F382869
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 279 | 201 | 274 | 79 |
Family's Representative Sequence
| Representative Sequence | 3300005353|Ga0070669_101381296|Ga0070669_1013812962 |
| Length | 81 |
| Sequence | MAATVTLLYFASLRDTAGLDRETVASEAADLRALYAEVRARHGFVLPQEKLRVAVDGAFARWDAPLGDGSEIAFIPPVSGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 2 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 3 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 4 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 5 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 6 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 41 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 42 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 43 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 54 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 66 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 112 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 113 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 114 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 115 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 116 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 117 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 118 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 119 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 120 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 121 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 122 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 123 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 124 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 125 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 126 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 127 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 128 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 129 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 130 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 131 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 133 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 134 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 135 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 136 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 137 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 138 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 139 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 140 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 141 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 142 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 143 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 144 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 145 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 146 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 147 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 148 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 149 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 150 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 151 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 152 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 153 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 154 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 172 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 173 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 174 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 177 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 178 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 179 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 180 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 181 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 182 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 183 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 194 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 195 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 196 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 199 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 200 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 201 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.21 |
| Metatranscriptomes | 0 |
| Isolates | 1.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.53 |
| Nodule | 0 |
| Rhizoplane | 6.09 |
| Rhizosphere | 82.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055526_1065423 | 3300003771 | Bacteria | 757 |
| 2 | Ga0055524_1011066 | 3300003775 | Bacteria | 3548 |
| 3 | Ga0055524_1014164 | 3300003775 | Bacteria | 2970 |
| 4 | Ga0055531_10097881 | 3300003794 | Bacteria | 608 |
| 5 | Ga0065714_10091994 | 3300005288 | Bacteria | 1883 |
| 6 | Ga0070680_100235574 | 3300005336 | Bacteria | 1546 |
| 7 | Ga0070680_100698855 | 3300005336 | Bacteria | 872 |
| 8 | Ga0070660_101292570 | 3300005339 | Bacteria | 619 |
| 9 | Ga0070691_10199644 | 3300005341 | Bacteria | 1050 |
| 10 | Ga0070692_10771415 | 3300005345 | Bacteria | 654 |
| 11 | Ga0070668_100188470 | 3300005347 | Bacteria | 1688 |
| 12 | Ga0070669_101381296 | 3300005353 | Bacteria | 611 |
| 13 | Ga0070675_100295745 | 3300005354 | Bacteria | 1425 |
| 14 | Ga0070659_100277880 | 3300005366 | Bacteria | 1393 |
| 15 | Ga0070667_100290116 | 3300005367 | Bacteria | 1471 |
| 16 | Ga0070714_100027856 | 3300005435 | Bacteria | 4682 |
| 17 | Ga0070711_100537850 | 3300005439 | Bacteria | 968 |
| 18 | Ga0070678_100445127 | 3300005456 | Bacteria | 1134 |
| 19 | Ga0070681_10000007 | 3300005458 | Bacteria | 159821 |
| 20 | Ga0070681_10095162 | 3300005458 | Bacteria | 2927 |
| 21 | Ga0070681_10569447 | 3300005458 | Bacteria | 1046 |
| 22 | Ga0068867_100248422 | 3300005459 | Bacteria | 1446 |
| 23 | Ga0068867_100510584 | 3300005459 | Bacteria | 1035 |
| 24 | Ga0070679_100915459 | 3300005530 | Bacteria | 820 |
| 25 | Ga0068853_100006385 | 3300005539 | Bacteria | 9364 |
| 26 | Ga0070672_100004380 | 3300005543 | Bacteria | 9246 |
| 27 | Ga0070672_100010568 | 3300005543 | Bacteria | 6408 |
| 28 | Ga0070696_100112148 | 3300005546 | Bacteria | 1965 |
| 29 | Ga0070693_100007564 | 3300005547 | Bacteria | 5316 |
| 30 | Ga0070693_100308020 | 3300005547 | Bacteria | 1070 |
| 31 | Ga0070693_101194275 | 3300005547 | Bacteria | 584 |
| 32 | Ga0070665_100309634 | 3300005548 | Bacteria | 1583 |
| 33 | Ga0068855_100077870 | 3300005563 | Bacteria | 3847 |
| 34 | Ga0068855_100702714 | 3300005563 | Bacteria | 1082 |
| 35 | Ga0068855_101810135 | 3300005563 | Bacteria | 620 |
| 36 | Ga0068857_100091286 | 3300005577 | Bacteria | 2726 |
| 37 | Ga0068854_101763927 | 3300005578 | Bacteria | 567 |
| 38 | Ga0070702_100998986 | 3300005615 | Bacteria | 662 |
| 39 | Ga0068852_100120763 | 3300005616 | Bacteria | 2399 |
| 40 | Ga0068852_102014267 | 3300005616 | Bacteria | 599 |
| 41 | Ga0068859_100076536 | 3300005617 | Bacteria | 3387 |
| 42 | Ga0068859_101452708 | 3300005617 | Bacteria | 757 |
| 43 | Ga0068861_101087207 | 3300005719 | Bacteria | 768 |
| 44 | Ga0068863_100503415 | 3300005841 | Bacteria | 1193 |
| 45 | Ga0068860_100009878 | 3300005843 | Bacteria | 9461 |
| 46 | Ga0068862_101632388 | 3300005844 | Bacteria | 652 |
| 47 | Ga0081455_10259029 | 3300005937 | Bacteria | 1268 |
| 48 | Ga0075364_10057092 | 3300006051 | Bacteria | 2556 |
| 49 | Ga0075364_10060407 | 3300006051 | Bacteria | 2486 |
| 50 | Ga0075364_10350399 | 3300006051 | Bacteria | 1006 |
| 51 | Ga0068871_100115700 | 3300006358 | Bacteria | 2260 |
| 52 | Ga0068865_100001867 | 3300006881 | Bacteria | 12378 |
| 53 | Ga0097620_100076536 | 3300006931 | Bacteria | 3387 |
| 54 | Ga0097620_101452632 | 3300006931 | Bacteria | 757 |
| 55 | Ga0105240_10007745 | 3300009093 | Bacteria | 15536 |
| 56 | Ga0105240_10095359 | 3300009093 | Bacteria | 3627 |
| 57 | Ga0105240_11352357 | 3300009093 | Bacteria | 750 |
| 58 | Ga0105240_12555636 | 3300009093 | Bacteria | 528 |
| 59 | Ga0105245_10762446 | 3300009098 | Bacteria | 1004 |
| 60 | Ga0105245_12512095 | 3300009098 | Bacteria | 568 |
| 61 | Ga0105241_10060823 | 3300009174 | Bacteria | 2907 |
| 62 | Ga0105242_10001918 | 3300009176 | Bacteria | 16343 |
| 63 | Ga0105237_10016858 | 3300009545 | Bacteria | 7580 |
| 64 | Ga0105237_12496965 | 3300009545 | Bacteria | 527 |
| 65 | Ga0105238_10015784 | 3300009551 | Bacteria | 7645 |
| 66 | Ga0105238_10019466 | 3300009551 | Bacteria | 6912 |
| 67 | Ga0105249_10071549 | 3300009553 | Bacteria | 3204 |
| 68 | Ga0105239_10044931 | 3300010375 | Bacteria | 4842 |
| 69 | Ga0105239_10111889 | 3300010375 | Bacteria | 3027 |
| 70 | Ga0105239_12039930 | 3300010375 | Bacteria | 666 |
| 71 | Ga0157327_1008046 | 3300012512 | Bacteria | 935 |
| 72 | Ga0157326_1052637 | 3300012513 | Bacteria | 602 |
| 73 | Ga0157373_10188820 | 3300013100 | Bacteria | 1452 |
| 74 | Ga0157373_11564704 | 3300013100 | Bacteria | 504 |
| 75 | Ga0157371_11363739 | 3300013102 | Bacteria | 550 |
| 76 | Ga0157370_10064917 | 3300013104 | Bacteria | 3454 |
| 77 | Ga0157370_10352429 | 3300013104 | Bacteria | 1357 |
| 78 | Ga0157370_10780219 | 3300013104 | Bacteria | 870 |
| 79 | Ga0157369_10000195 | 3300013105 | Bacteria | 84688 |
| 80 | Ga0157374_10039767 | 3300013296 | Bacteria | 4329 |
| 81 | Ga0157374_10121405 | 3300013296 | Bacteria | 2522 |
| 82 | Ga0157378_10051445 | 3300013297 | Bacteria | 3666 |
| 83 | Ga0163162_10001959 | 3300013306 | Bacteria | 19333 |
| 84 | Ga0157372_10312351 | 3300013307 | Bacteria | 1830 |
| 85 | Ga0157372_11124253 | 3300013307 | Bacteria | 909 |
| 86 | Ga0157375_10000156 | 3300013308 | Bacteria | 66009 |
| 87 | Ga0157375_10031195 | 3300013308 | Bacteria | 5033 |
| 88 | Ga0157375_10609213 | 3300013308 | Bacteria | 1251 |
| 89 | Ga0157375_11687487 | 3300013308 | Bacteria | 750 |
| 90 | Ga0157380_10305645 | 3300014326 | Bacteria | 1467 |
| 91 | Ga0157380_10763895 | 3300014326 | Bacteria | 980 |
| 92 | Ga0182008_10600726 | 3300014497 | Bacteria | 617 |
| 93 | Ga0157376_10005014 | 3300014969 | Bacteria | 9237 |
| 94 | Ga0157376_10058312 | 3300014969 | Bacteria | 3233 |
| 95 | Ga0157376_10064239 | 3300014969 | Bacteria | 3095 |
| 96 | Ga0209673_1041574 | 3300025273 | Bacteria | 1303 |
| 97 | Ga0209675_1010033 | 3300025291 | Bacteria | 3276 |
| 98 | Ga0209676_1045786 | 3300025292 | Bacteria | 1188 |
| 99 | Ga0209025_1032876 | 3300025294 | Bacteria | 2413 |
| 100 | Ga0209564_1007666 | 3300025295 | Bacteria | 5512 |
| 101 | Ga0209256_1004843 | 3300025299 | Bacteria | 8141 |
| 102 | Ga0207426_1046584 | 3300025302 | Bacteria | 1312 |
| 103 | Ga0209257_1002276 | 3300025304 | Bacteria | 19574 |
| 104 | Ga0207699_10847374 | 3300025906 | Bacteria | 673 |
| 105 | Ga0207645_10187858 | 3300025907 | Bacteria | 1357 |
| 106 | Ga0207654_10228084 | 3300025911 | Bacteria | 1239 |
| 107 | Ga0207707_10011211 | 3300025912 | Bacteria | 7798 |
| 108 | Ga0207707_10481401 | 3300025912 | Bacteria | 1060 |
| 109 | Ga0207707_10640949 | 3300025912 | Bacteria | 896 |
| 110 | Ga0207695_10001746 | 3300025913 | Bacteria | 34535 |
| 111 | Ga0207695_10043274 | 3300025913 | Bacteria | 4800 |
| 112 | Ga0207671_10630873 | 3300025914 | Bacteria | 854 |
| 113 | Ga0207657_10816787 | 3300025919 | Bacteria | 720 |
| 114 | Ga0207652_11210125 | 3300025921 | Bacteria | 657 |
| 115 | Ga0207694_10000627 | 3300025924 | Bacteria | 32068 |
| 116 | Ga0207694_10048426 | 3300025924 | Bacteria | 3289 |
| 117 | Ga0207650_10770804 | 3300025925 | Bacteria | 814 |
| 118 | Ga0207687_11548880 | 3300025927 | Bacteria | 569 |
| 119 | Ga0207664_10185856 | 3300025929 | Bacteria | 1787 |
| 120 | Ga0207644_10012209 | 3300025931 | Bacteria | 5700 |
| 121 | Ga0207686_10023038 | 3300025934 | Bacteria | 3592 |
| 122 | Ga0207691_10004868 | 3300025940 | Bacteria | 12984 |
| 123 | Ga0207689_10047934 | 3300025942 | Bacteria | 3525 |
| 124 | Ga0207667_10117069 | 3300025949 | Bacteria | 2746 |
| 125 | Ga0207651_10112936 | 3300025960 | Bacteria | 2043 |
| 126 | Ga0207712_10221584 | 3300025961 | Bacteria | 1513 |
| 127 | Ga0207668_10038100 | 3300025972 | Bacteria | 3223 |
| 128 | Ga0207640_10847650 | 3300025981 | Bacteria | 795 |
| 129 | Ga0207639_10008534 | 3300026041 | Bacteria | 7031 |
| 130 | Ga0207678_10690227 | 3300026067 | Bacteria | 898 |
| 131 | Ga0207641_10310344 | 3300026088 | Bacteria | 1493 |
| 132 | Ga0207641_12002961 | 3300026088 | Bacteria | 580 |
| 133 | Ga0207648_10212788 | 3300026089 | Bacteria | 1716 |
| 134 | Ga0207648_10382181 | 3300026089 | Bacteria | 1273 |
| 135 | Ga0207674_10513434 | 3300026116 | Bacteria | 1157 |
| 136 | Ga0207674_11013202 | 3300026116 | Bacteria | 800 |
| 137 | Ga0207698_10021084 | 3300026142 | Bacteria | 4499 |
| 138 | Ga0207698_12127480 | 3300026142 | Bacteria | 574 |
| 139 | Ga0207698_12323798 | 3300026142 | Bacteria | 548 |
| 140 | Ga0209967_1018348 | 3300027364 | Bacteria | 1013 |
| 141 | Ga0209995_1006661 | 3300027471 | Bacteria | 1857 |
| 142 | Ga0209999_1000714 | 3300027543 | Bacteria | 5385 |
| 143 | Ga0209970_1006785 | 3300027614 | Bacteria | 1880 |
| 144 | Ga0209983_1000296 | 3300027665 | Bacteria | 10384 |
| 145 | Ga0209971_1013235 | 3300027682 | Bacteria | 1955 |
| 146 | Ga0209974_10008039 | 3300027876 | Bacteria | 3614 |
| 147 | Ga0268266_10060519 | 3300028379 | Bacteria | 3265 |
| 148 | Ga0268266_10338979 | 3300028379 | Bacteria | 1411 |
| 149 | Ga0268264_10005234 | 3300028381 | Bacteria | 10980 |
| 150 | Ga0316177_1191026 | 3300030731 | Bacteria | 2923 |
| 151 | Ga0314311_1031529 | 3300030733 | Bacteria | 1168 |
| 152 | Ga0316178_1182566 | 3300030735 | Bacteria | 744 |
| 153 | Ga0316180_1150849 | 3300030736 | Bacteria | 760 |
| 154 | Ga0316181_1286399 | 3300030744 | Bacteria | 1562 |
| 155 | Ga0307513_10015796 | 3300031456 | Bacteria | 9137 |
| 156 | Ga0307408_100288800 | 3300031548 | Bacteria | 1369 |
| 157 | Ga0307516_10047197 | 3300031730 | Bacteria | 4245 |
| 158 | Ga0307516_10978244 | 3300031730 | Bacteria | 517 |
| 159 | Ga0307405_11160375 | 3300031731 | Bacteria | 666 |
| 160 | Ga0307413_10022156 | 3300031824 | Bacteria | 3418 |
| 161 | Ga0307413_10438489 | 3300031824 | Bacteria | 1033 |
| 162 | Ga0307412_10748543 | 3300031911 | Bacteria | 843 |
| 163 | Ga0307409_101519682 | 3300031995 | Bacteria | 697 |
| 164 | Ga0307409_101745899 | 3300031995 | Bacteria | 651 |
| 165 | Ga0307416_103621864 | 3300032002 | Bacteria | 517 |
| 166 | Ga0307414_10000300 | 3300032004 | Bacteria | 28812 |
| 167 | Ga0307414_10240869 | 3300032004 | Bacteria | 1497 |
| 168 | Ga0307414_10498646 | 3300032004 | Bacteria | 1077 |
| 169 | Ga0307414_10599577 | 3300032004 | Bacteria | 988 |
| 170 | Ga0307414_11003919 | 3300032004 | Bacteria | 768 |
| 171 | Ga0307415_100561333 | 3300032126 | Bacteria | 1009 |
| 172 | Ga0307415_101456351 | 3300032126 | Bacteria | 654 |
| 173 | Ga0373934_0338898 | 3300035086 | Bacteria | 625 |
| 174 | Ga0373944_0108141 | 3300035089 | Bacteria | 946 |
| 175 | Ga0373936_0299300 | 3300035113 | Bacteria | 726 |
| 176 | Ga0373935_0923989 | 3300035692 | Bacteria | 647 |
| 177 | Ga0373937_0752623 | 3300036401 | Bacteria | 922 |
| 178 | Ga0373925_1208454 | 3300037068 | Bacteria | 621 |
| 179 | Ga0395899_0097343 | 3300037312 | Bacteria | 2127 |
| 180 | Ga0395900_0000175 | 3300037418 | Bacteria | 102937 |
| 181 | Ga0395900_0056989 | 3300037418 | Bacteria | 4022 |
| 182 | Ga0395900_0295913 | 3300037418 | Bacteria | 1606 |
| 183 | Ga0395900_0894211 | 3300037418 | Bacteria | 812 |
| 184 | Ga0395898_0086681 | 3300037466 | Bacteria | 3017 |
| 185 | Ga0395898_0436242 | 3300037466 | Bacteria | 1248 |
| 186 | Ga0395905_0000630 | 3300037471 | Bacteria | 47216 |
| 187 | Ga0395905_0133704 | 3300037471 | Bacteria | 2333 |
| 188 | Ga0395901_0131268 | 3300038443 | Bacteria | 2632 |
| 189 | Ga0395901_0816971 | 3300038443 | Bacteria | 920 |
| 190 | Ga0395901_1681284 | 3300038443 | Bacteria | 586 |
| 191 | Ga0439436_0025738 | 3300041404 | Bacteria | 1727 |
| 192 | Ga0439436_0028700 | 3300041404 | Bacteria | 1623 |
| 193 | Ga0439439_0135389 | 3300041406 | Bacteria | 693 |
| 194 | Ga0439465_0000297 | 3300041413 | Bacteria | 14018 |
| 195 | Ga0451800_0340878 | 3300041459 | Bacteria | 596 |
| 196 | Ga0451800_1617507 | 3300041459 | Bacteria | 878 |
| 197 | Ga0451807_0371901 | 3300041486 | Bacteria | 555 |
| 198 | Ga0451807_0693854 | 3300041486 | Bacteria | 1094 |
| 199 | Ga0451837_0374541 | 3300041494 | Bacteria | 981 |
| 200 | Ga0451837_0990016 | 3300041494 | Bacteria | 1015 |
| 201 | Ga0451837_1098651 | 3300041494 | Bacteria | 964 |
| 202 | Ga0451843_1009909 | 3300041509 | Bacteria | 628 |
| 203 | Ga0439431_0032445 | 3300041997 | Bacteria | 1302 |
| 204 | Ga0439445_0114526 | 3300042004 | Bacteria | 771 |
| 205 | Ga0439445_0115690 | 3300042004 | Bacteria | 767 |
| 206 | Ga0439432_020431 | 3300042006 | Bacteria | 2201 |
| 207 | Ga0439432_043098 | 3300042006 | Bacteria | 1425 |
| 208 | Ga0439432_060999 | 3300042006 | Bacteria | 1163 |
| 209 | Ga0439449_0000045 | 3300042007 | Bacteria | 38264 |
| 210 | Ga0439449_0087864 | 3300042007 | Bacteria | 1147 |
| 211 | Ga0439449_0136835 | 3300042007 | Bacteria | 911 |
| 212 | Ga0450909_068498 | 3300042185 | Bacteria | 566 |
| 213 | Ga0451577_0044594 | 3300042876 | Bacteria | 3970 |
| 214 | Ga0453683_0124980 | 3300044673 | Bacteria | 1620 |
| 215 | Ga0453684_0385725 | 3300044712 | Bacteria | 1572 |
| 216 | Ga0466957_0337028 | 3300044842 | Bacteria | 1021 |
| 217 | Ga0466967_1166120 | 3300045976 | Bacteria | 768 |
| 218 | Ga0495638_0202337 | 3300046460 | Bacteria | 1120 |
| 219 | Ga0495580_0778901 | 3300046472 | Bacteria | 621 |
| 220 | Ga0495582_0105451 | 3300046473 | Bacteria | 1580 |
| 221 | Ga0495639_0129997 | 3300046475 | Bacteria | 1205 |
| 222 | Ga0495662_0197428 | 3300046476 | Bacteria | 992 |
| 223 | Ga0495664_0299904 | 3300046477 | Bacteria | 970 |
| 224 | Ga0495643_0377531 | 3300046522 | Bacteria | 629 |
| 225 | Ga0495652_0532772 | 3300046529 | Bacteria | 810 |
| 226 | Ga0495654_0158372 | 3300046530 | Bacteria | 996 |
| 227 | Ga0495645_0473111 | 3300046543 | Bacteria | 787 |
| 228 | Ga0495656_0000843 | 3300046615 | Bacteria | 9891 |
| 229 | Ga0495647_0032619 | 3300046681 | Bacteria | 1942 |
| 230 | Ga0495658_0028701 | 3300046683 | Bacteria | 3005 |
| 231 | Ga0495613_0460975 | 3300046689 | Bacteria | 860 |
| 232 | Ga0495636_0003708 | 3300047318 | Bacteria | 5942 |
| 233 | Ga0496100_0187620 | 3300048903 | Bacteria | 1499 |
| 234 | Ga0496100_1035426 | 3300048903 | Bacteria | 646 |
| 235 | Ga0496101_1310068 | 3300048904 | Bacteria | 566 |
| 236 | Ga0496103_0079268 | 3300048906 | Bacteria | 2063 |
| 237 | Ga0496104_0000011 | 3300048907 | Bacteria | 459358 |
| 238 | Ga0496105_0000015 | 3300048908 | Bacteria | 218758 |
| 239 | Ga0496105_0618869 | 3300048908 | Bacteria | 839 |
| 240 | Ga0496108_0013046 | 3300048911 | Bacteria | 6772 |
| 241 | Ga0496109_0554441 | 3300048912 | Bacteria | 1084 |
| 242 | Ga0496109_0611698 | 3300048912 | Bacteria | 1026 |
| 243 | Ga0496112_0049966 | 3300048915 | Bacteria | 4099 |
| 244 | Ga0496113_0015849 | 3300048916 | Bacteria | 5194 |
| 245 | Ga0496115_0000065 | 3300048918 | Bacteria | 98148 |
| 246 | Ga0496118_0027212 | 3300048921 | Bacteria | 4846 |
| 247 | Ga0496126_0000185 | 3300048929 | Bacteria | 140051 |
| 248 | Ga0501290_000954 | 3300049513 | Bacteria | 4184 |
| 249 | Ga0501300_020371 | 3300049523 | Bacteria | 968 |
| 250 | Ga0501031_0066151 | 3300049568 | Bacteria | 2355 |
| 251 | Ga0501032_0047295 | 3300049569 | Bacteria | 2905 |
| 252 | Ga0501032_0085984 | 3300049569 | Bacteria | 2090 |
| 253 | Ga0501033_0250148 | 3300049570 | Bacteria | 1256 |
| 254 | Ga0501034_0517432 | 3300049571 | Bacteria | 1105 |
| 255 | Ga0501036_1346133 | 3300049572 | Bacteria | 580 |
| 256 | Ga0501037_0309975 | 3300049573 | Bacteria | 1094 |
| 257 | Ga0501039_0059402 | 3300049575 | Bacteria | 2962 |
| 258 | Ga0501043_0001953 | 3300049579 | Bacteria | 17638 |
| 259 | Ga0501043_0032273 | 3300049579 | Bacteria | 4117 |
| 260 | Ga0501047_0230843 | 3300049581 | Bacteria | 1704 |
| 261 | Ga0501070_0408149 | 3300049586 | Bacteria | 1098 |
| 262 | Ga0501070_1113888 | 3300049586 | Bacteria | 608 |
| 263 | Ga0501225_0003691 | 3300049705 | Bacteria | 4608 |
| 264 | Ga0501265_000288 | 3300049762 | Bacteria | 5166 |
| 265 | Ga0501276_026751 | 3300049773 | Bacteria | 583 |
| 266 | Ga0501035_0078536 | 3300049822 | Bacteria | 2915 |
| 267 | Ga0501044_0100640 | 3300049823 | Bacteria | 2908 |
| 268 | Ga0501044_1331394 | 3300049823 | Bacteria | 584 |
| 269 | nmdc:mga00v17_230224_c1 | 3300050491 | Bacteria | 1201 |
| 270 | nmdc:mga00v17_248665_c1 | 3300050491 | Bacteria | 1153 |
| 271 | nmdc:mga00v17_484369_c1 | 3300050491 | Bacteria | 802 |
| 272 | Ga0500597_279175 | 3300053120 | Bacteria | 674 |
| 273 | Ga0500614_143850 | 3300053123 | Bacteria | 715 |
| 274 | Ga0500637_0407442 | 3300053178 | Bacteria | 704 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031995 | Ga0307409_101745899 | Ga0307409_1017458992 | 68 |
| 2 | 3300026142 | Ga0207698_12323798 | Ga0207698_123237981 | 73 |
| 3 | 3300005563 | Ga0068855_100077870 | Ga0068855_1000778705 | 74 |
| 4 | 3300025925 | Ga0207650_10770804 | Ga0207650_107708042 | 74 |
| 5 | iso_pu_bacteria | 2895522137 | 2895524377 | 75 |
| 6 | iso_pu_bacteria | 2895525241 | 2895526474 | 75 |
| 7 | iso_pu_bacteria | 2643221695 | 2644529919 | 76 |
| 8 | iso_pu_bacteria | 2895498888 | 2895502527 | 76 |
| 9 | iso_pu_bacteria | 2895511927 | 2895514144 | 76 |
| 10 | 3300012513 | Ga0157326_1052637 | Ga0157326_10526372 | 77 |
| 11 | 3300005336 | Ga0070680_100235574 | Ga0070680_1002355742 | 78 |
| 12 | 3300005336 | Ga0070680_100698855 | Ga0070680_1006988552 | 78 |
| 13 | 3300005339 | Ga0070660_101292570 | Ga0070660_1012925701 | 78 |
| 14 | 3300005341 | Ga0070691_10199644 | Ga0070691_101996442 | 78 |
| 15 | 3300005345 | Ga0070692_10771415 | Ga0070692_107714151 | 78 |
| 16 | 3300005354 | Ga0070675_100295745 | Ga0070675_1002957453 | 78 |
| 17 | 3300005366 | Ga0070659_100277880 | Ga0070659_1002778802 | 78 |
| 18 | 3300005367 | Ga0070667_100290116 | Ga0070667_1002901163 | 78 |
| 19 | 3300005439 | Ga0070711_100537850 | Ga0070711_1005378502 | 78 |
| 20 | 3300005456 | Ga0070678_100445127 | Ga0070678_1004451272 | 78 |
| 21 | 3300005458 | Ga0070681_10000007 | Ga0070681_1000000745 | 78 |
| 22 | 3300005458 | Ga0070681_10095162 | Ga0070681_100951623 | 78 |
| 23 | 3300005458 | Ga0070681_10569447 | Ga0070681_105694472 | 78 |
| 24 | 3300005459 | Ga0068867_100248422 | Ga0068867_1002484223 | 78 |
| 25 | 3300005459 | Ga0068867_100510584 | Ga0068867_1005105842 | 78 |
| 26 | 3300005530 | Ga0070679_100915459 | Ga0070679_1009154592 | 78 |
| 27 | 3300005539 | Ga0068853_100006385 | Ga0068853_1000063859 | 78 |
| 28 | 3300005543 | Ga0070672_100004380 | Ga0070672_1000043803 | 78 |
| 29 | 3300005543 | Ga0070672_100010568 | Ga0070672_1000105684 | 78 |
| 30 | 3300005546 | Ga0070696_100112148 | Ga0070696_1001121482 | 78 |
| 31 | 3300005547 | Ga0070693_100007564 | Ga0070693_1000075644 | 78 |
| 32 | 3300005547 | Ga0070693_100308020 | Ga0070693_1003080203 | 78 |
| 33 | 3300005547 | Ga0070693_101194275 | Ga0070693_1011942752 | 78 |
| 34 | 3300005548 | Ga0070665_100309634 | Ga0070665_1003096343 | 78 |
| 35 | 3300005563 | Ga0068855_100702714 | Ga0068855_1007027142 | 78 |
| 36 | 3300005563 | Ga0068855_101810135 | Ga0068855_1018101352 | 78 |
| 37 | 3300005577 | Ga0068857_100091286 | Ga0068857_1000912862 | 78 |
| 38 | 3300005578 | Ga0068854_101763927 | Ga0068854_1017639272 | 78 |
| 39 | 3300005615 | Ga0070702_100998986 | Ga0070702_1009989862 | 78 |
| 40 | 3300005616 | Ga0068852_100120763 | Ga0068852_1001207633 | 78 |
| 41 | 3300005616 | Ga0068852_102014267 | Ga0068852_1020142672 | 78 |
| 42 | 3300005617 | Ga0068859_100076536 | Ga0068859_1000765364 | 78 |
| 43 | 3300005617 | Ga0068859_101452708 | Ga0068859_1014527082 | 78 |
| 44 | 3300005719 | Ga0068861_101087207 | Ga0068861_1010872072 | 78 |
| 45 | 3300005841 | Ga0068863_100503415 | Ga0068863_1005034152 | 78 |
| 46 | 3300005843 | Ga0068860_100009878 | Ga0068860_1000098788 | 78 |
| 47 | 3300006358 | Ga0068871_100115700 | Ga0068871_1001157003 | 78 |
| 48 | 3300006881 | Ga0068865_100001867 | Ga0068865_1000018672 | 78 |
| 49 | 3300006931 | Ga0097620_100076536 | Ga0097620_1000765363 | 78 |
| 50 | 3300006931 | Ga0097620_101452632 | Ga0097620_1014526322 | 78 |
| 51 | 3300009093 | Ga0105240_10007745 | Ga0105240_1000774518 | 78 |
| 52 | 3300009093 | Ga0105240_10095359 | Ga0105240_100953593 | 78 |
| 53 | 3300009093 | Ga0105240_12555636 | Ga0105240_125556362 | 78 |
| 54 | 3300009098 | Ga0105245_10762446 | Ga0105245_107624463 | 78 |
| 55 | 3300009098 | Ga0105245_12512095 | Ga0105245_125120952 | 78 |
| 56 | 3300009174 | Ga0105241_10060823 | Ga0105241_100608232 | 78 |
| 57 | 3300009176 | Ga0105242_10001918 | Ga0105242_1000191816 | 78 |
| 58 | 3300009545 | Ga0105237_10016858 | Ga0105237_100168583 | 78 |
| 59 | 3300009545 | Ga0105237_12496965 | Ga0105237_124969652 | 78 |
| 60 | 3300009551 | Ga0105238_10015784 | Ga0105238_100157843 | 78 |
| 61 | 3300009551 | Ga0105238_10019466 | Ga0105238_100194665 | 78 |
| 62 | 3300009553 | Ga0105249_10071549 | Ga0105249_100715494 | 78 |
| 63 | 3300010375 | Ga0105239_10044931 | Ga0105239_100449313 | 78 |
| 64 | 3300010375 | Ga0105239_10111889 | Ga0105239_101118893 | 78 |
| 65 | 3300010375 | Ga0105239_12039930 | Ga0105239_120399302 | 78 |
| 66 | 3300012512 | Ga0157327_1008046 | Ga0157327_10080461 | 78 |
| 67 | 3300013100 | Ga0157373_10188820 | Ga0157373_101888201 | 78 |
| 68 | 3300013100 | Ga0157373_11564704 | Ga0157373_115647042 | 78 |
| 69 | 3300013104 | Ga0157370_10064917 | Ga0157370_100649174 | 78 |
| 70 | 3300013104 | Ga0157370_10352429 | Ga0157370_103524293 | 78 |
| 71 | 3300013105 | Ga0157369_10000195 | Ga0157369_100001953 | 78 |
| 72 | 3300013296 | Ga0157374_10039767 | Ga0157374_100397673 | 78 |
| 73 | 3300013296 | Ga0157374_10121405 | Ga0157374_101214053 | 78 |
| 74 | 3300013297 | Ga0157378_10051445 | Ga0157378_100514454 | 78 |
| 75 | 3300013306 | Ga0163162_10001959 | Ga0163162_100019595 | 78 |
| 76 | 3300013307 | Ga0157372_10312351 | Ga0157372_103123512 | 78 |
| 77 | 3300013308 | Ga0157375_10000156 | Ga0157375_1000015632 | 78 |
| 78 | 3300013308 | Ga0157375_10031195 | Ga0157375_100311953 | 78 |
| 79 | 3300013308 | Ga0157375_10609213 | Ga0157375_106092132 | 78 |
| 80 | 3300014326 | Ga0157380_10763895 | Ga0157380_107638952 | 78 |
| 81 | 3300014497 | Ga0182008_10600726 | Ga0182008_106007262 | 78 |
| 82 | 3300014969 | Ga0157376_10005014 | Ga0157376_100050144 | 78 |
| 83 | 3300014969 | Ga0157376_10058312 | Ga0157376_100583123 | 78 |
| 84 | 3300014969 | Ga0157376_10064239 | Ga0157376_100642393 | 78 |
| 85 | 3300025906 | Ga0207699_10847374 | Ga0207699_108473742 | 78 |
| 86 | 3300025907 | Ga0207645_10187858 | Ga0207645_101878582 | 78 |
| 87 | 3300025911 | Ga0207654_10228084 | Ga0207654_102280842 | 78 |
| 88 | 3300025912 | Ga0207707_10011211 | Ga0207707_1001121112 | 78 |
| 89 | 3300025912 | Ga0207707_10481401 | Ga0207707_104814012 | 78 |
| 90 | 3300025912 | Ga0207707_10640949 | Ga0207707_106409492 | 78 |
| 91 | 3300025913 | Ga0207695_10001746 | Ga0207695_1000174636 | 78 |
| 92 | 3300025913 | Ga0207695_10043274 | Ga0207695_100432746 | 78 |
| 93 | 3300025914 | Ga0207671_10630873 | Ga0207671_106308732 | 78 |
| 94 | 3300025919 | Ga0207657_10816787 | Ga0207657_108167872 | 78 |
| 95 | 3300025921 | Ga0207652_11210125 | Ga0207652_112101252 | 78 |
| 96 | 3300025924 | Ga0207694_10000627 | Ga0207694_1000062712 | 78 |
| 97 | 3300025924 | Ga0207694_10048426 | Ga0207694_100484264 | 78 |
| 98 | 3300025927 | Ga0207687_11548880 | Ga0207687_115488802 | 78 |
| 99 | 3300025934 | Ga0207686_10023038 | Ga0207686_100230385 | 78 |
| 100 | 3300025940 | Ga0207691_10004868 | Ga0207691_100048688 | 78 |
| 101 | 3300025942 | Ga0207689_10047934 | Ga0207689_100479343 | 78 |
| 102 | 3300025949 | Ga0207667_10117069 | Ga0207667_101170693 | 78 |
| 103 | 3300025960 | Ga0207651_10112936 | Ga0207651_101129362 | 78 |
| 104 | 3300025961 | Ga0207712_10221584 | Ga0207712_102215842 | 78 |
| 105 | 3300025981 | Ga0207640_10847650 | Ga0207640_108476502 | 78 |
| 106 | 3300026041 | Ga0207639_10008534 | Ga0207639_100085344 | 78 |
| 107 | 3300026067 | Ga0207678_10690227 | Ga0207678_106902272 | 78 |
| 108 | 3300026088 | Ga0207641_10310344 | Ga0207641_103103444 | 78 |
| 109 | 3300026088 | Ga0207641_12002961 | Ga0207641_120029611 | 78 |
| 110 | 3300026089 | Ga0207648_10212788 | Ga0207648_102127883 | 78 |
| 111 | 3300026089 | Ga0207648_10382181 | Ga0207648_103821812 | 78 |
| 112 | 3300026116 | Ga0207674_10513434 | Ga0207674_105134342 | 78 |
| 113 | 3300026116 | Ga0207674_11013202 | Ga0207674_110132022 | 78 |
| 114 | 3300026142 | Ga0207698_10021084 | Ga0207698_100210844 | 78 |
| 115 | 3300026142 | Ga0207698_12127480 | Ga0207698_121274802 | 78 |
| 116 | 3300027364 | Ga0209967_1018348 | Ga0209967_10183482 | 78 |
| 117 | 3300027471 | Ga0209995_1006661 | Ga0209995_10066612 | 78 |
| 118 | 3300027543 | Ga0209999_1000714 | Ga0209999_10007144 | 78 |
| 119 | 3300027614 | Ga0209970_1006785 | Ga0209970_10067852 | 78 |
| 120 | 3300027665 | Ga0209983_1000296 | Ga0209983_100029615 | 78 |
| 121 | 3300027682 | Ga0209971_1013235 | Ga0209971_10132353 | 78 |
| 122 | 3300027876 | Ga0209974_10008039 | Ga0209974_100080395 | 78 |
| 123 | 3300028379 | Ga0268266_10060519 | Ga0268266_100605192 | 78 |
| 124 | 3300028379 | Ga0268266_10338979 | Ga0268266_103389792 | 78 |
| 125 | 3300028381 | Ga0268264_10005234 | Ga0268264_100052344 | 78 |
| 126 | 3300031548 | Ga0307408_100288800 | Ga0307408_1002888002 | 78 |
| 127 | 3300031730 | Ga0307516_10047197 | Ga0307516_100471973 | 78 |
| 128 | 3300031730 | Ga0307516_10978244 | Ga0307516_109782442 | 78 |
| 129 | 3300031731 | Ga0307405_11160375 | Ga0307405_111603752 | 78 |
| 130 | 3300032004 | Ga0307414_10599577 | Ga0307414_105995772 | 78 |
| 131 | 3300032126 | Ga0307415_100561333 | Ga0307415_1005613332 | 78 |
| 132 | 3300032126 | Ga0307415_101456351 | Ga0307415_1014563512 | 78 |
| 133 | 3300035086 | Ga0373934_0338898 | Ga0373934_0338898_117_356 | 78 |
| 134 | 3300035089 | Ga0373944_0108141 | Ga0373944_0108141_419_658 | 78 |
| 135 | 3300035113 | Ga0373936_0299300 | Ga0373936_0299300_443_682 | 78 |
| 136 | 3300035692 | Ga0373935_0923989 | Ga0373935_0923989_257_496 | 78 |
| 137 | 3300036401 | Ga0373937_0752623 | Ga0373937_0752623_269_508 | 78 |
| 138 | 3300037068 | Ga0373925_1208454 | Ga0373925_1208454_247_486 | 78 |
| 139 | 3300037418 | Ga0395900_0000175 | Ga0395900_0000175_45616_45855 | 78 |
| 140 | 3300037418 | Ga0395900_0295913 | Ga0395900_0295913_661_900 | 78 |
| 141 | 3300037466 | Ga0395898_0086681 | Ga0395898_0086681_788_1027 | 78 |
| 142 | 3300041459 | Ga0451800_0340878 | Ga0451800_0340878_109_345 | 78 |
| 143 | 3300041486 | Ga0451807_0693854 | Ga0451807_0693854_490_729 | 78 |
| 144 | 3300044673 | Ga0453683_0124980 | Ga0453683_0124980_640_876 | 78 |
| 145 | 3300044842 | Ga0466957_0337028 | Ga0466957_0337028_55_294 | 78 |
| 146 | 3300045976 | Ga0466967_1166120 | Ga0466967_1166120_10_249 | 78 |
| 147 | 3300046472 | Ga0495580_0778901 | Ga0495580_0778901_361_600 | 78 |
| 148 | 3300046473 | Ga0495582_0105451 | Ga0495582_0105451_413_652 | 78 |
| 149 | 3300046475 | Ga0495639_0129997 | Ga0495639_0129997_601_840 | 78 |
| 150 | 3300046476 | Ga0495662_0197428 | Ga0495662_0197428_332_571 | 78 |
| 151 | 3300046477 | Ga0495664_0299904 | Ga0495664_0299904_200_439 | 78 |
| 152 | 3300046529 | Ga0495652_0532772 | Ga0495652_0532772_128_367 | 78 |
| 153 | 3300046530 | Ga0495654_0158372 | Ga0495654_0158372_333_569 | 78 |
| 154 | 3300046543 | Ga0495645_0473111 | Ga0495645_0473111_388_627 | 78 |
| 155 | 3300046681 | Ga0495647_0032619 | Ga0495647_0032619_112_351 | 78 |
| 156 | 3300046683 | Ga0495658_0028701 | Ga0495658_0028701_1394_1633 | 78 |
| 157 | 3300046689 | Ga0495613_0460975 | Ga0495613_0460975_302_541 | 78 |
| 158 | 3300048906 | Ga0496103_0079268 | Ga0496103_0079268_308_547 | 78 |
| 159 | 3300048907 | Ga0496104_0000011 | Ga0496104_0000011_316663_316902 | 78 |
| 160 | 3300048908 | Ga0496105_0000015 | Ga0496105_0000015_202940_203179 | 78 |
| 161 | 3300048918 | Ga0496115_0000065 | Ga0496115_0000065_92672_92911 | 78 |
| 162 | 3300048921 | Ga0496118_0027212 | Ga0496118_0027212_871_1110 | 78 |
| 163 | 3300048929 | Ga0496126_0000185 | Ga0496126_0000185_43432_43671 | 78 |
| 164 | 3300049823 | Ga0501044_1331394 | Ga0501044_1331394_169_408 | 78 |
| 165 | 3300053120 | Ga0500597_279175 | Ga0500597_279175_347_583 | 78 |
| 166 | 3300053123 | Ga0500614_143850 | Ga0500614_143850_316_555 | 78 |
| 167 | 3300003771 | Ga0055526_1065423 | Ga0055526_10654232 | 79 |
| 168 | 3300003775 | Ga0055524_1011066 | Ga0055524_10110663 | 79 |
| 169 | 3300003775 | Ga0055524_1014164 | Ga0055524_10141642 | 79 |
| 170 | 3300003794 | Ga0055531_10097881 | Ga0055531_100978812 | 79 |
| 171 | 3300005288 | Ga0065714_10091994 | Ga0065714_100919944 | 79 |
| 172 | 3300005347 | Ga0070668_100188470 | Ga0070668_1001884703 | 79 |
| 173 | 3300005353 | Ga0070669_101381296 | Ga0070669_1013812962 | 79 |
| 174 | 3300005435 | Ga0070714_100027856 | Ga0070714_1000278563 | 79 |
| 175 | 3300005844 | Ga0068862_101632388 | Ga0068862_1016323882 | 79 |
| 176 | 3300005937 | Ga0081455_10259029 | Ga0081455_102590292 | 79 |
| 177 | 3300006051 | Ga0075364_10057092 | Ga0075364_100570923 | 79 |
| 178 | 3300006051 | Ga0075364_10060407 | Ga0075364_100604072 | 79 |
| 179 | 3300006051 | Ga0075364_10350399 | Ga0075364_103503992 | 79 |
| 180 | 3300009093 | Ga0105240_11352357 | Ga0105240_113523572 | 79 |
| 181 | 3300013102 | Ga0157371_11363739 | Ga0157371_113637392 | 79 |
| 182 | 3300013104 | Ga0157370_10780219 | Ga0157370_107802192 | 79 |
| 183 | 3300013307 | Ga0157372_11124253 | Ga0157372_111242532 | 79 |
| 184 | 3300013308 | Ga0157375_11687487 | Ga0157375_116874872 | 79 |
| 185 | 3300014326 | Ga0157380_10305645 | Ga0157380_103056453 | 79 |
| 186 | 3300025273 | Ga0209673_1041574 | Ga0209673_10415742 | 79 |
| 187 | 3300025291 | Ga0209675_1010033 | Ga0209675_10100334 | 79 |
| 188 | 3300025292 | Ga0209676_1045786 | Ga0209676_10457862 | 79 |
| 189 | 3300025294 | Ga0209025_1032876 | Ga0209025_10328762 | 79 |
| 190 | 3300025295 | Ga0209564_1007666 | Ga0209564_10076664 | 79 |
| 191 | 3300025299 | Ga0209256_1004843 | Ga0209256_10048435 | 79 |
| 192 | 3300025302 | Ga0207426_1046584 | Ga0207426_10465843 | 79 |
| 193 | 3300025304 | Ga0209257_1002276 | Ga0209257_100227616 | 79 |
| 194 | 3300025929 | Ga0207664_10185856 | Ga0207664_101858563 | 79 |
| 195 | 3300025931 | Ga0207644_10012209 | Ga0207644_100122093 | 79 |
| 196 | 3300025972 | Ga0207668_10038100 | Ga0207668_100381003 | 79 |
| 197 | 3300030731 | Ga0316177_1191026 | Ga0316177_11910264 | 79 |
| 198 | 3300030733 | Ga0314311_1031529 | Ga0314311_10315292 | 79 |
| 199 | 3300030735 | Ga0316178_1182566 | Ga0316178_11825662 | 79 |
| 200 | 3300030736 | Ga0316180_1150849 | Ga0316180_11508492 | 79 |
| 201 | 3300030744 | Ga0316181_1286399 | Ga0316181_12863993 | 79 |
| 202 | 3300031456 | Ga0307513_10015796 | Ga0307513_100157965 | 79 |
| 203 | 3300031824 | Ga0307413_10022156 | Ga0307413_100221565 | 79 |
| 204 | 3300031824 | Ga0307413_10438489 | Ga0307413_104384892 | 79 |
| 205 | 3300031911 | Ga0307412_10748543 | Ga0307412_107485432 | 79 |
| 206 | 3300031995 | Ga0307409_101519682 | Ga0307409_1015196822 | 79 |
| 207 | 3300032002 | Ga0307416_103621864 | Ga0307416_1036218641 | 79 |
| 208 | 3300032004 | Ga0307414_10000300 | Ga0307414_1000030017 | 79 |
| 209 | 3300032004 | Ga0307414_10240869 | Ga0307414_102408692 | 79 |
| 210 | 3300032004 | Ga0307414_10498646 | Ga0307414_104986462 | 79 |
| 211 | 3300032004 | Ga0307414_11003919 | Ga0307414_110039192 | 79 |
| 212 | 3300037312 | Ga0395899_0097343 | Ga0395899_0097343_1224_1466 | 79 |
| 213 | 3300037418 | Ga0395900_0056989 | Ga0395900_0056989_2220_2462 | 79 |
| 214 | 3300037418 | Ga0395900_0894211 | Ga0395900_0894211_450_692 | 79 |
| 215 | 3300037466 | Ga0395898_0436242 | Ga0395898_0436242_472_714 | 79 |
| 216 | 3300037471 | Ga0395905_0000630 | Ga0395905_0000630_43957_44199 | 79 |
| 217 | 3300037471 | Ga0395905_0133704 | Ga0395905_0133704_1451_1693 | 79 |
| 218 | 3300038443 | Ga0395901_0131268 | Ga0395901_0131268_2229_2471 | 79 |
| 219 | 3300038443 | Ga0395901_0816971 | Ga0395901_0816971_535_777 | 79 |
| 220 | 3300038443 | Ga0395901_1681284 | Ga0395901_1681284_167_409 | 79 |
| 221 | 3300041404 | Ga0439436_0025738 | Ga0439436_0025738_896_1138 | 79 |
| 222 | 3300041404 | Ga0439436_0028700 | Ga0439436_0028700_1363_1605 | 79 |
| 223 | 3300041406 | Ga0439439_0135389 | Ga0439439_0135389_389_631 | 79 |
| 224 | 3300041413 | Ga0439465_0000297 | Ga0439465_0000297_8139_8381 | 79 |
| 225 | 3300041459 | Ga0451800_1617507 | Ga0451800_1617507_199_441 | 79 |
| 226 | 3300041486 | Ga0451807_0371901 | Ga0451807_0371901_117_359 | 79 |
| 227 | 3300041494 | Ga0451837_0374541 | Ga0451837_0374541_552_794 | 79 |
| 228 | 3300041494 | Ga0451837_0990016 | Ga0451837_0990016_510_752 | 79 |
| 229 | 3300041494 | Ga0451837_1098651 | Ga0451837_1098651_677_919 | 79 |
| 230 | 3300041509 | Ga0451843_1009909 | Ga0451843_1009909_97_339 | 79 |
| 231 | 3300041997 | Ga0439431_0032445 | Ga0439431_0032445_433_675 | 79 |
| 232 | 3300042004 | Ga0439445_0114526 | Ga0439445_0114526_172_417 | 79 |
| 233 | 3300042004 | Ga0439445_0115690 | Ga0439445_0115690_282_524 | 79 |
| 234 | 3300042006 | Ga0439432_020431 | Ga0439432_020431_1196_1441 | 79 |
| 235 | 3300042006 | Ga0439432_043098 | Ga0439432_043098_381_623 | 79 |
| 236 | 3300042006 | Ga0439432_060999 | Ga0439432_060999_580_822 | 79 |
| 237 | 3300042007 | Ga0439449_0000045 | Ga0439449_0000045_18473_18715 | 79 |
| 238 | 3300042007 | Ga0439449_0087864 | Ga0439449_0087864_457_699 | 79 |
| 239 | 3300042007 | Ga0439449_0136835 | Ga0439449_0136835_510_752 | 79 |
| 240 | 3300042185 | Ga0450909_068498 | Ga0450909_068498_31_273 | 79 |
| 241 | 3300042876 | Ga0451577_0044594 | Ga0451577_0044594_1103_1342 | 79 |
| 242 | 3300044712 | Ga0453684_0385725 | Ga0453684_0385725_102_341 | 79 |
| 243 | 3300046460 | Ga0495638_0202337 | Ga0495638_0202337_581_823 | 79 |
| 244 | 3300046522 | Ga0495643_0377531 | Ga0495643_0377531_133_375 | 79 |
| 245 | 3300046615 | Ga0495656_0000843 | Ga0495656_0000843_7526_7765 | 79 |
| 246 | 3300047318 | Ga0495636_0003708 | Ga0495636_0003708_985_1224 | 79 |
| 247 | 3300048903 | Ga0496100_0187620 | Ga0496100_0187620_1147_1389 | 79 |
| 248 | 3300048903 | Ga0496100_1035426 | Ga0496100_1035426_39_281 | 79 |
| 249 | 3300048904 | Ga0496101_1310068 | Ga0496101_1310068_307_549 | 79 |
| 250 | 3300048908 | Ga0496105_0618869 | Ga0496105_0618869_546_788 | 79 |
| 251 | 3300048911 | Ga0496108_0013046 | Ga0496108_0013046_3522_3764 | 79 |
| 252 | 3300048912 | Ga0496109_0554441 | Ga0496109_0554441_269_511 | 79 |
| 253 | 3300048912 | Ga0496109_0611698 | Ga0496109_0611698_83_325 | 79 |
| 254 | 3300048915 | Ga0496112_0049966 | Ga0496112_0049966_364_606 | 79 |
| 255 | 3300048916 | Ga0496113_0015849 | Ga0496113_0015849_246_488 | 79 |
| 256 | 3300049513 | Ga0501290_000954 | Ga0501290_000954_3697_3936 | 79 |
| 257 | 3300049523 | Ga0501300_020371 | Ga0501300_020371_423_662 | 79 |
| 258 | 3300049568 | Ga0501031_0066151 | Ga0501031_0066151_1993_2235 | 79 |
| 259 | 3300049569 | Ga0501032_0047295 | Ga0501032_0047295_2473_2715 | 79 |
| 260 | 3300049569 | Ga0501032_0085984 | Ga0501032_0085984_10_252 | 79 |
| 261 | 3300049570 | Ga0501033_0250148 | Ga0501033_0250148_272_514 | 79 |
| 262 | 3300049571 | Ga0501034_0517432 | Ga0501034_0517432_743_985 | 79 |
| 263 | 3300049572 | Ga0501036_1346133 | Ga0501036_1346133_148_390 | 79 |
| 264 | 3300049573 | Ga0501037_0309975 | Ga0501037_0309975_382_624 | 79 |
| 265 | 3300049575 | Ga0501039_0059402 | Ga0501039_0059402_133_375 | 79 |
| 266 | 3300049579 | Ga0501043_0001953 | Ga0501043_0001953_10450_10689 | 79 |
| 267 | 3300049579 | Ga0501043_0032273 | Ga0501043_0032273_636_878 | 79 |
| 268 | 3300049581 | Ga0501047_0230843 | Ga0501047_0230843_289_531 | 79 |
| 269 | 3300049586 | Ga0501070_0408149 | Ga0501070_0408149_46_288 | 79 |
| 270 | 3300049586 | Ga0501070_1113888 | Ga0501070_1113888_46_288 | 79 |
| 271 | 3300049705 | Ga0501225_0003691 | Ga0501225_0003691_1402_1644 | 79 |
| 272 | 3300049762 | Ga0501265_000288 | Ga0501265_000288_1875_2114 | 79 |
| 273 | 3300049773 | Ga0501276_026751 | Ga0501276_026751_144_383 | 79 |
| 274 | 3300049822 | Ga0501035_0078536 | Ga0501035_0078536_1231_1473 | 79 |
| 275 | 3300049823 | Ga0501044_0100640 | Ga0501044_0100640_2054_2296 | 79 |
| 276 | 3300050491 | nmdc:mga00v17_230224_c1 | nmdc:mga00v17_230224_c1_467_709 | 79 |
| 277 | 3300050491 | nmdc:mga00v17_248665_c1 | nmdc:mga00v17_248665_c1_157_399 | 79 |
| 278 | 3300050491 | nmdc:mga00v17_484369_c1 | nmdc:mga00v17_484369_c1_139_381 | 79 |
| 279 | 3300053178 | Ga0500637_0407442 | Ga0500637_0407442_316_555 | 79 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6jc0-assembly1.cif.gz_A | structural analysis of molybdopterin synthases from two mycobacteria pathogens | 0.8718 | 2 | 79 |
| 6jbz-assembly1.cif.gz_D | structural analysis of molybdopterin synthases from two mycobacteria pathogens | 0.8654 | 2 | 79 |
| 6jc0-assembly1.cif.gz_A | structural analysis of molybdopterin synthases from two mycobacteria pathogens | 0.8519 | 2 | 79 |
| 6jbz-assembly1.cif.gz_D | structural analysis of molybdopterin synthases from two mycobacteria pathogens | 0.8458 | 2 | 79 |
| 1vjk-assembly1.cif.gz_A | putative molybdopterin converting factor, subunit 1 from pyrococcus furiosus, pfu-562899-001 | 0.8398 | 1 | 76 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6XWG2_11_92_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8503 | 3 | 79 | 3.10.20.30 |
| af_P0C919_9_90_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8416 | 4 | 79 | 3.10.20.30 |
| 4hroA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8365 | 1 | 76 | 3.10.20.30 |
| af_Q6MWY3_4_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.834 | 5 | 76 | 3.10.20.30 |
| 1vjkA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8298 | 1 | 77 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2A1Q5-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9864 | 3 | 79 |
GO:0000166
GO:0006777 GO:1990133 |
| AF-A0A3M8SVZ1-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9859 | 2 | 79 |
GO:0000166
GO:0006777 GO:1990133 |
| AF-A0A0S7Z8A9-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.983 | 1 | 79 |
GO:0000166
GO:0006777 GO:1990133 |
| AF-K9RT74-F1-model_v4 | Molybdopterin converting factor, subunit 1 | 0.9808 | 1 | 79 |
|
| AF-Q2JXS8-F1-model_v4 | Putative molybdopterin converting factor, subunit 1 | 0.9806 | 2 | 79 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar