F382801

General Info

Members Datasets Scaffolds Average Seq Length
279 201 255 439

Family's Representative Sequence

Representative Sequence 3300003752|Ga0055539_1000588|Ga0055539_10005883
Length 478
Sequence VARLLLPARRTVYAVAAIAALLAAKWRDLANVPVATVGTSLAGALAALFVADVAMTLSQLRRHPIVFERQMPSAFALGQPHGLTVTLAHEGEQPWTLELFDHVPATMTQRLLPARVVLPARSRLDVRYEITPTQRGKVVFAPAAIRVRSRLGLADLQLRVGESQDVHVYPNFAALSRYAWLAGDRRLAEIGIKTYAARGAGTDFKQLGEYVPGMPTRHIDWNASMRHRRPVVREFQDDRDQSVVFLLDCGRRMRADEGPPLAGYREQPPKGARGLAPERPSAAAAGSRIGGSHFDQALNAAMLLAYVALKDGDAVGALTFGHDASEQRHFAPAKGMAALNTLVARLHDIEPSPTHSDYLAAARDLMLRVRRRSLIVVLTNFRDEDCEELEDALKLMRTRHLVLLASLREGVVAEIAAQPLDEPRDIVDVASAHWFENARAEAFRRLAGKNQLLVDTEPEHLPAALVNRYHAVKRARLL

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2643221585 Pelomonas sp. Root662 Isolate Unclassified
9 2643221656 Pelomonas sp. Root405 Isolate Unclassified
10 2643221672 Variovorax sp. Root434 Isolate Unclassified
11 2738541337 Pelomonas sp. BT06 Isolate Unclassified
12 2818991446 Variovorax sp. 1180 Isolate Unclassified
13 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
14 2831864461 Roseateles noduli HZ7 Isolate Nodule
15 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
16 2885198086 Variovorax sp. 679 Isolate Unclassified
17 2885211737 Variovorax sp. 553 Isolate Unclassified
18 2899924645 Variovorax sp. 369 Isolate Unclassified
19 2928037797 Variovorax sp. 1126 Isolate Unclassified
20 2928044640 Variovorax sp. 1128 Isolate Unclassified
21 2928051484 Variovorax sp. 1133 Isolate Unclassified
22 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
23 2928070936 Variovorax gossypii 1167 Isolate Unclassified
24 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
25 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
26 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
27 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
28 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
29 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
30 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
31 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
32 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
33 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
34 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
35 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
36 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
37 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
38 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
39 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
40 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
41 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
42 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
43 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
46 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
47 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
48 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
49 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
87 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
100 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
103 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
104 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
140 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
143 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
144 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
168 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
169 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
174 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
186 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
187 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
188 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
189 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
190 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
191 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
192 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
193 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
194 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
195 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
196 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
199 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
200 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.04
Metatranscriptomes 0.36
Isolates 8.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 37.63
Nodule 0.72
Rhizoplane 1.43
Rhizosphere 46.59
Stem 0
Stem Tuber 0
Unclassified 13.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10016709 3300001989 Bacteria 2652
2 JGI25156J39149_1000459 3300002705 Bacteria 24817
3 JGI25154J39366_1002135 3300002738 Bacteria 5531
4 JGI25157J39369_1000021 3300002741 Bacteria 163907
5 JGI25159J45721_1002044 3300002987 Bacteria 7985
6 JGI25151J46595_10002148 3300003187 Bacteria 12247
7 JGI25151J46595_10002546 3300003187 Bacteria 10815
8 JGI25151J46595_10018393 3300003187 Bacteria 3002
9 JGI25153J46596_10001619 3300003215 Bacteria 13360
10 rootH2_10000408 3300003320 Bacteria 2761
11 rootH1_10038643 3300003323 Bacteria 2572
12 JGI25161J50226_1002036 3300003374 Bacteria 5502
13 Ga0006562J51391_1097944 3300003578 Bacteria 4380
14 Ga0055539_1000588 3300003752 Bacteria 10143
15 Ga0055533_1000033 3300003756 Bacteria 265716
16 Ga0055525_1000046 3300003759 Bacteria 261587
17 Ga0055525_1002619 3300003759 Bacteria 1769
18 Ga0055535_1000192 3300003761 Bacteria 64814
19 Ga0055542_1000058 3300003762 Bacteria 162781
20 Ga0055537_1000915 3300003773 Bacteria 13891
21 Ga0055534_1001009 3300003784 Bacteria 12390
22 Ga0055528_1001308 3300003790 Bacteria 15606
23 Ga0055530_10000386 3300003791 Bacteria 39620
24 Ga0055540_1001280 3300003792 Bacteria 15303
25 Ga0055540_1003175 3300003792 Bacteria 8109
26 Ga0055540_1010323 3300003792 Bacteria 3118
27 Ga0055531_10000137 3300003794 Bacteria 83343
28 Ga0055531_10001780 3300003794 Bacteria 15303
29 Ga0055543_1001865 3300004625 Bacteria 7673
30 Ga0065165_1000273 3300005262 Bacteria 87879
31 Ga0065165_1005611 3300005262 Bacteria 6951
32 Ga0070682_100043770 3300005337 Bacteria 2769
33 Ga0070660_100039293 3300005339 Bacteria 3596
34 Ga0070660_100099541 3300005339 Bacteria 2302
35 Ga0070659_100143809 3300005366 Bacteria 1942
36 Ga0070667_100100994 3300005367 Bacteria 2491
37 Ga0070663_100074954 3300005455 Bacteria 2472
38 Ga0070662_100059449 3300005457 Bacteria 2784
39 Ga0068867_100160230 3300005459 Bacteria 1774
40 Ga0070679_100067313 3300005530 Bacteria 3572
41 Ga0068853_100125466 3300005539 Bacteria 2293
42 Ga0070672_100019174 3300005543 Bacteria 4961
43 Ga0070665_100002851 3300005548 Bacteria 18704
44 Ga0070665_100029141 3300005548 Bacteria 5556
45 Ga0068855_100009405 3300005563 Bacteria 11802
46 Ga0068855_100088579 3300005563 Bacteria 3575
47 Ga0068855_100128533 3300005563 Bacteria 2895
48 Ga0070664_100004106 3300005564 Bacteria 11696
49 Ga0068857_100005113 3300005577 Bacteria 11156
50 Ga0068857_100010135 3300005577 Bacteria 8189
51 Ga0068857_100045636 3300005577 Bacteria 3889
52 Ga0068856_100000887 3300005614 Bacteria 32039
53 Ga0068856_100107840 3300005614 Bacteria 2781
54 Ga0068859_100141693 3300005617 Bacteria 2478
55 Ga0068851_10019995 3300005834 Bacteria 3239
56 Ga0068858_100001882 3300005842 Bacteria 21432
57 Ga0068860_100013493 3300005843 Bacteria 8011
58 Ga0068862_100032277 3300005844 Bacteria 4424
59 Ga0081455_10009064 3300005937 Bacteria 10266
60 Ga0075365_10046615 3300006038 Bacteria 2847
61 Ga0075364_10008823 3300006051 Bacteria 6033
62 Ga0075364_10046443 3300006051 Bacteria 2828
63 Ga0075367_10030097 3300006178 Bacteria 3110
64 Ga0075366_10013680 3300006195 Bacteria 4626
65 Ga0075370_10001295 3300006353 Bacteria 10687
66 Ga0075370_10020001 3300006353 Bacteria 3651
67 Ga0097620_100141690 3300006931 Bacteria 2478
68 Ga0105244_10004022 3300009036 Bacteria 10269
69 Ga0105237_10011120 3300009545 Bacteria 9541
70 Ga0105237_10021474 3300009545 Bacteria 6636
71 Ga0105237_10094924 3300009545 Bacteria 2971
72 Ga0105238_10048705 3300009551 Bacteria 4269
73 Ga0105239_10024610 3300010375 Bacteria 6632
74 Ga0105239_10030789 3300010375 Bacteria 5902
75 Ga0105239_10079930 3300010375 Bacteria 3598
76 Ga0157371_10041745 3300013102 Bacteria 3272
77 Ga0157369_10006986 3300013105 Bacteria 13022
78 Ga0157369_10082661 3300013105 Unclassified 3436
79 Ga0157375_10013989 3300013308 Bacteria 7155
80 Ga0163163_10032224 3300014325 Bacteria 5062
81 Ga0182008_10005126 3300014497 Bacteria 7520
82 Ga0157379_10063964 3300014968 Bacteria 3288
83 Ga0157379_10122665 3300014968 Bacteria 2338
84 Ga0182006_1001206 3300015261 Bacteria 16155
85 Ga0182007_10001393 3300015262 Bacteria 13006
86 Ga0163161_10029173 3300017792 Bacteria 3922
87 Ga0213872_10000161 3300021361 Bacteria 61406
88 Ga0213872_10000177 3300021361 Bacteria 56798
89 Ga0209436_104069 3300025208 Bacteria 3689
90 Ga0209674_100064 3300025226 Bacteria 265769
91 Ga0209672_100539 3300025228 Bacteria 20575
92 Ga0209147_102021 3300025229 Bacteria 5849
93 Ga0209563_100005 3300025230 Bacteria 1774893
94 Ga0209563_100126 3300025230 Bacteria 113122
95 Ga0207427_100197 3300025231 Bacteria 57629
96 Ga0209258_100147 3300025242 Bacteria 162823
97 Ga0209258_100905 3300025242 Bacteria 15234
98 Ga0207425_1000518 3300025245 Bacteria 23516
99 Ga0207425_1002887 3300025245 Bacteria 5767
100 Ga0209646_1000060 3300025246 Bacteria 256386
101 Ga0209026_1000049 3300025250 Bacteria 255273
102 Ga0209677_100411 3300025253 Bacteria 25661
103 Ga0209677_100792 3300025253 Bacteria 15906
104 Ga0209677_101222 3300025253 Bacteria 11674
105 Ga0209148_1000122 3300025254 Bacteria 186071
106 Ga0209759_1000069 3300025256 Bacteria 182437
107 Ga0209759_1001428 3300025256 Bacteria 13546
108 Ga0209129_1000601 3300025258 Bacteria 24463
109 Ga0209129_1003026 3300025258 Bacteria 7634
110 Ga0209565_1000248 3300025263 Bacteria 57592
111 Ga0209565_1002762 3300025263 Bacteria 6088
112 Ga0209673_1000377 3300025273 Bacteria 80360
113 Ga0209673_1000681 3300025273 Bacteria 48925
114 Ga0209130_1000218 3300025284 Bacteria 75339
115 Ga0209130_1000614 3300025284 Bacteria 34072
116 Ga0209675_1000673 3300025291 Bacteria 23959
117 Ga0209675_1001146 3300025291 Bacteria 16153
118 Ga0209676_1000202 3300025292 Bacteria 133078
119 Ga0209676_1002009 3300025292 Bacteria 16042
120 Ga0209025_1000285 3300025294 Bacteria 114575
121 Ga0209025_1001205 3300025294 Bacteria 36303
122 Ga0209025_1006058 3300025294 Bacteria 9563
123 Ga0209025_1009354 3300025294 Bacteria 6850
124 Ga0209564_1000223 3300025295 Bacteria 128117
125 Ga0209564_1000226 3300025295 Bacteria 125693
126 Ga0209564_1002033 3300025295 Bacteria 17545
127 Ga0209758_1000142 3300025297 Bacteria 171779
128 Ga0209758_1015195 3300025297 Bacteria 4012
129 Ga0209050_1000224 3300025298 Bacteria 125433
130 Ga0209050_1001384 3300025298 Bacteria 26424
131 Ga0209050_1002324 3300025298 Bacteria 16727
132 Ga0209256_1000114 3300025299 Bacteria 173999
133 Ga0209256_1000174 3300025299 Bacteria 128117
134 Ga0207426_1000162 3300025302 Bacteria 172643
135 Ga0207426_1000232 3300025302 Bacteria 128117
136 Ga0209051_1000112 3300025303 Bacteria 152667
137 Ga0209051_1000497 3300025303 Bacteria 50521
138 Ga0209051_1009583 3300025303 Bacteria 4977
139 Ga0209257_1000131 3300025304 Bacteria 211464
140 Ga0209257_1000163 3300025304 Bacteria 175355
141 Ga0209257_1000290 3300025304 Bacteria 110826
142 Ga0209257_1003943 3300025304 Bacteria 12048
143 Ga0209257_1005851 3300025304 Bacteria 8329
144 Ga0207656_10001974 3300025321 Bacteria 6834
145 Ga0207695_10045326 3300025913 Bacteria 4669
146 Ga0207695_10095269 3300025913 Bacteria 2981
147 Ga0207671_10031503 3300025914 Bacteria 3951
148 Ga0207671_10077831 3300025914 Bacteria 2483
149 Ga0207671_10120531 3300025914 Bacteria 2005
150 Ga0207657_10171297 3300025919 Bacteria 1758
151 Ga0207649_10111711 3300025920 Bacteria 1827
152 Ga0207694_10051432 3300025924 Bacteria 3193
153 Ga0207687_10046026 3300025927 Bacteria 3018
154 Ga0207690_10078739 3300025932 Bacteria 2295
155 Ga0207706_10009725 3300025933 Bacteria 8826
156 Ga0207709_10000752 3300025935 Bacteria 25630
157 Ga0207709_10105779 3300025935 Bacteria 1871
158 Ga0207691_10004083 3300025940 Bacteria 14165
159 Ga0207689_10014953 3300025942 Bacteria 6585
160 Ga0207661_10023415 3300025944 Bacteria 4666
161 Ga0207679_10042833 3300025945 Bacteria 3256
162 Ga0207667_10001779 3300025949 Bacteria 27124
163 Ga0207667_10024063 3300025949 Bacteria 6697
164 Ga0207667_10115020 3300025949 Bacteria 2773
165 Ga0207640_10093351 3300025981 Bacteria 2090
166 Ga0207639_10020646 3300026041 Bacteria 4718
167 Ga0207678_10096152 3300026067 Bacteria 2531
168 Ga0207702_10002045 3300026078 Bacteria 19536
169 Ga0207674_10024723 3300026116 Bacteria 6411
170 Ga0207674_10028490 3300026116 Bacteria 5895
171 Ga0207674_10097346 3300026116 Bacteria 2926
172 Ga0207698_10060085 3300026142 Bacteria 2954
173 Ga0207698_10072350 3300026142 Bacteria 2740
174 Ga0268266_10001345 3300028379 Bacteria 29695
175 Ga0265334_10038109 3300028573 Unclassified 1893
176 Ga0265336_10000123 3300028666 Bacteria 57956
177 Ga0307515_10012310 3300028794 Bacteria 16098
178 Ga0307515_10157365 3300028794 Bacteria 2337
179 Ga0265324_10000932 3300029957 Bacteria 18361
180 Ga0265331_10002087 3300031250 Bacteria 13819
181 Ga0265331_10003807 3300031250 Bacteria 9570
182 Ga0265327_10000028 3300031251 Bacteria 361066
183 Ga0307408_100038561 3300031548 Bacteria 3372
184 Ga0307514_10001826 3300031649 Bacteria 23651
185 Ga0307516_10000383 3300031730 Bacteria 57684
186 Ga0373931_0003056 3300035691 Bacteria 7481
187 Ga0395905_0041251 3300037471 Bacteria 4331
188 Ga0395901_0030872 3300038443 Bacteria 5522
189 Ga0395901_0318285 3300038443 Bacteria 1610
190 Ga0436365_1025357 3300039437 Bacteria 3236
191 Ga0436361_0481133 3300039447 Bacteria 61506
192 Ga0436361_0521796 3300039447 Bacteria 35201
193 Ga0466969_0000028 3300044656 Bacteria 92394
194 Ga0466966_0002819 3300044684 Bacteria 11437
195 Ga0466966_0011741 3300044684 Bacteria 5807
196 Ga0466966_0012032 3300044684 Bacteria 5734
197 Ga0466961_0002399 3300044693 Bacteria 11641
198 Ga0466961_0049817 3300044693 Bacteria 2676
199 Ga0466963_0062303 3300044694 Bacteria 2495
200 Ga0466964_0001494 3300044706 Bacteria 8019
201 Ga0466970_0052420 3300044765 Bacteria 2177
202 Ga0466957_0003346 3300044842 Bacteria 8788
203 Ga0466959_0007818 3300045049 Bacteria 7525
204 Ga0466959_0079307 3300045049 Bacteria 2367
205 Ga0466959_0088259 3300045049 Bacteria 2229
206 Ga0466958_0103773 3300045836 Bacteria 1770
207 Ga0495650_0011619 3300046471 Bacteria 4807
208 Ga0495650_0041262 3300046471 Bacteria 1975
209 Ga0495585_0047699 3300046492 Bacteria 2385
210 Ga0495583_0000046 3300046506 Bacteria 218059
211 Ga0495606_0001300 3300046507 Bacteria 34419
212 Ga0495610_0027445 3300046512 Bacteria 3025
213 Ga0495631_0000405 3300046518 Bacteria 29764
214 Ga0495654_0002419 3300046530 Bacteria 12027
215 Ga0495609_0034038 3300046538 Bacteria 2311
216 Ga0495625_0016534 3300046660 Bacteria 5802
217 Ga0495658_0048779 3300046683 Bacteria 2389
218 Ga0495649_0000638 3300046694 Bacteria 28526
219 Ga0495593_0003378 3300047673 Bacteria 9561
220 Ga0495614_0025112 3300048089 Bacteria 2571
221 Ga0496104_0036079 3300048907 Bacteria 4619
222 Ga0496116_0006960 3300048919 Bacteria 10135
223 Ga0496117_0015463 3300048920 Bacteria 6505
224 Ga0496118_0006317 3300048921 Bacteria 13093
225 Ga0496118_0013124 3300048921 Bacteria 7867
226 Ga0496121_0067524 3300048924 Bacteria 2897
227 Ga0496122_0131826 3300048925 Bacteria 1586
228 Ga0496124_0009873 3300048927 Bacteria 9762
229 Ga0496124_0034458 3300048927 Bacteria 4443
230 Ga0496125_0005801 3300048928 Bacteria 13563
231 Ga0496125_0060278 3300048928 Bacteria 3052
232 Ga0496126_0001393 3300048929 Bacteria 38278
233 nmdc:mga00v17_4355_c1 3300050491 Bacteria 7354
234 nmdc:mga0yw44_41851_c1 3300050492 Bacteria 2729
235 nmdc:mga07m45_24671_c1 3300050496 Bacteria 3295
236 nmdc:mga07m45_37052_c1 3300050496 Bacteria 2720
237 nmdc:mga07m45_88428_c1 3300050496 Bacteria 1773
238 nmdc:mga0sz30_54942_c1 3300050516 Bacteria 1694
239 Ga0500635_0000005 3300053080 Bacteria 187821
240 Ga0500635_0005447 3300053080 Bacteria 3339
241 Ga0500643_010133 3300053087 Bacteria 3536
242 Ga0500651_0000217 3300053093 Bacteria 36081
243 Ga0500641_0009126 3300053096 Bacteria 3557
244 Ga0500571_000292 3300053110 Bacteria 19509
245 Ga0500608_037641 3300053122 Bacteria 2311
246 Ga0500655_000917 3300053133 Bacteria 5705
247 Ga0500658_0000686 3300053134 Bacteria 13986
248 Ga0500658_0000800 3300053134 Bacteria 13026
249 Ga0500568_0002984 3300053139 Bacteria 9677
250 Ga0500616_0000030 3300053153 Bacteria 415224
251 Ga0500634_0022626 3300053161 Bacteria 3412
252 Ga0500638_000750 3300053162 Bacteria 8813
253 Ga0500636_0016393 3300053177 Bacteria 4370
254 Ga0500636_0038433 3300053177 Bacteria 2831
255 Ga0466962_0003967 3300061719 Bacteria 7084

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039447 Ga0436361_0481133 Ga0436361_0481133_23132_24502 387
2 3300021361 Ga0213872_10000161 Ga0213872_1000016140 391
3 3300025304 Ga0209257_1005851 Ga0209257_10058515 391
4 3300044684 Ga0466966_0011741 Ga0466966_0011741_4105_5466 392
5 3300044693 Ga0466961_0002399 Ga0466961_0002399_4959_6320 392
6 3300045049 Ga0466959_0007818 Ga0466959_0007818_2068_3429 392
7 3300003794 Ga0055531_10000137 Ga0055531_1000013772 397
8 3300025298 Ga0209050_1001384 Ga0209050_100138419 397
9 3300025304 Ga0209257_1000131 Ga0209257_100013158 397
10 3300005337 Ga0070682_100043770 Ga0070682_1000437702 398
11 3300021361 Ga0213872_10000177 Ga0213872_1000017739 399
12 3300039447 Ga0436361_0521796 Ga0436361_0521796_13050_14396 399
13 3300028794 Ga0307515_10012310 Ga0307515_1001231015 401
14 3300028794 Ga0307515_10157365 Ga0307515_101573652 401
15 3300005455 Ga0070663_100074954 Ga0070663_1000749542 403
16 3300026067 Ga0207678_10096152 Ga0207678_100961522 403
17 3300048919 Ga0496116_0006960 Ga0496116_0006960_4117_5478 403
18 3300048920 Ga0496117_0015463 Ga0496117_0015463_2086_3447 403
19 3300048921 Ga0496118_0006317 Ga0496118_0006317_6343_7704 403
20 3300003761 Ga0055535_1000192 Ga0055535_10001924 404
21 3300003762 Ga0055542_1000058 Ga0055542_100005847 404
22 3300003792 Ga0055540_1001280 Ga0055540_100128013 404
23 3300003794 Ga0055531_10001780 Ga0055531_100017805 404
24 3300025228 Ga0209672_100539 Ga0209672_10053921 404
25 3300025229 Ga0209147_102021 Ga0209147_1020212 404
26 3300025242 Ga0209258_100147 Ga0209258_100147108 404
27 3300025254 Ga0209148_1000122 Ga0209148_100012247 404
28 3300025292 Ga0209676_1002009 Ga0209676_10020095 404
29 3300025298 Ga0209050_1002324 Ga0209050_100232415 404
30 3300025303 Ga0209051_1000112 Ga0209051_100011299 404
31 3300025304 Ga0209257_1000290 Ga0209257_100029038 404
32 3300026116 Ga0207674_10097346 Ga0207674_100973462 404
33 3300005614 Ga0068856_100107840 Ga0068856_1001078403 406
34 3300025935 Ga0207709_10105779 Ga0207709_101057793 406
35 3300031250 Ga0265331_10002087 Ga0265331_100020873 407
36 3300031251 Ga0265327_10000028 Ga0265327_10000028247 407
37 3300005367 Ga0070667_100100994 Ga0070667_1001009942 411
38 3300005543 Ga0070672_100019174 Ga0070672_1000191743 411
39 3300005617 Ga0068859_100141693 Ga0068859_1001416932 411
40 3300005842 Ga0068858_100001882 Ga0068858_1000018824 411
41 3300005843 Ga0068860_100013493 Ga0068860_1000134935 411
42 3300006931 Ga0097620_100141690 Ga0097620_1001416902 411
43 3300013308 Ga0157375_10013989 Ga0157375_100139894 411
44 3300014968 Ga0157379_10122665 Ga0157379_101226652 411
45 3300025940 Ga0207691_10004083 Ga0207691_100040832 411
46 3300005262 Ga0065165_1000273 Ga0065165_100027380 415
47 3300009545 Ga0105237_10021474 Ga0105237_100214744 415
48 3300013105 Ga0157369_10006986 Ga0157369_100069864 415
49 3300048907 Ga0496104_0036079 Ga0496104_0036079_1238_2701 416
50 3300005530 Ga0070679_100067313 Ga0070679_1000673132 417
51 3300025944 Ga0207661_10023415 Ga0207661_100234152 417
52 3300037471 Ga0395905_0041251 Ga0395905_0041251_1525_2874 417
53 3300039437 Ga0436365_1025357 Ga0436365_1025357_1538_2890 417
54 3300053134 Ga0500658_0000800 Ga0500658_0000800_3269_4633 417
55 3300005563 Ga0068855_100088579 Ga0068855_1000885793 418
56 3300025949 Ga0207667_10115020 Ga0207667_101150203 418
57 3300005563 Ga0068855_100009405 Ga0068855_1000094059 419
58 3300025949 Ga0207667_10024063 Ga0207667_100240633 419
59 3300005459 Ga0068867_100160230 Ga0068867_1001602301 420
60 3300045836 Ga0466958_0103773 Ga0466958_0103773_304_1677 420
61 3300025914 Ga0207671_10077831 Ga0207671_100778311 421
62 3300004625 Ga0055543_1001865 Ga0055543_10018652 422
63 3300005262 Ga0065165_1005611 Ga0065165_10056113 422
64 3300005457 Ga0070662_100059449 Ga0070662_1000594492 422
65 3300005539 Ga0068853_100125466 Ga0068853_1001254662 422
66 3300005564 Ga0070664_100004106 Ga0070664_1000041063 422
67 3300005577 Ga0068857_100045636 Ga0068857_1000456364 422
68 3300006353 Ga0075370_10020001 Ga0075370_100200013 422
69 3300009036 Ga0105244_10004022 Ga0105244_100040224 422
70 3300014497 Ga0182008_10005126 Ga0182008_100051261 422
71 3300015261 Ga0182006_1001206 Ga0182006_10012064 422
72 3300015262 Ga0182007_10001393 Ga0182007_100013934 422
73 3300025919 Ga0207657_10171297 Ga0207657_101712972 422
74 3300025920 Ga0207649_10111711 Ga0207649_101117112 422
75 3300025927 Ga0207687_10046026 Ga0207687_100460262 422
76 3300025933 Ga0207706_10009725 Ga0207706_100097252 422
77 3300025935 Ga0207709_10000752 Ga0207709_1000075218 422
78 3300025945 Ga0207679_10042833 Ga0207679_100428332 422
79 3300026041 Ga0207639_10020646 Ga0207639_100206462 422
80 3300026142 Ga0207698_10072350 Ga0207698_100723502 422
81 3300048927 Ga0496124_0009873 Ga0496124_0009873_7437_8798 422
82 3300048928 Ga0496125_0005801 Ga0496125_0005801_9415_10776 422
83 3300050496 nmdc:mga07m45_37052_c1 nmdc:mga07m45_37052_c1_1277_2638 422
84 3300028573 Ga0265334_10038109 Ga0265334_100381092 424
85 3300031250 Ga0265331_10003807 Ga0265331_100038073 424
86 3300046694 Ga0495649_0000638 Ga0495649_0000638_23579_25042 425
87 3300005548 Ga0070665_100002851 Ga0070665_10000285119 427
88 3300009545 Ga0105237_10011120 Ga0105237_100111202 427
89 3300010375 Ga0105239_10079930 Ga0105239_100799303 427
90 3300014325 Ga0163163_10032224 Ga0163163_100322242 427
91 3300025914 Ga0207671_10120531 Ga0207671_101205312 427
92 3300028379 Ga0268266_10001345 Ga0268266_100013451 427
93 3300045049 Ga0466959_0088259 Ga0466959_0088259_406_1776 429
94 3300013105 Ga0157369_10082661 Ga0157369_100826614 430
95 3300031548 Ga0307408_100038561 Ga0307408_1000385612 430
96 3300038443 Ga0395901_0318285 Ga0395901_0318285_59_1420 432
97 3300046471 Ga0495650_0011619 Ga0495650_0011619_2571_3923 432
98 3300048929 Ga0496126_0001393 Ga0496126_0001393_24532_25890 433
99 3300053087 Ga0500643_010133 Ga0500643_010133_1999_3363 433
100 3300044656 Ga0466969_0000028 Ga0466969_0000028_24671_26047 434
101 3300044684 Ga0466966_0012032 Ga0466966_0012032_3615_4991 434
102 3300010375 Ga0105239_10030789 Ga0105239_100307894 435
103 3300013102 Ga0157371_10041745 Ga0157371_100417452 435
104 3300025253 Ga0209677_100792 Ga0209677_10079210 435
105 3300026142 Ga0207698_10060085 Ga0207698_100600852 435
106 3300046492 Ga0495585_0047699 Ga0495585_0047699_276_1658 435
107 3300046518 Ga0495631_0000405 Ga0495631_0000405_9911_11275 435
108 3300046683 Ga0495658_0048779 Ga0495658_0048779_611_1975 435
109 3300048925 Ga0496122_0131826 Ga0496122_0131826_97_1461 435
110 3300050496 nmdc:mga07m45_24671_c1 nmdc:mga07m45_24671_c1_1895_3256 436
111 3300017792 Ga0163161_10029173 Ga0163161_100291733 437
112 3300046512 Ga0495610_0027445 Ga0495610_0027445_1435_2799 437
113 3300046530 Ga0495654_0002419 Ga0495654_0002419_4346_5710 437
114 3300048089 Ga0495614_0025112 Ga0495614_0025112_226_1590 437
115 3300048924 Ga0496121_0067524 Ga0496121_0067524_1257_2621 437
116 3300048928 Ga0496125_0060278 Ga0496125_0060278_293_1657 437
117 3300053093 Ga0500651_0000217 Ga0500651_0000217_25581_26945 437
118 3300053134 Ga0500658_0000686 Ga0500658_0000686_8392_9756 437
119 3300053139 Ga0500568_0002984 Ga0500568_0002984_6873_8237 437
120 3300053161 Ga0500634_0022626 Ga0500634_0022626_1995_3359 437
121 3300035691 Ga0373931_0003056 Ga0373931_0003056_725_2095 438
122 3300044693 Ga0466961_0049817 Ga0466961_0049817_68_1444 438
123 3300044694 Ga0466963_0062303 Ga0466963_0062303_470_1858 438
124 3300045049 Ga0466959_0079307 Ga0466959_0079307_911_2287 438
125 3300047673 Ga0495593_0003378 Ga0495593_0003378_6869_8233 438
126 3300053110 Ga0500571_000292 Ga0500571_000292_206_1570 438
127 3300053133 Ga0500655_000917 Ga0500655_000917_240_1604 438
128 3300053162 Ga0500638_000750 Ga0500638_000750_6271_7635 438
129 3300053177 Ga0500636_0016393 Ga0500636_0016393_2770_4134 438
130 3300025231 Ga0207427_100197 Ga0207427_10019722 439
131 3300003323 rootH1_10038643 rootH1_100386433 441
132 3300005834 Ga0068851_10019995 Ga0068851_100199953 442
133 3300006038 Ga0075365_10046615 Ga0075365_100466153 442
134 3300025321 Ga0207656_10001974 Ga0207656_100019745 442
135 3300031730 Ga0307516_10000383 Ga0307516_1000038347 442
136 3300050492 nmdc:mga0yw44_41851_c1 nmdc:mga0yw44_41851_c1_692_2050 442
137 3300025294 Ga0209025_1009354 Ga0209025_10093546 443
138 3300025295 Ga0209564_1002033 Ga0209564_10020337 443
139 3300053096 Ga0500641_0009126 Ga0500641_0009126_1562_2929 443
140 3300006195 Ga0075366_10013680 Ga0075366_100136804 444
141 3300014968 Ga0157379_10063964 Ga0157379_100639643 444
142 3300025242 Ga0209258_100905 Ga0209258_10090515 444
143 3300025913 Ga0207695_10045326 Ga0207695_100453263 444
144 3300025949 Ga0207667_10001779 Ga0207667_1000177912 444
145 3300038443 Ga0395901_0030872 Ga0395901_0030872_497_1849 444
146 3300046506 Ga0495583_0000046 Ga0495583_0000046_192900_194252 444
147 3300046507 Ga0495606_0001300 Ga0495606_0001300_30686_32038 444
148 3300046660 Ga0495625_0016534 Ga0495625_0016534_550_1902 444
149 3300053080 Ga0500635_0000005 Ga0500635_0000005_47881_49233 444
150 3300053080 Ga0500635_0005447 Ga0500635_0005447_1227_2579 444
151 3300053177 Ga0500636_0038433 Ga0500636_0038433_1232_2584 444
152 iso_pu_bacteria 2585428057 2587726060 445
153 iso_pu_bacteria 2585428058 2587735790 445
154 3300003187 JGI25151J46595_10018393 JGI25151J46595_100183932 446
155 3300006051 Ga0075364_10008823 Ga0075364_100088232 446
156 3300025245 Ga0207425_1002887 Ga0207425_10028873 446
157 3300025294 Ga0209025_1006058 Ga0209025_10060583 446
158 3300025297 Ga0209758_1015195 Ga0209758_10151953 446
159 3300050491 nmdc:mga00v17_4355_c1 nmdc:mga00v17_4355_c1_1738_3108 446
160 3300003187 JGI25151J46595_10002546 JGI25151J46595_1000254611 447
161 3300005339 Ga0070660_100099541 Ga0070660_1000995412 447
162 3300005366 Ga0070659_100143809 Ga0070659_1001438092 447
163 3300005577 Ga0068857_100010135 Ga0068857_1000101357 447
164 3300005844 Ga0068862_100032277 Ga0068862_1000322772 447
165 3300006178 Ga0075367_10030097 Ga0075367_100300973 447
166 3300006353 Ga0075370_10001295 Ga0075370_100012959 447
167 3300009545 Ga0105237_10094924 Ga0105237_100949243 447
168 3300025258 Ga0209129_1003026 Ga0209129_10030267 447
169 3300025294 Ga0209025_1000285 Ga0209025_100028565 447
170 3300025914 Ga0207671_10031503 Ga0207671_100315033 447
171 3300025932 Ga0207690_10078739 Ga0207690_100787391 447
172 3300026116 Ga0207674_10024723 Ga0207674_100247235 447
173 3300046538 Ga0495609_0034038 Ga0495609_0034038_689_2050 447
174 3300050516 nmdc:mga0sz30_54942_c1 nmdc:mga0sz30_54942_c1_121_1476 447
175 3300053122 Ga0500608_037641 Ga0500608_037641_200_1561 447
176 3300003752 Ga0055539_1000588 Ga0055539_10005883 448
177 3300003756 Ga0055533_1000033 Ga0055533_100003322 448
178 3300003759 Ga0055525_1002619 Ga0055525_10026191 448
179 3300025226 Ga0209674_100064 Ga0209674_100064227 448
180 3300025230 Ga0209563_100126 Ga0209563_10012686 448
181 3300025253 Ga0209677_100411 Ga0209677_10041122 448
182 iso_pu_bacteria 2511231002 2511247325 448
183 iso_pu_bacteria 2643221672 2644398133 448
184 iso_pu_bacteria 2738541337 2739053263 448
185 iso_pu_bacteria 2831864461 2831866929 448
186 3300002705 JGI25156J39149_1000459 JGI25156J39149_100045921 449
187 3300002738 JGI25154J39366_1002135 JGI25154J39366_10021352 449
188 3300002741 JGI25157J39369_1000021 JGI25157J39369_1000021133 449
189 3300003320 rootH2_10000408 rootH2_100004082 449
190 3300003759 Ga0055525_1000046 Ga0055525_1000046170 449
191 3300005339 Ga0070660_100039293 Ga0070660_1000392933 449
192 3300005563 Ga0068855_100128533 Ga0068855_1001285333 449
193 3300005577 Ga0068857_100005113 Ga0068857_10000511311 449
194 3300005614 Ga0068856_100000887 Ga0068856_10000088722 449
195 3300005937 Ga0081455_10009064 Ga0081455_100090649 449
196 3300009551 Ga0105238_10048705 Ga0105238_100487053 449
197 3300010375 Ga0105239_10024610 Ga0105239_100246103 449
198 3300025230 Ga0209563_100005 Ga0209563_100005907 449
199 3300025246 Ga0209646_1000060 Ga0209646_100006023 449
200 3300025250 Ga0209026_1000049 Ga0209026_100004921 449
201 3300025253 Ga0209677_101222 Ga0209677_10122212 449
202 3300025256 Ga0209759_1000069 Ga0209759_100006921 449
203 3300025913 Ga0207695_10095269 Ga0207695_100952693 449
204 3300025924 Ga0207694_10051432 Ga0207694_100514322 449
205 3300025942 Ga0207689_10014953 Ga0207689_100149535 449
206 3300025981 Ga0207640_10093351 Ga0207640_100933512 449
207 3300026078 Ga0207702_10002045 Ga0207702_100020453 449
208 3300026116 Ga0207674_10028490 Ga0207674_100284903 449
209 3300028666 Ga0265336_10000123 Ga0265336_1000012331 449
210 3300029957 Ga0265324_10000932 Ga0265324_100009324 449
211 3300031649 Ga0307514_10001826 Ga0307514_1000182614 449
212 3300053153 Ga0500616_0000030 Ga0500616_0000030_137493_138851 449
213 iso_pu_bacteria 2599185214 2599626816 449
214 iso_pu_bacteria 2599185226 2599676062 449
215 iso_pu_bacteria 2599185227 2599684353 449
216 iso_pu_bacteria 2599185229 2599696367 449
217 iso_pu_bacteria 2643221585 2643934029 449
218 iso_pu_bacteria 2643221656 2644315516 449
219 iso_pu_bacteria 2818991446 2819601893 449
220 iso_pu_bacteria 2885198086 2885199950 449
221 iso_pu_bacteria 2885211737 2885213529 449
222 iso_pu_bacteria 2928037797 2928039803 449
223 iso_pu_bacteria 2928044640 2928047448 449
224 iso_pu_bacteria 2928051484 2928058577 449
225 iso_pu_bacteria 2928064002 2928070379 449
226 iso_pu_bacteria 2928070936 2928072846 449
227 iso_pu_bacteria 2954767861 2954769348 449
228 3300006051 Ga0075364_10046443 Ga0075364_100464432 450
229 3300044684 Ga0466966_0002819 Ga0466966_0002819_2756_4126 450
230 3300044706 Ga0466964_0001494 Ga0466964_0001494_6268_7638 450
231 3300044765 Ga0466970_0052420 Ga0466970_0052420_793_2163 450
232 3300044842 Ga0466957_0003346 Ga0466957_0003346_6315_7685 450
233 3300061719 Ga0466962_0003967 Ga0466962_0003967_5436_6806 450
234 3300025256 Ga0209759_1001428 Ga0209759_10014283 451
235 iso_pu_bacteria 2899924645 2899926469 451
236 3300005548 Ga0070665_100029141 Ga0070665_1000291414 452
237 3300046471 Ga0495650_0041262 Ga0495650_0041262_86_1447 452
238 iso_pu_bacteria 2831265667 2831269474 452
239 iso_pu_bacteria 2838054893 2838060960 452
240 3300002987 JGI25159J45721_1002044 JGI25159J45721_10020443 453
241 3300003187 JGI25151J46595_10002148 JGI25151J46595_1000214813 453
242 3300003215 JGI25153J46596_10001619 JGI25153J46596_100016194 453
243 3300003374 JGI25161J50226_1002036 JGI25161J50226_10020363 453
244 3300003773 Ga0055537_1000915 Ga0055537_100091513 453
245 3300003784 Ga0055534_1001009 Ga0055534_100100913 453
246 3300003790 Ga0055528_1001308 Ga0055528_100130815 453
247 3300003792 Ga0055540_1010323 Ga0055540_10103231 453
248 3300025208 Ga0209436_104069 Ga0209436_1040692 453
249 3300025245 Ga0207425_1000518 Ga0207425_100051815 453
250 3300025258 Ga0209129_1000601 Ga0209129_100060113 453
251 3300025263 Ga0209565_1000248 Ga0209565_100024817 453
252 3300025273 Ga0209673_1000681 Ga0209673_100068116 453
253 3300025284 Ga0209130_1000218 Ga0209130_10002184 453
254 3300025291 Ga0209675_1000673 Ga0209675_100067327 453
255 3300025294 Ga0209025_1001205 Ga0209025_100120515 453
256 3300025295 Ga0209564_1000226 Ga0209564_10002266 453
257 3300025297 Ga0209758_1000142 Ga0209758_100014244 453
258 3300025299 Ga0209256_1000114 Ga0209256_100011444 453
259 3300025302 Ga0207426_1000162 Ga0207426_100016243 453
260 3300025303 Ga0209051_1009583 Ga0209051_10095833 453
261 3300025304 Ga0209257_1003943 Ga0209257_10039433 453
262 3300001989 JGI24739J22299_10016709 JGI24739J22299_100167092 456
263 3300003578 Ga0006562J51391_1097944 Ga0006562J51391_10979441 456
264 3300003791 Ga0055530_10000386 Ga0055530_100003865 456
265 3300003792 Ga0055540_1003175 Ga0055540_10031753 456
266 3300025263 Ga0209565_1002762 Ga0209565_10027623 456
267 3300025273 Ga0209673_1000377 Ga0209673_100037711 456
268 3300025284 Ga0209130_1000614 Ga0209130_100061413 456
269 3300025291 Ga0209675_1001146 Ga0209675_10011463 456
270 3300025292 Ga0209676_1000202 Ga0209676_100020247 456
271 3300025295 Ga0209564_1000223 Ga0209564_1000223127 456
272 3300025298 Ga0209050_1000224 Ga0209050_10002245 456
273 3300025299 Ga0209256_1000174 Ga0209256_1000174127 456
274 3300025302 Ga0207426_1000232 Ga0207426_1000232127 456
275 3300025303 Ga0209051_1000497 Ga0209051_100049717 456
276 3300025304 Ga0209257_1000163 Ga0209257_1000163127 456
277 3300048921 Ga0496118_0013124 Ga0496118_0013124_3276_4646 456
278 3300048927 Ga0496124_0034458 Ga0496124_0034458_2438_3808 456
279 3300050496 nmdc:mga07m45_88428_c1 nmdc:mga07m45_88428_c1_309_1694 456

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01882

DUF58

Protein of unknown function DUF58

201

317

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b2p-assembly1.cif.gz_B cryo-em structure of complement c4b in complex with nanobody b5 0.8339 67 171
7b2q-assembly1.cif.gz_B cryo-em structure of complement c4b in complex with nanobody b12 0.8196 67 169
4ziu-assembly1.cif.gz_A crystal structure of native alpha-2-macroglobulin from escherichia coli spanning the residues from domain mg7 to the c-terminus. 0.8164 65 171
7ad7-assembly1.cif.gz_A crystal structure of human complement c5 in complex with the k8 bovine knob domain peptide. 0.8125 67 171
5jpm-assembly2.cif.gz_E structure of the complex of human complement c4 with masp-2 rebuilt using imdff 0.8067 67 169
ID Description Score Start End Superfamily
af_O69661_282_440_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.9126 312 455 3.40.50.410
af_Q4D1A2_978_1070_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8305 67 150 2.60.40.10
af_O69661_282_440_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8264 312 455 3.40.50.410
5jpmE03 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8067 67 169 2.60.40.10
af_Q9Y2L5_605_1435_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8016 67 171 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A4Q6C3W4-F1-model_v4 DUF58 domain-containing protein 0.9486 291 455
AF-A0A657PNA0-F1-model_v4 DUF58 domain-containing protein 0.947 265 455
AF-A0A4Q6C3W4-F1-model_v4 DUF58 domain-containing protein 0.9266 291 455
AF-A0A355JUK6-F1-model_v4 deleted 0.9262 234 455
AF-A0A0Q0AMQ4-F1-model_v4 DUF58 domain-containing protein 0.9257 239 455

Feature Viewer

pLDDT pTM Quality
82.25 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map