | 7634 |
| 110 | Ga0209565_1000248 | 3300025263 | Bacteria | 57592 |
| 111 | Ga0209565_1002762 | 3300025263 | Bacteria | 6088 |
| 112 | Ga0209673_1000377 | 3300025273 | Bacteria | 80360 |
| 113 | Ga0209673_1000681 | 3300025273 | Bacteria | 48925 |
| 114 | Ga0209130_1000218 | 3300025284 | Bacteria | 75339 |
| 115 | Ga0209130_1000614 | 3300025284 | Bacteria | 34072 |
| 116 | Ga0209675_1000673 | 3300025291 | Bacteria | 23959 |
| 117 | Ga0209675_1001146 | 3300025291 | Bacteria | 16153 |
| 118 | Ga0209676_1000202 | 3300025292 | Bacteria | 133078 |
| 119 | Ga0209676_1002009 | 3300025292 | Bacteria | 16042 |
| 120 | Ga0209025_1000285 | 3300025294 | Bacteria | 114575 |
| 121 | Ga0209025_1001205 | 3300025294 | Bacteria | 36303 |
| 122 | Ga0209025_1006058 | 3300025294 | Bacteria | 9563 |
| 123 | Ga0209025_1009354 | 3300025294 | Bacteria | 6850 |
| 124 | Ga0209564_1000223 | 3300025295 | Bacteria | 128117 |
| 125 | Ga0209564_1000226 | 3300025295 | Bacteria | 125693 |
| 126 | Ga0209564_1002033 | 3300025295 | Bacteria | 17545 |
| 127 | Ga0209758_1000142 | 3300025297 | Bacteria | 171779 |
| 128 | Ga0209758_1015195 | 3300025297 | Bacteria | 4012 |
| 129 | Ga0209050_1000224 | 3300025298 | Bacteria | 125433 |
| 130 | Ga0209050_1001384 | 3300025298 | Bacteria | 26424 |
| 131 | Ga0209050_1002324 | 3300025298 | Bacteria | 16727 |
| 132 | Ga0209256_1000114 | 3300025299 | Bacteria | 173999 |
| 133 | Ga0209256_1000174 | 3300025299 | Bacteria | 128117 |
| 134 | Ga0207426_1000162 | 3300025302 | Bacteria | 172643 |
| 135 | Ga0207426_1000232 | 3300025302 | Bacteria | 128117 |
| 136 | Ga0209051_1000112 | 3300025303 | Bacteria | 152667 |
| 137 | Ga0209051_1000497 | 3300025303 | Bacteria | 50521 |
| 138 | Ga0209051_1009583 | 3300025303 | Bacteria | 4977 |
| 139 | Ga0209257_1000131 | 3300025304 | Bacteria | 211464 |
| 140 | Ga0209257_1000163 | 3300025304 | Bacteria | 175355 |
| 141 | Ga0209257_1000290 | 3300025304 | Bacteria | 110826 |
| 142 | Ga0209257_1003943 | 3300025304 | Bacteria | 12048 |
| 143 | Ga0209257_1005851 | 3300025304 | Bacteria | 8329 |
| 144 | Ga0207656_10001974 | 3300025321 | Bacteria | 6834 |
| 145 | Ga0207695_10045326 | 3300025913 | Bacteria | 4669 |
| 146 | Ga0207695_10095269 | 3300025913 | Bacteria | 2981 |
| 147 | Ga0207671_10031503 | 3300025914 | Bacteria | 3951 |
| 148 | Ga0207671_10077831 | 3300025914 | Bacteria | 2483 |
| 149 | Ga0207671_10120531 | 3300025914 | Bacteria | 2005 |
| 150 | Ga0207657_10171297 | 3300025919 | Bacteria | 1758 |
| 151 | Ga0207649_10111711 | 3300025920 | Bacteria | 1827 |
| 152 | Ga0207694_10051432 | 3300025924 | Bacteria | 3193 |
| 153 | Ga0207687_10046026 | 3300025927 | Bacteria | 3018 |
| 154 | Ga0207690_10078739 | 3300025932 | Bacteria | 2295 |
| 155 | Ga0207706_10009725 | 3300025933 | Bacteria | 8826 |
| 156 | Ga0207709_10000752 | 3300025935 | Bacteria | 25630 |
| 157 | Ga0207709_10105779 | 3300025935 | Bacteria | 1871 |
| 158 | Ga0207691_10004083 | 3300025940 | Bacteria | 14165 |
| 159 | Ga0207689_10014953 | 3300025942 | Bacteria | 6585 |
| 160 | Ga0207661_10023415 | 3300025944 | Bacteria | 4666 |
| 161 | Ga0207679_10042833 | 3300025945 | Bacteria | 3256 |
| 162 | Ga0207667_10001779 | 3300025949 | Bacteria | 27124 |
| 163 | Ga0207667_10024063 | 3300025949 | Bacteria | 6697 |
| 164 | Ga0207667_10115020 | 3300025949 | Bacteria | 2773 |
| 165 | Ga0207640_10093351 | 3300025981 | Bacteria | 2090 |
| 166 | Ga0207639_10020646 | 3300026041 | Bacteria | 4718 |
| 167 | Ga0207678_10096152 | 3300026067 | Bacteria | 2531 |
| 168 | Ga0207702_10002045 | 3300026078 | Bacteria | 19536 |
| 169 | Ga0207674_10024723 | 3300026116 | Bacteria | 6411 |
| 170 | Ga0207674_10028490 | 3300026116 | Bacteria | 5895 |
| 171 | Ga0207674_10097346 | 3300026116 | Bacteria | 2926 |
| 172 | Ga0207698_10060085 | 3300026142 | Bacteria | 2954 |
| 173 | Ga0207698_10072350 | 3300026142 | Bacteria | 2740 |
| 174 | Ga0268266_10001345 | 3300028379 | Bacteria | 29695 |
| 175 | Ga0265334_10038109 | 3300028573 | Unclassified | 1893 |
| 176 | Ga0265336_10000123 | 3300028666 | Bacteria | 57956 |
| 177 | Ga0307515_10012310 | 3300028794 | Bacteria | 16098 |
| 178 | Ga0307515_10157365 | 3300028794 | Bacteria | 2337 |
| 179 | Ga0265324_10000932 | 3300029957 | Bacteria | 18361 |
| 180 | Ga0265331_10002087 | 3300031250 | Bacteria | 13819 |
| 181 | Ga0265331_10003807 | 3300031250 | Bacteria | 9570 |
| 182 | Ga0265327_10000028 | 3300031251 | Bacteria | 361066 |
| 183 | Ga0307408_100038561 | 3300031548 | Bacteria | 3372 |
| 184 | Ga0307514_10001826 | 3300031649 | Bacteria | 23651 |
| 185 | Ga0307516_10000383 | 3300031730 | Bacteria | 57684 |
| 186 | Ga0373931_0003056 | 3300035691 | Bacteria | 7481 |
| 187 | Ga0395905_0041251 | 3300037471 | Bacteria | 4331 |
| 188 | Ga0395901_0030872 | 3300038443 | Bacteria | 5522 |
| 189 | Ga0395901_0318285 | 3300038443 | Bacteria | 1610 |
| 190 | Ga0436365_1025357 | 3300039437 | Bacteria | 3236 |
| 191 | Ga0436361_0481133 | 3300039447 | Bacteria | 61506 |
| 192 | Ga0436361_0521796 | 3300039447 | Bacteria | 35201 |
| 193 | Ga0466969_0000028 | 3300044656 | Bacteria | 92394 |
| 194 | Ga0466966_0002819 | 3300044684 | Bacteria | 11437 |
| 195 | Ga0466966_0011741 | 3300044684 | Bacteria | 5807 |
| 196 | Ga0466966_0012032 | 3300044684 | Bacteria | 5734 |
| 197 | Ga0466961_0002399 | 3300044693 | Bacteria | 11641 |
| 198 | Ga0466961_0049817 | 3300044693 | Bacteria | 2676 |
| 199 | Ga0466963_0062303 | 3300044694 | Bacteria | 2495 |
| 200 | Ga0466964_0001494 | 3300044706 | Bacteria | 8019 |
| 201 | Ga0466970_0052420 | 3300044765 | Bacteria | 2177 |
| 202 | Ga0466957_0003346 | 3300044842 | Bacteria | 8788 |
| 203 | Ga0466959_0007818 | 3300045049 | Bacteria | 7525 |
| 204 | Ga0466959_0079307 | 3300045049 | Bacteria | 2367 |
| 205 | Ga0466959_0088259 | 3300045049 | Bacteria | 2229 |
| 206 | Ga0466958_0103773 | 3300045836 | Bacteria | 1770 |
| 207 | Ga0495650_0011619 | 3300046471 | Bacteria | 4807 |
| 208 | Ga0495650_0041262 | 3300046471 | Bacteria | 1975 |
| 209 | Ga0495585_0047699 | 3300046492 | Bacteria | 2385 |
| 210 | Ga0495583_0000046 | 3300046506 | Bacteria | 218059 |
| 211 | Ga0495606_0001300 | 3300046507 | Bacteria | 34419 |
| 212 | Ga0495610_0027445 | 3300046512 | Bacteria | 3025 |
| 213 | Ga0495631_0000405 | 3300046518 | Bacteria | 29764 |
| 214 | Ga0495654_0002419 | 3300046530 | Bacteria | 12027 |
| 215 | Ga0495609_0034038 | 3300046538 | Bacteria | 2311 |
| 216 | Ga0495625_0016534 | 3300046660 | Bacteria | 5802 |
| 217 | Ga0495658_0048779 | 3300046683 | Bacteria | 2389 |
| 218 | Ga0495649_0000638 | 3300046694 | Bacteria | 28526 |
| 219 | Ga0495593_0003378 | 3300047673 | Bacteria | 9561 |
| 220 | Ga0495614_0025112 | 3300048089 | Bacteria | 2571 |
| 221 | Ga0496104_0036079 | 3300048907 | Bacteria | 4619 |
| 222 | Ga0496116_0006960 | 3300048919 | Bacteria | 10135 |
| 223 | Ga0496117_0015463 | 3300048920 | Bacteria | 6505 |
| 224 | Ga0496118_0006317 | 3300048921 | Bacteria | 13093 |
| 225 | Ga0496118_0013124 | 3300048921 | Bacteria | 7867 |
| 226 | Ga0496121_0067524 | 3300048924 | Bacteria | 2897 |
| 227 | Ga0496122_0131826 | 3300048925 | Bacteria | 1586 |
| 228 | Ga0496124_0009873 | 3300048927 | Bacteria | 9762 |
| 229 | Ga0496124_0034458 | 3300048927 | Bacteria | 4443 |
| 230 | Ga0496125_0005801 | 3300048928 | Bacteria | 13563 |
| 231 | Ga0496125_0060278 | 3300048928 | Bacteria | 3052 |
| 232 | Ga0496126_0001393 | 3300048929 | Bacteria | 38278 |
| 233 | nmdc:mga00v17_4355_c1 | 3300050491 | Bacteria | 7354 |
| 234 | nmdc:mga0yw44_41851_c1 | 3300050492 | Bacteria | 2729 |
| 235 | nmdc:mga07m45_24671_c1 | 3300050496 | Bacteria | 3295 |
| 236 | nmdc:mga07m45_37052_c1 | 3300050496 | Bacteria | 2720 |
| 237 | nmdc:mga07m45_88428_c1 | 3300050496 | Bacteria | 1773 |
| 238 | nmdc:mga0sz30_54942_c1 | 3300050516 | Bacteria | 1694 |
| 239 | Ga0500635_0000005 | 3300053080 | Bacteria | 187821 |
| 240 | Ga0500635_0005447 | 3300053080 | Bacteria | 3339 |
| 241 | Ga0500643_010133 | 3300053087 | Bacteria | 3536 |
| 242 | Ga0500651_0000217 | 3300053093 | Bacteria | 36081 |
| 243 | Ga0500641_0009126 | 3300053096 | Bacteria | 3557 |
| 244 | Ga0500571_000292 | 3300053110 | Bacteria | 19509 |
| 245 | Ga0500608_037641 | 3300053122 | Bacteria | 2311 |
| 246 | Ga0500655_000917 | 3300053133 | Bacteria | 5705 |
| 247 | Ga0500658_0000686 | 3300053134 | Bacteria | 13986 |
| 248 | Ga0500658_0000800 | 3300053134 | Bacteria | 13026 |
| 249 | Ga0500568_0002984 | 3300053139 | Bacteria | 9677 |
| 250 | Ga0500616_0000030 | 3300053153 | Bacteria | 415224 |
| 251 | Ga0500634_0022626 | 3300053161 | Bacteria | 3412 |
| 252 | Ga0500638_000750 | 3300053162 | Bacteria | 8813 |
| 253 | Ga0500636_0016393 | 3300053177 | Bacteria | 4370 |
| 254 | Ga0500636_0038433 | 3300053177 | Bacteria | 2831 |
| 255 | Ga0466962_0003967 | 3300061719 | Bacteria | 7084 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039447 | Ga0436361_0481133 | Ga0436361_0481133_23132_24502 | 387 |
| 2 | 3300021361 | Ga0213872_10000161 | Ga0213872_1000016140 | 391 |
| 3 | 3300025304 | Ga0209257_1005851 | Ga0209257_10058515 | 391 |
| 4 | 3300044684 | Ga0466966_0011741 | Ga0466966_0011741_4105_5466 | 392 |
| 5 | 3300044693 | Ga0466961_0002399 | Ga0466961_0002399_4959_6320 | 392 |
| 6 | 3300045049 | Ga0466959_0007818 | Ga0466959_0007818_2068_3429 | 392 |
| 7 | 3300003794 | Ga0055531_10000137 | Ga0055531_1000013772 | 397 |
| 8 | 3300025298 | Ga0209050_1001384 | Ga0209050_100138419 | 397 |
| 9 | 3300025304 | Ga0209257_1000131 | Ga0209257_100013158 | 397 |
| 10 | 3300005337 | Ga0070682_100043770 | Ga0070682_1000437702 | 398 |
| 11 | 3300021361 | Ga0213872_10000177 | Ga0213872_1000017739 | 399 |
| 12 | 3300039447 | Ga0436361_0521796 | Ga0436361_0521796_13050_14396 | 399 |
| 13 | 3300028794 | Ga0307515_10012310 | Ga0307515_1001231015 | 401 |
| 14 | 3300028794 | Ga0307515_10157365 | Ga0307515_101573652 | 401 |
| 15 | 3300005455 | Ga0070663_100074954 | Ga0070663_1000749542 | 403 |
| 16 | 3300026067 | Ga0207678_10096152 | Ga0207678_100961522 | 403 |
| 17 | 3300048919 | Ga0496116_0006960 | Ga0496116_0006960_4117_5478 | 403 |
| 18 | 3300048920 | Ga0496117_0015463 | Ga0496117_0015463_2086_3447 | 403 |
| 19 | 3300048921 | Ga0496118_0006317 | Ga0496118_0006317_6343_7704 | 403 |
| 20 | 3300003761 | Ga0055535_1000192 | Ga0055535_10001924 | 404 |
| 21 | 3300003762 | Ga0055542_1000058 | Ga0055542_100005847 | 404 |
| 22 | 3300003792 | Ga0055540_1001280 | Ga0055540_100128013 | 404 |
| 23 | 3300003794 | Ga0055531_10001780 | Ga0055531_100017805 | 404 |
| 24 | 3300025228 | Ga0209672_100539 | Ga0209672_10053921 | 404 |
| 25 | 3300025229 | Ga0209147_102021 | Ga0209147_1020212 | 404 |
| 26 | 3300025242 | Ga0209258_100147 | Ga0209258_100147108 | 404 |
| 27 | 3300025254 | Ga0209148_1000122 | Ga0209148_100012247 | 404 |
| 28 | 3300025292 | Ga0209676_1002009 | Ga0209676_10020095 | 404 |
| 29 | 3300025298 | Ga0209050_1002324 | Ga0209050_100232415 | 404 |
| 30 | 3300025303 | Ga0209051_1000112 | Ga0209051_100011299 | 404 |
| 31 | 3300025304 | Ga0209257_1000290 | Ga0209257_100029038 | 404 |
| 32 | 3300026116 | Ga0207674_10097346 | Ga0207674_100973462 | 404 |
| 33 | 3300005614 | Ga0068856_100107840 | Ga0068856_1001078403 | 406 |
| 34 | 3300025935 | Ga0207709_10105779 | Ga0207709_101057793 | 406 |
| 35 | 3300031250 | Ga0265331_10002087 | Ga0265331_100020873 | 407 |
| 36 | 3300031251 | Ga0265327_10000028 | Ga0265327_10000028247 | 407 |
| 37 | 3300005367 | Ga0070667_100100994 | Ga0070667_1001009942 | 411 |
| 38 | 3300005543 | Ga0070672_100019174 | Ga0070672_1000191743 | 411 |
| 39 | 3300005617 | Ga0068859_100141693 | Ga0068859_1001416932 | 411 |
| 40 | 3300005842 | Ga0068858_100001882 | Ga0068858_1000018824 | 411 |
| 41 | 3300005843 | Ga0068860_100013493 | Ga0068860_1000134935 | 411 |
| 42 | 3300006931 | Ga0097620_100141690 | Ga0097620_1001416902 | 411 |
| 43 | 3300013308 | Ga0157375_10013989 | Ga0157375_100139894 | 411 |
| 44 | 3300014968 | Ga0157379_10122665 | Ga0157379_101226652 | 411 |
| 45 | 3300025940 | Ga0207691_10004083 | Ga0207691_100040832 | 411 |
| 46 | 3300005262 | Ga0065165_1000273 | Ga0065165_100027380 | 415 |
| 47 | 3300009545 | Ga0105237_10021474 | Ga0105237_100214744 | 415 |
| 48 | 3300013105 | Ga0157369_10006986 | Ga0157369_100069864 | 415 |
| 49 | 3300048907 | Ga0496104_0036079 | Ga0496104_0036079_1238_2701 | 416 |
| 50 | 3300005530 | Ga0070679_100067313 | Ga0070679_1000673132 | 417 |
| 51 | 3300025944 | Ga0207661_10023415 | Ga0207661_100234152 | 417 |
| 52 | 3300037471 | Ga0395905_0041251 | Ga0395905_0041251_1525_2874 | 417 |
| 53 | 3300039437 | Ga0436365_1025357 | Ga0436365_1025357_1538_2890 | 417 |
| 54 | 3300053134 | Ga0500658_0000800 | Ga0500658_0000800_3269_4633 | 417 |
| 55 | 3300005563 | Ga0068855_100088579 | Ga0068855_1000885793 | 418 |
| 56 | 3300025949 | Ga0207667_10115020 | Ga0207667_101150203 | 418 |
| 57 | 3300005563 | Ga0068855_100009405 | Ga0068855_1000094059 | 419 |
| 58 | 3300025949 | Ga0207667_10024063 | Ga0207667_100240633 | 419 |
| 59 | 3300005459 | Ga0068867_100160230 | Ga0068867_1001602301 | 420 |
| 60 | 3300045836 | Ga0466958_0103773 | Ga0466958_0103773_304_1677 | 420 |
| 61 | 3300025914 | Ga0207671_10077831 | Ga0207671_100778311 | 421 |
| 62 | 3300004625 | Ga0055543_1001865 | Ga0055543_10018652 | 422 |
| 63 | 3300005262 | Ga0065165_1005611 | Ga0065165_10056113 | 422 |
| 64 | 3300005457 | Ga0070662_100059449 | Ga0070662_1000594492 | 422 |
| 65 | 3300005539 | Ga0068853_100125466 | Ga0068853_1001254662 | 422 |
| 66 | 3300005564 | Ga0070664_100004106 | Ga0070664_1000041063 | 422 |
| 67 | 3300005577 | Ga0068857_100045636 | Ga0068857_1000456364 | 422 |
| 68 | 3300006353 | Ga0075370_10020001 | Ga0075370_100200013 | 422 |
| 69 | 3300009036 | Ga0105244_10004022 | Ga0105244_100040224 | 422 |
| 70 | 3300014497 | Ga0182008_10005126 | Ga0182008_100051261 | 422 |
| 71 | 3300015261 | Ga0182006_1001206 | Ga0182006_10012064 | 422 |
| 72 | 3300015262 | Ga0182007_10001393 | Ga0182007_100013934 | 422 |
| 73 | 3300025919 | Ga0207657_10171297 | Ga0207657_101712972 | 422 |
| 74 | 3300025920 | Ga0207649_10111711 | Ga0207649_101117112 | 422 |
| 75 | 3300025927 | Ga0207687_10046026 | Ga0207687_100460262 | 422 |
| 76 | 3300025933 | Ga0207706_10009725 | Ga0207706_100097252 | 422 |
| 77 | 3300025935 | Ga0207709_10000752 | Ga0207709_1000075218 | 422 |
| 78 | 3300025945 | Ga0207679_10042833 | Ga0207679_100428332 | 422 |
| 79 | 3300026041 | Ga0207639_10020646 | Ga0207639_100206462 | 422 |
| 80 | 3300026142 | Ga0207698_10072350 | Ga0207698_100723502 | 422 |
| 81 | 3300048927 | Ga0496124_0009873 | Ga0496124_0009873_7437_8798 | 422 |
| 82 | 3300048928 | Ga0496125_0005801 | Ga0496125_0005801_9415_10776 | 422 |
| 83 | 3300050496 | nmdc:mga07m45_37052_c1 | nmdc:mga07m45_37052_c1_1277_2638 | 422 |
| 84 | 3300028573 | Ga0265334_10038109 | Ga0265334_100381092 | 424 |
| 85 | 3300031250 | Ga0265331_10003807 | Ga0265331_100038073 | 424 |
| 86 | 3300046694 | Ga0495649_0000638 | Ga0495649_0000638_23579_25042 | 425 |
| 87 | 3300005548 | Ga0070665_100002851 | Ga0070665_10000285119 | 427 |
| 88 | 3300009545 | Ga0105237_10011120 | Ga0105237_100111202 | 427 |
| 89 | 3300010375 | Ga0105239_10079930 | Ga0105239_100799303 | 427 |
| 90 | 3300014325 | Ga0163163_10032224 | Ga0163163_100322242 | 427 |
| 91 | 3300025914 | Ga0207671_10120531 | Ga0207671_101205312 | 427 |
| 92 | 3300028379 | Ga0268266_10001345 | Ga0268266_100013451 | 427 |
| 93 | 3300045049 | Ga0466959_0088259 | Ga0466959_0088259_406_1776 | 429 |
| 94 | 3300013105 | Ga0157369_10082661 | Ga0157369_100826614 | 430 |
| 95 | 3300031548 | Ga0307408_100038561 | Ga0307408_1000385612 | 430 |
| 96 | 3300038443 | Ga0395901_0318285 | Ga0395901_0318285_59_1420 | 432 |
| 97 | 3300046471 | Ga0495650_0011619 | Ga0495650_0011619_2571_3923 | 432 |
| 98 | 3300048929 | Ga0496126_0001393 | Ga0496126_0001393_24532_25890 | 433 |
| 99 | 3300053087 | Ga0500643_010133 | Ga0500643_010133_1999_3363 | 433 |
| 100 | 3300044656 | Ga0466969_0000028 | Ga0466969_0000028_24671_26047 | 434 |
| 101 | 3300044684 | Ga0466966_0012032 | Ga0466966_0012032_3615_4991 | 434 |
| 102 | 3300010375 | Ga0105239_10030789 | Ga0105239_100307894 | 435 |
| 103 | 3300013102 | Ga0157371_10041745 | Ga0157371_100417452 | 435 |
| 104 | 3300025253 | Ga0209677_100792 | Ga0209677_10079210 | 435 |
| 105 | 3300026142 | Ga0207698_10060085 | Ga0207698_100600852 | 435 |
| 106 | 3300046492 | Ga0495585_0047699 | Ga0495585_0047699_276_1658 | 435 |
| 107 | 3300046518 | Ga0495631_0000405 | Ga0495631_0000405_9911_11275 | 435 |
| 108 | 3300046683 | Ga0495658_0048779 | Ga0495658_0048779_611_1975 | 435 |
| 109 | 3300048925 | Ga0496122_0131826 | Ga0496122_0131826_97_1461 | 435 |
| 110 | 3300050496 | nmdc:mga07m45_24671_c1 | nmdc:mga07m45_24671_c1_1895_3256 | 436 |
| 111 | 3300017792 | Ga0163161_10029173 | Ga0163161_100291733 | 437 |
| 112 | 3300046512 | Ga0495610_0027445 | Ga0495610_0027445_1435_2799 | 437 |
| 113 | 3300046530 | Ga0495654_0002419 | Ga0495654_0002419_4346_5710 | 437 |
| 114 | 3300048089 | Ga0495614_0025112 | Ga0495614_0025112_226_1590 | 437 |
| 115 | 3300048924 | Ga0496121_0067524 | Ga0496121_0067524_1257_2621 | 437 |
| 116 | 3300048928 | Ga0496125_0060278 | Ga0496125_0060278_293_1657 | 437 |
| 117 | 3300053093 | Ga0500651_0000217 | Ga0500651_0000217_25581_26945 | 437 |
| 118 | 3300053134 | Ga0500658_0000686 | Ga0500658_0000686_8392_9756 | 437 |
| 119 | 3300053139 | Ga0500568_0002984 | Ga0500568_0002984_6873_8237 | 437 |
| 120 | 3300053161 | Ga0500634_0022626 | Ga0500634_0022626_1995_3359 | 437 |
| 121 | 3300035691 | Ga0373931_0003056 | Ga0373931_0003056_725_2095 | 438 |
| 122 | 3300044693 | Ga0466961_0049817 | Ga0466961_0049817_68_1444 | 438 |
| 123 | 3300044694 | Ga0466963_0062303 | Ga0466963_0062303_470_1858 | 438 |
| 124 | 3300045049 | Ga0466959_0079307 | Ga0466959_0079307_911_2287 | 438 |
| 125 | 3300047673 | Ga0495593_0003378 | Ga0495593_0003378_6869_8233 | 438 |
| 126 | 3300053110 | Ga0500571_000292 | Ga0500571_000292_206_1570 | 438 |
| 127 | 3300053133 | Ga0500655_000917 | Ga0500655_000917_240_1604 | 438 |
| 128 | 3300053162 | Ga0500638_000750 | Ga0500638_000750_6271_7635 | 438 |
| 129 | 3300053177 | Ga0500636_0016393 | Ga0500636_0016393_2770_4134 | 438 |
| 130 | 3300025231 | Ga0207427_100197 | Ga0207427_10019722 | 439 |
| 131 | 3300003323 | rootH1_10038643 | rootH1_100386433 | 441 |
| 132 | 3300005834 | Ga0068851_10019995 | Ga0068851_100199953 | 442 |
| 133 | 3300006038 | Ga0075365_10046615 | Ga0075365_100466153 | 442 |
| 134 | 3300025321 | Ga0207656_10001974 | Ga0207656_100019745 | 442 |
| 135 | 3300031730 | Ga0307516_10000383 | Ga0307516_1000038347 | 442 |
| 136 | 3300050492 | nmdc:mga0yw44_41851_c1 | nmdc:mga0yw44_41851_c1_692_2050 | 442 |
| 137 | 3300025294 | Ga0209025_1009354 | Ga0209025_10093546 | 443 |
| 138 | 3300025295 | Ga0209564_1002033 | Ga0209564_10020337 | 443 |
| 139 | 3300053096 | Ga0500641_0009126 | Ga0500641_0009126_1562_2929 | 443 |
| 140 | 3300006195 | Ga0075366_10013680 | Ga0075366_100136804 | 444 |
| 141 | 3300014968 | Ga0157379_10063964 | Ga0157379_100639643 | 444 |
| 142 | 3300025242 | Ga0209258_100905 | Ga0209258_10090515 | 444 |
| 143 | 3300025913 | Ga0207695_10045326 | Ga0207695_100453263 | 444 |
| 144 | 3300025949 | Ga0207667_10001779 | Ga0207667_1000177912 | 444 |
| 145 | 3300038443 | Ga0395901_0030872 | Ga0395901_0030872_497_1849 | 444 |
| 146 | 3300046506 | Ga0495583_0000046 | Ga0495583_0000046_192900_194252 | 444 |
| 147 | 3300046507 | Ga0495606_0001300 | Ga0495606_0001300_30686_32038 | 444 |
| 148 | 3300046660 | Ga0495625_0016534 | Ga0495625_0016534_550_1902 | 444 |
| 149 | 3300053080 | Ga0500635_0000005 | Ga0500635_0000005_47881_49233 | 444 |
| 150 | 3300053080 | Ga0500635_0005447 | Ga0500635_0005447_1227_2579 | 444 |
| 151 | 3300053177 | Ga0500636_0038433 | Ga0500636_0038433_1232_2584 | 444 |
| 152 | iso_pu_bacteria | 2585428057 | 2587726060 | 445 |
| 153 | iso_pu_bacteria | 2585428058 | 2587735790 | 445 |
| 154 | 3300003187 | JGI25151J46595_10018393 | JGI25151J46595_100183932 | 446 |
| 155 | 3300006051 | Ga0075364_10008823 | Ga0075364_100088232 | 446 |
| 156 | 3300025245 | Ga0207425_1002887 | Ga0207425_10028873 | 446 |
| 157 | 3300025294 | Ga0209025_1006058 | Ga0209025_10060583 | 446 |
| 158 | 3300025297 | Ga0209758_1015195 | Ga0209758_10151953 | 446 |
| 159 | 3300050491 | nmdc:mga00v17_4355_c1 | nmdc:mga00v17_4355_c1_1738_3108 | 446 |
| 160 | 3300003187 | JGI25151J46595_10002546 | JGI25151J46595_1000254611 | 447 |
| 161 | 3300005339 | Ga0070660_100099541 | Ga0070660_1000995412 | 447 |
| 162 | 3300005366 | Ga0070659_100143809 | Ga0070659_1001438092 | 447 |
| 163 | 3300005577 | Ga0068857_100010135 | Ga0068857_1000101357 | 447 |
| 164 | 3300005844 | Ga0068862_100032277 | Ga0068862_1000322772 | 447 |
| 165 | 3300006178 | Ga0075367_10030097 | Ga0075367_100300973 | 447 |
| 166 | 3300006353 | Ga0075370_10001295 | Ga0075370_100012959 | 447 |
| 167 | 3300009545 | Ga0105237_10094924 | Ga0105237_100949243 | 447 |
| 168 | 3300025258 | Ga0209129_1003026 | Ga0209129_10030267 | 447 |
| 169 | 3300025294 | Ga0209025_1000285 | Ga0209025_100028565 | 447 |
| 170 | 3300025914 | Ga0207671_10031503 | Ga0207671_100315033 | 447 |
| 171 | 3300025932 | Ga0207690_10078739 | Ga0207690_100787391 | 447 |
| 172 | 3300026116 | Ga0207674_10024723 | Ga0207674_100247235 | 447 |
| 173 | 3300046538 | Ga0495609_0034038 | Ga0495609_0034038_689_2050 | 447 |
| 174 | 3300050516 | nmdc:mga0sz30_54942_c1 | nmdc:mga0sz30_54942_c1_121_1476 | 447 |
| 175 | 3300053122 | Ga0500608_037641 | Ga0500608_037641_200_1561 | 447 |
| 176 | 3300003752 | Ga0055539_1000588 | Ga0055539_10005883 | 448 |
| 177 | 3300003756 | Ga0055533_1000033 | Ga0055533_100003322 | 448 |
| 178 | 3300003759 | Ga0055525_1002619 | Ga0055525_10026191 | 448 |
| 179 | 3300025226 | Ga0209674_100064 | Ga0209674_100064227 | 448 |
| 180 | 3300025230 | Ga0209563_100126 | Ga0209563_10012686 | 448 |
| 181 | 3300025253 | Ga0209677_100411 | Ga0209677_10041122 | 448 |
| 182 | iso_pu_bacteria | 2511231002 | 2511247325 | 448 |
| 183 | iso_pu_bacteria | 2643221672 | 2644398133 | 448 |
| 184 | iso_pu_bacteria | 2738541337 | 2739053263 | 448 |
| 185 | iso_pu_bacteria | 2831864461 | 2831866929 | 448 |
| 186 | 3300002705 | JGI25156J39149_1000459 | JGI25156J39149_100045921 | 449 |
| 187 | 3300002738 | JGI25154J39366_1002135 | JGI25154J39366_10021352 | 449 |
| 188 | 3300002741 | JGI25157J39369_1000021 | JGI25157J39369_1000021133 | 449 |
| 189 | 3300003320 | rootH2_10000408 | rootH2_100004082 | 449 |
| 190 | 3300003759 | Ga0055525_1000046 | Ga0055525_1000046170 | 449 |
| 191 | 3300005339 | Ga0070660_100039293 | Ga0070660_1000392933 | 449 |
| 192 | 3300005563 | Ga0068855_100128533 | Ga0068855_1001285333 | 449 |
| 193 | 3300005577 | Ga0068857_100005113 | Ga0068857_10000511311 | 449 |
| 194 | 3300005614 | Ga0068856_100000887 | Ga0068856_10000088722 | 449 |
| 195 | 3300005937 | Ga0081455_10009064 | Ga0081455_100090649 | 449 |
| 196 | 3300009551 | Ga0105238_10048705 | Ga0105238_100487053 | 449 |
| 197 | 3300010375 | Ga0105239_10024610 | Ga0105239_100246103 | 449 |
| 198 | 3300025230 | Ga0209563_100005 | Ga0209563_100005907 | 449 |
| 199 | 3300025246 | Ga0209646_1000060 | Ga0209646_100006023 | 449 |
| 200 | 3300025250 | Ga0209026_1000049 | Ga0209026_100004921 | 449 |
| 201 | 3300025253 | Ga0209677_101222 | Ga0209677_10122212 | 449 |
| 202 | 3300025256 | Ga0209759_1000069 | Ga0209759_100006921 | 449 |
| 203 | 3300025913 | Ga0207695_10095269 | Ga0207695_100952693 | 449 |
| 204 | 3300025924 | Ga0207694_10051432 | Ga0207694_100514322 | 449 |
| 205 | 3300025942 | Ga0207689_10014953 | Ga0207689_100149535 | 449 |
| 206 | 3300025981 | Ga0207640_10093351 | Ga0207640_100933512 | 449 |
| 207 | 3300026078 | Ga0207702_10002045 | Ga0207702_100020453 | 449 |
| 208 | 3300026116 | Ga0207674_10028490 | Ga0207674_100284903 | 449 |
| 209 | 3300028666 | Ga0265336_10000123 | Ga0265336_1000012331 | 449 |
| 210 | 3300029957 | Ga0265324_10000932 | Ga0265324_100009324 | 449 |
| 211 | 3300031649 | Ga0307514_10001826 | Ga0307514_1000182614 | 449 |
| 212 | 3300053153 | Ga0500616_0000030 | Ga0500616_0000030_137493_138851 | 449 |
| 213 | iso_pu_bacteria | 2599185214 | 2599626816 | 449 |
| 214 | iso_pu_bacteria | 2599185226 | 2599676062 | 449 |
| 215 | iso_pu_bacteria | 2599185227 | 2599684353 | 449 |
| 216 | iso_pu_bacteria | 2599185229 | 2599696367 | 449 |
| 217 | iso_pu_bacteria | 2643221585 | 2643934029 | 449 |
| 218 | iso_pu_bacteria | 2643221656 | 2644315516 | 449 |
| 219 | iso_pu_bacteria | 2818991446 | 2819601893 | 449 |
| 220 | iso_pu_bacteria | 2885198086 | 2885199950 | 449 |
| 221 | iso_pu_bacteria | 2885211737 | 2885213529 | 449 |
| 222 | iso_pu_bacteria | 2928037797 | 2928039803 | 449 |
| 223 | iso_pu_bacteria | 2928044640 | 2928047448 | 449 |
| 224 | iso_pu_bacteria | 2928051484 | 2928058577 | 449 |
| 225 | iso_pu_bacteria | 2928064002 | 2928070379 | 449 |
| 226 | iso_pu_bacteria | 2928070936 | 2928072846 | 449 |
| 227 | iso_pu_bacteria | 2954767861 | 2954769348 | 449 |
| 228 | 3300006051 | Ga0075364_10046443 | Ga0075364_100464432 | 450 |
| 229 | 3300044684 | Ga0466966_0002819 | Ga0466966_0002819_2756_4126 | 450 |
| 230 | 3300044706 | Ga0466964_0001494 | Ga0466964_0001494_6268_7638 | 450 |
| 231 | 3300044765 | Ga0466970_0052420 | Ga0466970_0052420_793_2163 | 450 |
| 232 | 3300044842 | Ga0466957_0003346 | Ga0466957_0003346_6315_7685 | 450 |
| 233 | 3300061719 | Ga0466962_0003967 | Ga0466962_0003967_5436_6806 | 450 |
| 234 | 3300025256 | Ga0209759_1001428 | Ga0209759_10014283 | 451 |
| 235 | iso_pu_bacteria | 2899924645 | 2899926469 | 451 |
| 236 | 3300005548 | Ga0070665_100029141 | Ga0070665_1000291414 | 452 |
| 237 | 3300046471 | Ga0495650_0041262 | Ga0495650_0041262_86_1447 | 452 |
| 238 | iso_pu_bacteria | 2831265667 | 2831269474 | 452 |
| 239 | iso_pu_bacteria | 2838054893 | 2838060960 | 452 |
| 240 | 3300002987 | JGI25159J45721_1002044 | JGI25159J45721_10020443 | 453 |
| 241 | 3300003187 | JGI25151J46595_10002148 | JGI25151J46595_1000214813 | 453 |
| 242 | 3300003215 | JGI25153J46596_10001619 | JGI25153J46596_100016194 | 453 |
| 243 | 3300003374 | JGI25161J50226_1002036 | JGI25161J50226_10020363 | 453 |
| 244 | 3300003773 | Ga0055537_1000915 | Ga0055537_100091513 | 453 |
| 245 | 3300003784 | Ga0055534_1001009 | Ga0055534_100100913 | 453 |
| 246 | 3300003790 | Ga0055528_1001308 | Ga0055528_100130815 | 453 |
| 247 | 3300003792 | Ga0055540_1010323 | Ga0055540_10103231 | 453 |
| 248 | 3300025208 | Ga0209436_104069 | Ga0209436_1040692 | 453 |
| 249 | 3300025245 | Ga0207425_1000518 | Ga0207425_100051815 | 453 |
| 250 | 3300025258 | Ga0209129_1000601 | Ga0209129_100060113 | 453 |
| 251 | 3300025263 | Ga0209565_1000248 | Ga0209565_100024817 | 453 |
| 252 | 3300025273 | Ga0209673_1000681 | Ga0209673_100068116 | 453 |
| 253 | 3300025284 | Ga0209130_1000218 | Ga0209130_10002184 | 453 |
| 254 | 3300025291 | Ga0209675_1000673 | Ga0209675_100067327 | 453 |
| 255 | 3300025294 | Ga0209025_1001205 | Ga0209025_100120515 | 453 |
| 256 | 3300025295 | Ga0209564_1000226 | Ga0209564_10002266 | 453 |
| 257 | 3300025297 | Ga0209758_1000142 | Ga0209758_100014244 | 453 |
| 258 | 3300025299 | Ga0209256_1000114 | Ga0209256_100011444 | 453 |
| 259 | 3300025302 | Ga0207426_1000162 | Ga0207426_100016243 | 453 |
| 260 | 3300025303 | Ga0209051_1009583 | Ga0209051_10095833 | 453 |
| 261 | 3300025304 | Ga0209257_1003943 | Ga0209257_10039433 | 453 |
| 262 | 3300001989 | JGI24739J22299_10016709 | JGI24739J22299_100167092 | 456 |
| 263 | 3300003578 | Ga0006562J51391_1097944 | Ga0006562J51391_10979441 | 456 |
| 264 | 3300003791 | Ga0055530_10000386 | Ga0055530_100003865 | 456 |
| 265 | 3300003792 | Ga0055540_1003175 | Ga0055540_10031753 | 456 |
| 266 | 3300025263 | Ga0209565_1002762 | Ga0209565_10027623 | 456 |
| 267 | 3300025273 | Ga0209673_1000377 | Ga0209673_100037711 | 456 |
| 268 | 3300025284 | Ga0209130_1000614 | Ga0209130_100061413 | 456 |
| 269 | 3300025291 | Ga0209675_1001146 | Ga0209675_10011463 | 456 |
| 270 | 3300025292 | Ga0209676_1000202 | Ga0209676_100020247 | 456 |
| 271 | 3300025295 | Ga0209564_1000223 | Ga0209564_1000223127 | 456 |
| 272 | 3300025298 | Ga0209050_1000224 | Ga0209050_10002245 | 456 |
| 273 | 3300025299 | Ga0209256_1000174 | Ga0209256_1000174127 | 456 |
| 274 | 3300025302 | Ga0207426_1000232 | Ga0207426_1000232127 | 456 |
| 275 | 3300025303 | Ga0209051_1000497 | Ga0209051_100049717 | 456 |
| 276 | 3300025304 | Ga0209257_1000163 | Ga0209257_1000163127 | 456 |
| 277 | 3300048921 | Ga0496118_0013124 | Ga0496118_0013124_3276_4646 | 456 |
| 278 | 3300048927 | Ga0496124_0034458 | Ga0496124_0034458_2438_3808 | 456 |
| 279 | 3300050496 | nmdc:mga07m45_88428_c1 | nmdc:mga07m45_88428_c1_309_1694 | 456 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7b2p-assembly1.cif.gz_B | cryo-em structure of complement c4b in complex with nanobody b5 | 0.8339 | 67 | 171 |
| 7b2q-assembly1.cif.gz_B | cryo-em structure of complement c4b in complex with nanobody b12 | 0.8196 | 67 | 169 |
| 4ziu-assembly1.cif.gz_A | crystal structure of native alpha-2-macroglobulin from escherichia coli spanning the residues from domain mg7 to the c-terminus. | 0.8164 | 65 | 171 |
| 7ad7-assembly1.cif.gz_A | crystal structure of human complement c5 in complex with the k8 bovine knob domain peptide. | 0.8125 | 67 | 171 |
| 5jpm-assembly2.cif.gz_E | structure of the complex of human complement c4 with masp-2 rebuilt using imdff | 0.8067 | 67 | 169 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O69661_282_440_3.40.50.410 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain | 0.9126 | 312 | 455 | 3.40.50.410 |
| af_Q4D1A2_978_1070_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8305 | 67 | 150 | 2.60.40.10 |
| af_O69661_282_440_3.40.50.410 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain | 0.8264 | 312 | 455 | 3.40.50.410 |
| 5jpmE03 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8067 | 67 | 169 | 2.60.40.10 |
| af_Q9Y2L5_605_1435_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8016 | 67 | 171 | 2.60.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q6C3W4-F1-model_v4 | DUF58 domain-containing protein | 0.9486 | 291 | 455 |
|
| AF-A0A657PNA0-F1-model_v4 | DUF58 domain-containing protein | 0.947 | 265 | 455 |
|
| AF-A0A4Q6C3W4-F1-model_v4 | DUF58 domain-containing protein | 0.9266 | 291 | 455 |
|
| AF-A0A355JUK6-F1-model_v4 | deleted | 0.9262 | 234 | 455 |
|
| AF-A0A0Q0AMQ4-F1-model_v4 | DUF58 domain-containing protein | 0.9257 | 239 | 455 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar