F382869

General Info

Members Datasets Scaffolds Average Seq Length
279 201 274 79

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_101381296|Ga0070669_1013812962
Length 81
Sequence MAATVTLLYFASLRDTAGLDRETVASEAADLRALYAEVRARHGFVLPQEKLRVAVDGAFARWDAPLGDGSEIAFIPPVSGG

Samples

Sample ID Description Type Environment
1 2643221695 Lysobacter sp. Root494 Isolate Unclassified
2 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
3 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
4 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
5 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
54 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
112 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
113 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
114 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
115 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
127 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
128 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
138 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
139 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
140 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
141 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
142 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
143 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
144 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
145 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
146 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
147 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
148 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
165 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
182 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
194 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
195 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
199 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
200 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
201 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 0
Isolates 1.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.53
Nodule 0
Rhizoplane 6.09
Rhizosphere 82.8
Stem 0
Stem Tuber 0
Unclassified 3.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1065423 3300003771 Bacteria 757
2 Ga0055524_1011066 3300003775 Bacteria 3548
3 Ga0055524_1014164 3300003775 Bacteria 2970
4 Ga0055531_10097881 3300003794 Bacteria 608
5 Ga0065714_10091994 3300005288 Bacteria 1883
6 Ga0070680_100235574 3300005336 Bacteria 1546
7 Ga0070680_100698855 3300005336 Bacteria 872
8 Ga0070660_101292570 3300005339 Bacteria 619
9 Ga0070691_10199644 3300005341 Bacteria 1050
10 Ga0070692_10771415 3300005345 Bacteria 654
11 Ga0070668_100188470 3300005347 Bacteria 1688
12 Ga0070669_101381296 3300005353 Bacteria 611
13 Ga0070675_100295745 3300005354 Bacteria 1425
14 Ga0070659_100277880 3300005366 Bacteria 1393
15 Ga0070667_100290116 3300005367 Bacteria 1471
16 Ga0070714_100027856 3300005435 Bacteria 4682
17 Ga0070711_100537850 3300005439 Bacteria 968
18 Ga0070678_100445127 3300005456 Bacteria 1134
19 Ga0070681_10000007 3300005458 Bacteria 159821
20 Ga0070681_10095162 3300005458 Bacteria 2927
21 Ga0070681_10569447 3300005458 Bacteria 1046
22 Ga0068867_100248422 3300005459 Bacteria 1446
23 Ga0068867_100510584 3300005459 Bacteria 1035
24 Ga0070679_100915459 3300005530 Bacteria 820
25 Ga0068853_100006385 3300005539 Bacteria 9364
26 Ga0070672_100004380 3300005543 Bacteria 9246
27 Ga0070672_100010568 3300005543 Bacteria 6408
28 Ga0070696_100112148 3300005546 Bacteria 1965
29 Ga0070693_100007564 3300005547 Bacteria 5316
30 Ga0070693_100308020 3300005547 Bacteria 1070
31 Ga0070693_101194275 3300005547 Bacteria 584
32 Ga0070665_100309634 3300005548 Bacteria 1583
33 Ga0068855_100077870 3300005563 Bacteria 3847
34 Ga0068855_100702714 3300005563 Bacteria 1082
35 Ga0068855_101810135 3300005563 Bacteria 620
36 Ga0068857_100091286 3300005577 Bacteria 2726
37 Ga0068854_101763927 3300005578 Bacteria 567
38 Ga0070702_100998986 3300005615 Bacteria 662
39 Ga0068852_100120763 3300005616 Bacteria 2399
40 Ga0068852_102014267 3300005616 Bacteria 599
41 Ga0068859_100076536 3300005617 Bacteria 3387
42 Ga0068859_101452708 3300005617 Bacteria 757
43 Ga0068861_101087207 3300005719 Bacteria 768
44 Ga0068863_100503415 3300005841 Bacteria 1193
45 Ga0068860_100009878 3300005843 Bacteria 9461
46 Ga0068862_101632388 3300005844 Bacteria 652
47 Ga0081455_10259029 3300005937 Bacteria 1268
48 Ga0075364_10057092 3300006051 Bacteria 2556
49 Ga0075364_10060407 3300006051 Bacteria 2486
50 Ga0075364_10350399 3300006051 Bacteria 1006
51 Ga0068871_100115700 3300006358 Bacteria 2260
52 Ga0068865_100001867 3300006881 Bacteria 12378
53 Ga0097620_100076536 3300006931 Bacteria 3387
54 Ga0097620_101452632 3300006931 Bacteria 757
55 Ga0105240_10007745 3300009093 Bacteria 15536
56 Ga0105240_10095359 3300009093 Bacteria 3627
57 Ga0105240_11352357 3300009093 Bacteria 750
58 Ga0105240_12555636 3300009093 Bacteria 528
59 Ga0105245_10762446 3300009098 Bacteria 1004
60 Ga0105245_12512095 3300009098 Bacteria 568
61 Ga0105241_10060823 3300009174 Bacteria 2907
62 Ga0105242_10001918 3300009176 Bacteria 16343
63 Ga0105237_10016858 3300009545 Bacteria 7580
64 Ga0105237_12496965 3300009545 Bacteria 527
65 Ga0105238_10015784 3300009551 Bacteria 7645
66 Ga0105238_10019466 3300009551 Bacteria 6912
67 Ga0105249_10071549 3300009553 Bacteria 3204
68 Ga0105239_10044931 3300010375 Bacteria 4842
69 Ga0105239_10111889 3300010375 Bacteria 3027
70 Ga0105239_12039930 3300010375 Bacteria 666
71 Ga0157327_1008046 3300012512 Bacteria 935
72 Ga0157326_1052637 3300012513 Bacteria 602
73 Ga0157373_10188820 3300013100 Bacteria 1452
74 Ga0157373_11564704 3300013100 Bacteria 504
75 Ga0157371_11363739 3300013102 Bacteria 550
76 Ga0157370_10064917 3300013104 Bacteria 3454
77 Ga0157370_10352429 3300013104 Bacteria 1357
78 Ga0157370_10780219 3300013104 Bacteria 870
79 Ga0157369_10000195 3300013105 Bacteria 84688
80 Ga0157374_10039767 3300013296 Bacteria 4329
81 Ga0157374_10121405 3300013296 Bacteria 2522
82 Ga0157378_10051445 3300013297 Bacteria 3666
83 Ga0163162_10001959 3300013306 Bacteria 19333
84 Ga0157372_10312351 3300013307 Bacteria 1830
85 Ga0157372_11124253 3300013307 Bacteria 909
86 Ga0157375_10000156 3300013308 Bacteria 66009
87 Ga0157375_10031195 3300013308 Bacteria 5033
88 Ga0157375_10609213 3300013308 Bacteria 1251
89 Ga0157375_11687487 3300013308 Bacteria 750
90 Ga0157380_10305645 3300014326 Bacteria 1467
91 Ga0157380_10763895 3300014326 Bacteria 980
92 Ga0182008_10600726 3300014497 Bacteria 617
93 Ga0157376_10005014 3300014969 Bacteria 9237
94 Ga0157376_10058312 3300014969 Bacteria 3233
95 Ga0157376_10064239 3300014969 Bacteria 3095
96 Ga0209673_1041574 3300025273 Bacteria 1303
97 Ga0209675_1010033 3300025291 Bacteria 3276
98 Ga0209676_1045786 3300025292 Bacteria 1188
99 Ga0209025_1032876 3300025294 Bacteria 2413
100 Ga0209564_1007666 3300025295 Bacteria 5512
101 Ga0209256_1004843 3300025299 Bacteria 8141
102 Ga0207426_1046584 3300025302 Bacteria 1312
103 Ga0209257_1002276 3300025304 Bacteria 19574
104 Ga0207699_10847374 3300025906 Bacteria 673
105 Ga0207645_10187858 3300025907 Bacteria 1357
106 Ga0207654_10228084 3300025911 Bacteria 1239
107 Ga0207707_10011211 3300025912 Bacteria 7798
108 Ga0207707_10481401 3300025912 Bacteria 1060
109 Ga0207707_10640949 3300025912 Bacteria 896
110 Ga0207695_10001746 3300025913 Bacteria 34535
111 Ga0207695_10043274 3300025913 Bacteria 4800
112 Ga0207671_10630873 3300025914 Bacteria 854
113 Ga0207657_10816787 3300025919 Bacteria 720
114 Ga0207652_11210125 3300025921 Bacteria 657
115 Ga0207694_10000627 3300025924 Bacteria 32068
116 Ga0207694_10048426 3300025924 Bacteria 3289
117 Ga0207650_10770804 3300025925 Bacteria 814
118 Ga0207687_11548880 3300025927 Bacteria 569
119 Ga0207664_10185856 3300025929 Bacteria 1787
120 Ga0207644_10012209 3300025931 Bacteria 5700
121 Ga0207686_10023038 3300025934 Bacteria 3592
122 Ga0207691_10004868 3300025940 Bacteria 12984
123 Ga0207689_10047934 3300025942 Bacteria 3525
124 Ga0207667_10117069 3300025949 Bacteria 2746
125 Ga0207651_10112936 3300025960 Bacteria 2043
126 Ga0207712_10221584 3300025961 Bacteria 1513
127 Ga0207668_10038100 3300025972 Bacteria 3223
128 Ga0207640_10847650 3300025981 Bacteria 795
129 Ga0207639_10008534 3300026041 Bacteria 7031
130 Ga0207678_10690227 3300026067 Bacteria 898
131 Ga0207641_10310344 3300026088 Bacteria 1493
132 Ga0207641_12002961 3300026088 Bacteria 580
133 Ga0207648_10212788 3300026089 Bacteria 1716
134 Ga0207648_10382181 3300026089 Bacteria 1273
135 Ga0207674_10513434 3300026116 Bacteria 1157
136 Ga0207674_11013202 3300026116 Bacteria 800
137 Ga0207698_10021084 3300026142 Bacteria 4499
138 Ga0207698_12127480 3300026142 Bacteria 574
139 Ga0207698_12323798 3300026142 Bacteria 548
140 Ga0209967_1018348 3300027364 Bacteria 1013
141 Ga0209995_1006661 3300027471 Bacteria 1857
142 Ga0209999_1000714 3300027543 Bacteria 5385
143 Ga0209970_1006785 3300027614 Bacteria 1880
144 Ga0209983_1000296 3300027665 Bacteria 10384
145 Ga0209971_1013235 3300027682 Bacteria 1955
146 Ga0209974_10008039 3300027876 Bacteria 3614
147 Ga0268266_10060519 3300028379 Bacteria 3265
148 Ga0268266_10338979 3300028379 Bacteria 1411
149 Ga0268264_10005234 3300028381 Bacteria 10980
150 Ga0316177_1191026 3300030731 Bacteria 2923
151 Ga0314311_1031529 3300030733 Bacteria 1168
152 Ga0316178_1182566 3300030735 Bacteria 744
153 Ga0316180_1150849 3300030736 Bacteria 760
154 Ga0316181_1286399 3300030744 Bacteria 1562
155 Ga0307513_10015796 3300031456 Bacteria 9137
156 Ga0307408_100288800 3300031548 Bacteria 1369
157 Ga0307516_10047197 3300031730 Bacteria 4245
158 Ga0307516_10978244 3300031730 Bacteria 517
159 Ga0307405_11160375 3300031731 Bacteria 666
160 Ga0307413_10022156 3300031824 Bacteria 3418
161 Ga0307413_10438489 3300031824 Bacteria 1033
162 Ga0307412_10748543 3300031911 Bacteria 843
163 Ga0307409_101519682 3300031995 Bacteria 697
164 Ga0307409_101745899 3300031995 Bacteria 651
165 Ga0307416_103621864 3300032002 Bacteria 517
166 Ga0307414_10000300 3300032004 Bacteria 28812
167 Ga0307414_10240869 3300032004 Bacteria 1497
168 Ga0307414_10498646 3300032004 Bacteria 1077
169 Ga0307414_10599577 3300032004 Bacteria 988
170 Ga0307414_11003919 3300032004 Bacteria 768
171 Ga0307415_100561333 3300032126 Bacteria 1009
172 Ga0307415_101456351 3300032126 Bacteria 654
173 Ga0373934_0338898 3300035086 Bacteria 625
174 Ga0373944_0108141 3300035089 Bacteria 946
175 Ga0373936_0299300 3300035113 Bacteria 726
176 Ga0373935_0923989 3300035692 Bacteria 647
177 Ga0373937_0752623 3300036401 Bacteria 922
178 Ga0373925_1208454 3300037068 Bacteria 621
179 Ga0395899_0097343 3300037312 Bacteria 2127
180 Ga0395900_0000175 3300037418 Bacteria 102937
181 Ga0395900_0056989 3300037418 Bacteria 4022
182 Ga0395900_0295913 3300037418 Bacteria 1606
183 Ga0395900_0894211 3300037418 Bacteria 812
184 Ga0395898_0086681 3300037466 Bacteria 3017
185 Ga0395898_0436242 3300037466 Bacteria 1248
186 Ga0395905_0000630 3300037471 Bacteria 47216
187 Ga0395905_0133704 3300037471 Bacteria 2333
188 Ga0395901_0131268 3300038443 Bacteria 2632
189 Ga0395901_0816971 3300038443 Bacteria 920
190 Ga0395901_1681284 3300038443 Bacteria 586
191 Ga0439436_0025738 3300041404 Bacteria 1727
192 Ga0439436_0028700 3300041404 Bacteria 1623
193 Ga0439439_0135389 3300041406 Bacteria 693
194 Ga0439465_0000297 3300041413 Bacteria 14018
195 Ga0451800_0340878 3300041459 Bacteria 596
196 Ga0451800_1617507 3300041459 Bacteria 878
197 Ga0451807_0371901 3300041486 Bacteria 555
198 Ga0451807_0693854 3300041486 Bacteria 1094
199 Ga0451837_0374541 3300041494 Bacteria 981
200 Ga0451837_0990016 3300041494 Bacteria 1015
201 Ga0451837_1098651 3300041494 Bacteria 964
202 Ga0451843_1009909 3300041509 Bacteria 628
203 Ga0439431_0032445 3300041997 Bacteria 1302
204 Ga0439445_0114526 3300042004 Bacteria 771
205 Ga0439445_0115690 3300042004 Bacteria 767
206 Ga0439432_020431 3300042006 Bacteria 2201
207 Ga0439432_043098 3300042006 Bacteria 1425
208 Ga0439432_060999 3300042006 Bacteria 1163
209 Ga0439449_0000045 3300042007 Bacteria 38264
210 Ga0439449_0087864 3300042007 Bacteria 1147
211 Ga0439449_0136835 3300042007 Bacteria 911
212 Ga0450909_068498 3300042185 Bacteria 566
213 Ga0451577_0044594 3300042876 Bacteria 3970
214 Ga0453683_0124980 3300044673 Bacteria 1620
215 Ga0453684_0385725 3300044712 Bacteria 1572
216 Ga0466957_0337028 3300044842 Bacteria 1021
217 Ga0466967_1166120 3300045976 Bacteria 768
218 Ga0495638_0202337 3300046460 Bacteria 1120
219 Ga0495580_0778901 3300046472 Bacteria 621
220 Ga0495582_0105451 3300046473 Bacteria 1580
221 Ga0495639_0129997 3300046475 Bacteria 1205
222 Ga0495662_0197428 3300046476 Bacteria 992
223 Ga0495664_0299904 3300046477 Bacteria 970
224 Ga0495643_0377531 3300046522 Bacteria 629
225 Ga0495652_0532772 3300046529 Bacteria 810
226 Ga0495654_0158372 3300046530 Bacteria 996
227 Ga0495645_0473111 3300046543 Bacteria 787
228 Ga0495656_0000843 3300046615 Bacteria 9891
229 Ga0495647_0032619 3300046681 Bacteria 1942
230 Ga0495658_0028701 3300046683 Bacteria 3005
231 Ga0495613_0460975 3300046689 Bacteria 860
232 Ga0495636_0003708 3300047318 Bacteria 5942
233 Ga0496100_0187620 3300048903 Bacteria 1499
234 Ga0496100_1035426 3300048903 Bacteria 646
235 Ga0496101_1310068 3300048904 Bacteria 566
236 Ga0496103_0079268 3300048906 Bacteria 2063
237 Ga0496104_0000011 3300048907 Bacteria 459358
238 Ga0496105_0000015 3300048908 Bacteria 218758
239 Ga0496105_0618869 3300048908 Bacteria 839
240 Ga0496108_0013046 3300048911 Bacteria 6772
241 Ga0496109_0554441 3300048912 Bacteria 1084
242 Ga0496109_0611698 3300048912 Bacteria 1026
243 Ga0496112_0049966 3300048915 Bacteria 4099
244 Ga0496113_0015849 3300048916 Bacteria 5194
245 Ga0496115_0000065 3300048918 Bacteria 98148
246 Ga0496118_0027212 3300048921 Bacteria 4846
247 Ga0496126_0000185 3300048929 Bacteria 140051
248 Ga0501290_000954 3300049513 Bacteria 4184
249 Ga0501300_020371 3300049523 Bacteria 968
250 Ga0501031_0066151 3300049568 Bacteria 2355
251 Ga0501032_0047295 3300049569 Bacteria 2905
252 Ga0501032_0085984 3300049569 Bacteria 2090
253 Ga0501033_0250148 3300049570 Bacteria 1256
254 Ga0501034_0517432 3300049571 Bacteria 1105
255 Ga0501036_1346133 3300049572 Bacteria 580
256 Ga0501037_0309975 3300049573 Bacteria 1094
257 Ga0501039_0059402 3300049575 Bacteria 2962
258 Ga0501043_0001953 3300049579 Bacteria 17638
259 Ga0501043_0032273 3300049579 Bacteria 4117
260 Ga0501047_0230843 3300049581 Bacteria 1704
261 Ga0501070_0408149 3300049586 Bacteria 1098
262 Ga0501070_1113888 3300049586 Bacteria 608
263 Ga0501225_0003691 3300049705 Bacteria 4608
264 Ga0501265_000288 3300049762 Bacteria 5166
265 Ga0501276_026751 3300049773 Bacteria 583
266 Ga0501035_0078536 3300049822 Bacteria 2915
267 Ga0501044_0100640 3300049823 Bacteria 2908
268 Ga0501044_1331394 3300049823 Bacteria 584
269 nmdc:mga00v17_230224_c1 3300050491 Bacteria 1201
270 nmdc:mga00v17_248665_c1 3300050491 Bacteria 1153
271 nmdc:mga00v17_484369_c1 3300050491 Bacteria 802
272 Ga0500597_279175 3300053120 Bacteria 674
273 Ga0500614_143850 3300053123 Bacteria 715
274 Ga0500637_0407442 3300053178 Bacteria 704

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031995 Ga0307409_101745899 Ga0307409_1017458992 68
2 3300026142 Ga0207698_12323798 Ga0207698_123237981 73
3 3300005563 Ga0068855_100077870 Ga0068855_1000778705 74
4 3300025925 Ga0207650_10770804 Ga0207650_107708042 74
5 iso_pu_bacteria 2895522137 2895524377 75
6 iso_pu_bacteria 2895525241 2895526474 75
7 iso_pu_bacteria 2643221695 2644529919 76
8 iso_pu_bacteria 2895498888 2895502527 76
9 iso_pu_bacteria 2895511927 2895514144 76
10 3300012513 Ga0157326_1052637 Ga0157326_10526372 77
11 3300005336 Ga0070680_100235574 Ga0070680_1002355742 78
12 3300005336 Ga0070680_100698855 Ga0070680_1006988552 78
13 3300005339 Ga0070660_101292570 Ga0070660_1012925701 78
14 3300005341 Ga0070691_10199644 Ga0070691_101996442 78
15 3300005345 Ga0070692_10771415 Ga0070692_107714151 78
16 3300005354 Ga0070675_100295745 Ga0070675_1002957453 78
17 3300005366 Ga0070659_100277880 Ga0070659_1002778802 78
18 3300005367 Ga0070667_100290116 Ga0070667_1002901163 78
19 3300005439 Ga0070711_100537850 Ga0070711_1005378502 78
20 3300005456 Ga0070678_100445127 Ga0070678_1004451272 78
21 3300005458 Ga0070681_10000007 Ga0070681_1000000745 78
22 3300005458 Ga0070681_10095162 Ga0070681_100951623 78
23 3300005458 Ga0070681_10569447 Ga0070681_105694472 78
24 3300005459 Ga0068867_100248422 Ga0068867_1002484223 78
25 3300005459 Ga0068867_100510584 Ga0068867_1005105842 78
26 3300005530 Ga0070679_100915459 Ga0070679_1009154592 78
27 3300005539 Ga0068853_100006385 Ga0068853_1000063859 78
28 3300005543 Ga0070672_100004380 Ga0070672_1000043803 78
29 3300005543 Ga0070672_100010568 Ga0070672_1000105684 78
30 3300005546 Ga0070696_100112148 Ga0070696_1001121482 78
31 3300005547 Ga0070693_100007564 Ga0070693_1000075644 78
32 3300005547 Ga0070693_100308020 Ga0070693_1003080203 78
33 3300005547 Ga0070693_101194275 Ga0070693_1011942752 78
34 3300005548 Ga0070665_100309634 Ga0070665_1003096343 78
35 3300005563 Ga0068855_100702714 Ga0068855_1007027142 78
36 3300005563 Ga0068855_101810135 Ga0068855_1018101352 78
37 3300005577 Ga0068857_100091286 Ga0068857_1000912862 78
38 3300005578 Ga0068854_101763927 Ga0068854_1017639272 78
39 3300005615 Ga0070702_100998986 Ga0070702_1009989862 78
40 3300005616 Ga0068852_100120763 Ga0068852_1001207633 78
41 3300005616 Ga0068852_102014267 Ga0068852_1020142672 78
42 3300005617 Ga0068859_100076536 Ga0068859_1000765364 78
43 3300005617 Ga0068859_101452708 Ga0068859_1014527082 78
44 3300005719 Ga0068861_101087207 Ga0068861_1010872072 78
45 3300005841 Ga0068863_100503415 Ga0068863_1005034152 78
46 3300005843 Ga0068860_100009878 Ga0068860_1000098788 78
47 3300006358 Ga0068871_100115700 Ga0068871_1001157003 78
48 3300006881 Ga0068865_100001867 Ga0068865_1000018672 78
49 3300006931 Ga0097620_100076536 Ga0097620_1000765363 78
50 3300006931 Ga0097620_101452632 Ga0097620_1014526322 78
51 3300009093 Ga0105240_10007745 Ga0105240_1000774518 78
52 3300009093 Ga0105240_10095359 Ga0105240_100953593 78
53 3300009093 Ga0105240_12555636 Ga0105240_125556362 78
54 3300009098 Ga0105245_10762446 Ga0105245_107624463 78
55 3300009098 Ga0105245_12512095 Ga0105245_125120952 78
56 3300009174 Ga0105241_10060823 Ga0105241_100608232 78
57 3300009176 Ga0105242_10001918 Ga0105242_1000191816 78
58 3300009545 Ga0105237_10016858 Ga0105237_100168583 78
59 3300009545 Ga0105237_12496965 Ga0105237_124969652 78
60 3300009551 Ga0105238_10015784 Ga0105238_100157843 78
61 3300009551 Ga0105238_10019466 Ga0105238_100194665 78
62 3300009553 Ga0105249_10071549 Ga0105249_100715494 78
63 3300010375 Ga0105239_10044931 Ga0105239_100449313 78
64 3300010375 Ga0105239_10111889 Ga0105239_101118893 78
65 3300010375 Ga0105239_12039930 Ga0105239_120399302 78
66 3300012512 Ga0157327_1008046 Ga0157327_10080461 78
67 3300013100 Ga0157373_10188820 Ga0157373_101888201 78
68 3300013100 Ga0157373_11564704 Ga0157373_115647042 78
69 3300013104 Ga0157370_10064917 Ga0157370_100649174 78
70 3300013104 Ga0157370_10352429 Ga0157370_103524293 78
71 3300013105 Ga0157369_10000195 Ga0157369_100001953 78
72 3300013296 Ga0157374_10039767 Ga0157374_100397673 78
73 3300013296 Ga0157374_10121405 Ga0157374_101214053 78
74 3300013297 Ga0157378_10051445 Ga0157378_100514454 78
75 3300013306 Ga0163162_10001959 Ga0163162_100019595 78
76 3300013307 Ga0157372_10312351 Ga0157372_103123512 78
77 3300013308 Ga0157375_10000156 Ga0157375_1000015632 78
78 3300013308 Ga0157375_10031195 Ga0157375_100311953 78
79 3300013308 Ga0157375_10609213 Ga0157375_106092132 78
80 3300014326 Ga0157380_10763895 Ga0157380_107638952 78
81 3300014497 Ga0182008_10600726 Ga0182008_106007262 78
82 3300014969 Ga0157376_10005014 Ga0157376_100050144 78
83 3300014969 Ga0157376_10058312 Ga0157376_100583123 78
84 3300014969 Ga0157376_10064239 Ga0157376_100642393 78
85 3300025906 Ga0207699_10847374 Ga0207699_108473742 78
86 3300025907 Ga0207645_10187858 Ga0207645_101878582 78
87 3300025911 Ga0207654_10228084 Ga0207654_102280842 78
88 3300025912 Ga0207707_10011211 Ga0207707_1001121112 78
89 3300025912 Ga0207707_10481401 Ga0207707_104814012 78
90 3300025912 Ga0207707_10640949 Ga0207707_106409492 78
91 3300025913 Ga0207695_10001746 Ga0207695_1000174636 78
92 3300025913 Ga0207695_10043274 Ga0207695_100432746 78
93 3300025914 Ga0207671_10630873 Ga0207671_106308732 78
94 3300025919 Ga0207657_10816787 Ga0207657_108167872 78
95 3300025921 Ga0207652_11210125 Ga0207652_112101252 78
96 3300025924 Ga0207694_10000627 Ga0207694_1000062712 78
97 3300025924 Ga0207694_10048426 Ga0207694_100484264 78
98 3300025927 Ga0207687_11548880 Ga0207687_115488802 78
99 3300025934 Ga0207686_10023038 Ga0207686_100230385 78
100 3300025940 Ga0207691_10004868 Ga0207691_100048688 78
101 3300025942 Ga0207689_10047934 Ga0207689_100479343 78
102 3300025949 Ga0207667_10117069 Ga0207667_101170693 78
103 3300025960 Ga0207651_10112936 Ga0207651_101129362 78
104 3300025961 Ga0207712_10221584 Ga0207712_102215842 78
105 3300025981 Ga0207640_10847650 Ga0207640_108476502 78
106 3300026041 Ga0207639_10008534 Ga0207639_100085344 78
107 3300026067 Ga0207678_10690227 Ga0207678_106902272 78
108 3300026088 Ga0207641_10310344 Ga0207641_103103444 78
109 3300026088 Ga0207641_12002961 Ga0207641_120029611 78
110 3300026089 Ga0207648_10212788 Ga0207648_102127883 78
111 3300026089 Ga0207648_10382181 Ga0207648_103821812 78
112 3300026116 Ga0207674_10513434 Ga0207674_105134342 78
113 3300026116 Ga0207674_11013202 Ga0207674_110132022 78
114 3300026142 Ga0207698_10021084 Ga0207698_100210844 78
115 3300026142 Ga0207698_12127480 Ga0207698_121274802 78
116 3300027364 Ga0209967_1018348 Ga0209967_10183482 78
117 3300027471 Ga0209995_1006661 Ga0209995_10066612 78
118 3300027543 Ga0209999_1000714 Ga0209999_10007144 78
119 3300027614 Ga0209970_1006785 Ga0209970_10067852 78
120 3300027665 Ga0209983_1000296 Ga0209983_100029615 78
121 3300027682 Ga0209971_1013235 Ga0209971_10132353 78
122 3300027876 Ga0209974_10008039 Ga0209974_100080395 78
123 3300028379 Ga0268266_10060519 Ga0268266_100605192 78
124 3300028379 Ga0268266_10338979 Ga0268266_103389792 78
125 3300028381 Ga0268264_10005234 Ga0268264_100052344 78
126 3300031548 Ga0307408_100288800 Ga0307408_1002888002 78
127 3300031730 Ga0307516_10047197 Ga0307516_100471973 78
128 3300031730 Ga0307516_10978244 Ga0307516_109782442 78
129 3300031731 Ga0307405_11160375 Ga0307405_111603752 78
130 3300032004 Ga0307414_10599577 Ga0307414_105995772 78
131 3300032126 Ga0307415_100561333 Ga0307415_1005613332 78
132 3300032126 Ga0307415_101456351 Ga0307415_1014563512 78
133 3300035086 Ga0373934_0338898 Ga0373934_0338898_117_356 78
134 3300035089 Ga0373944_0108141 Ga0373944_0108141_419_658 78
135 3300035113 Ga0373936_0299300 Ga0373936_0299300_443_682 78
136 3300035692 Ga0373935_0923989 Ga0373935_0923989_257_496 78
137 3300036401 Ga0373937_0752623 Ga0373937_0752623_269_508 78
138 3300037068 Ga0373925_1208454 Ga0373925_1208454_247_486 78
139 3300037418 Ga0395900_0000175 Ga0395900_0000175_45616_45855 78
140 3300037418 Ga0395900_0295913 Ga0395900_0295913_661_900 78
141 3300037466 Ga0395898_0086681 Ga0395898_0086681_788_1027 78
142 3300041459 Ga0451800_0340878 Ga0451800_0340878_109_345 78
143 3300041486 Ga0451807_0693854 Ga0451807_0693854_490_729 78
144 3300044673 Ga0453683_0124980 Ga0453683_0124980_640_876 78
145 3300044842 Ga0466957_0337028 Ga0466957_0337028_55_294 78
146 3300045976 Ga0466967_1166120 Ga0466967_1166120_10_249 78
147 3300046472 Ga0495580_0778901 Ga0495580_0778901_361_600 78
148 3300046473 Ga0495582_0105451 Ga0495582_0105451_413_652 78
149 3300046475 Ga0495639_0129997 Ga0495639_0129997_601_840 78
150 3300046476 Ga0495662_0197428 Ga0495662_0197428_332_571 78
151 3300046477 Ga0495664_0299904 Ga0495664_0299904_200_439 78
152 3300046529 Ga0495652_0532772 Ga0495652_0532772_128_367 78
153 3300046530 Ga0495654_0158372 Ga0495654_0158372_333_569 78
154 3300046543 Ga0495645_0473111 Ga0495645_0473111_388_627 78
155 3300046681 Ga0495647_0032619 Ga0495647_0032619_112_351 78
156 3300046683 Ga0495658_0028701 Ga0495658_0028701_1394_1633 78
157 3300046689 Ga0495613_0460975 Ga0495613_0460975_302_541 78
158 3300048906 Ga0496103_0079268 Ga0496103_0079268_308_547 78
159 3300048907 Ga0496104_0000011 Ga0496104_0000011_316663_316902 78
160 3300048908 Ga0496105_0000015 Ga0496105_0000015_202940_203179 78
161 3300048918 Ga0496115_0000065 Ga0496115_0000065_92672_92911 78
162 3300048921 Ga0496118_0027212 Ga0496118_0027212_871_1110 78
163 3300048929 Ga0496126_0000185 Ga0496126_0000185_43432_43671 78
164 3300049823 Ga0501044_1331394 Ga0501044_1331394_169_408 78
165 3300053120 Ga0500597_279175 Ga0500597_279175_347_583 78
166 3300053123 Ga0500614_143850 Ga0500614_143850_316_555 78
167 3300003771 Ga0055526_1065423 Ga0055526_10654232 79
168 3300003775 Ga0055524_1011066 Ga0055524_10110663 79
169 3300003775 Ga0055524_1014164 Ga0055524_10141642 79
170 3300003794 Ga0055531_10097881 Ga0055531_100978812 79
171 3300005288 Ga0065714_10091994 Ga0065714_100919944 79
172 3300005347 Ga0070668_100188470 Ga0070668_1001884703 79
173 3300005353 Ga0070669_101381296 Ga0070669_1013812962 79
174 3300005435 Ga0070714_100027856 Ga0070714_1000278563 79
175 3300005844 Ga0068862_101632388 Ga0068862_1016323882 79
176 3300005937 Ga0081455_10259029 Ga0081455_102590292 79
177 3300006051 Ga0075364_10057092 Ga0075364_100570923 79
178 3300006051 Ga0075364_10060407 Ga0075364_100604072 79
179 3300006051 Ga0075364_10350399 Ga0075364_103503992 79
180 3300009093 Ga0105240_11352357 Ga0105240_113523572 79
181 3300013102 Ga0157371_11363739 Ga0157371_113637392 79
182 3300013104 Ga0157370_10780219 Ga0157370_107802192 79
183 3300013307 Ga0157372_11124253 Ga0157372_111242532 79
184 3300013308 Ga0157375_11687487 Ga0157375_116874872 79
185 3300014326 Ga0157380_10305645 Ga0157380_103056453 79
186 3300025273 Ga0209673_1041574 Ga0209673_10415742 79
187 3300025291 Ga0209675_1010033 Ga0209675_10100334 79
188 3300025292 Ga0209676_1045786 Ga0209676_10457862 79
189 3300025294 Ga0209025_1032876 Ga0209025_10328762 79
190 3300025295 Ga0209564_1007666 Ga0209564_10076664 79
191 3300025299 Ga0209256_1004843 Ga0209256_10048435 79
192 3300025302 Ga0207426_1046584 Ga0207426_10465843 79
193 3300025304 Ga0209257_1002276 Ga0209257_100227616 79
194 3300025929 Ga0207664_10185856 Ga0207664_101858563 79
195 3300025931 Ga0207644_10012209 Ga0207644_100122093 79
196 3300025972 Ga0207668_10038100 Ga0207668_100381003 79
197 3300030731 Ga0316177_1191026 Ga0316177_11910264 79
198 3300030733 Ga0314311_1031529 Ga0314311_10315292 79
199 3300030735 Ga0316178_1182566 Ga0316178_11825662 79
200 3300030736 Ga0316180_1150849 Ga0316180_11508492 79
201 3300030744 Ga0316181_1286399 Ga0316181_12863993 79
202 3300031456 Ga0307513_10015796 Ga0307513_100157965 79
203 3300031824 Ga0307413_10022156 Ga0307413_100221565 79
204 3300031824 Ga0307413_10438489 Ga0307413_104384892 79
205 3300031911 Ga0307412_10748543 Ga0307412_107485432 79
206 3300031995 Ga0307409_101519682 Ga0307409_1015196822 79
207 3300032002 Ga0307416_103621864 Ga0307416_1036218641 79
208 3300032004 Ga0307414_10000300 Ga0307414_1000030017 79
209 3300032004 Ga0307414_10240869 Ga0307414_102408692 79
210 3300032004 Ga0307414_10498646 Ga0307414_104986462 79
211 3300032004 Ga0307414_11003919 Ga0307414_110039192 79
212 3300037312 Ga0395899_0097343 Ga0395899_0097343_1224_1466 79
213 3300037418 Ga0395900_0056989 Ga0395900_0056989_2220_2462 79
214 3300037418 Ga0395900_0894211 Ga0395900_0894211_450_692 79
215 3300037466 Ga0395898_0436242 Ga0395898_0436242_472_714 79
216 3300037471 Ga0395905_0000630 Ga0395905_0000630_43957_44199 79
217 3300037471 Ga0395905_0133704 Ga0395905_0133704_1451_1693 79
218 3300038443 Ga0395901_0131268 Ga0395901_0131268_2229_2471 79
219 3300038443 Ga0395901_0816971 Ga0395901_0816971_535_777 79
220 3300038443 Ga0395901_1681284 Ga0395901_1681284_167_409 79
221 3300041404 Ga0439436_0025738 Ga0439436_0025738_896_1138 79
222 3300041404 Ga0439436_0028700 Ga0439436_0028700_1363_1605 79
223 3300041406 Ga0439439_0135389 Ga0439439_0135389_389_631 79
224 3300041413 Ga0439465_0000297 Ga0439465_0000297_8139_8381 79
225 3300041459 Ga0451800_1617507 Ga0451800_1617507_199_441 79
226 3300041486 Ga0451807_0371901 Ga0451807_0371901_117_359 79
227 3300041494 Ga0451837_0374541 Ga0451837_0374541_552_794 79
228 3300041494 Ga0451837_0990016 Ga0451837_0990016_510_752 79
229 3300041494 Ga0451837_1098651 Ga0451837_1098651_677_919 79
230 3300041509 Ga0451843_1009909 Ga0451843_1009909_97_339 79
231 3300041997 Ga0439431_0032445 Ga0439431_0032445_433_675 79
232 3300042004 Ga0439445_0114526 Ga0439445_0114526_172_417 79
233 3300042004 Ga0439445_0115690 Ga0439445_0115690_282_524 79
234 3300042006 Ga0439432_020431 Ga0439432_020431_1196_1441 79
235 3300042006 Ga0439432_043098 Ga0439432_043098_381_623 79
236 3300042006 Ga0439432_060999 Ga0439432_060999_580_822 79
237 3300042007 Ga0439449_0000045 Ga0439449_0000045_18473_18715 79
238 3300042007 Ga0439449_0087864 Ga0439449_0087864_457_699 79
239 3300042007 Ga0439449_0136835 Ga0439449_0136835_510_752 79
240 3300042185 Ga0450909_068498 Ga0450909_068498_31_273 79
241 3300042876 Ga0451577_0044594 Ga0451577_0044594_1103_1342 79
242 3300044712 Ga0453684_0385725 Ga0453684_0385725_102_341 79
243 3300046460 Ga0495638_0202337 Ga0495638_0202337_581_823 79
244 3300046522 Ga0495643_0377531 Ga0495643_0377531_133_375 79
245 3300046615 Ga0495656_0000843 Ga0495656_0000843_7526_7765 79
246 3300047318 Ga0495636_0003708 Ga0495636_0003708_985_1224 79
247 3300048903 Ga0496100_0187620 Ga0496100_0187620_1147_1389 79
248 3300048903 Ga0496100_1035426 Ga0496100_1035426_39_281 79
249 3300048904 Ga0496101_1310068 Ga0496101_1310068_307_549 79
250 3300048908 Ga0496105_0618869 Ga0496105_0618869_546_788 79
251 3300048911 Ga0496108_0013046 Ga0496108_0013046_3522_3764 79
252 3300048912 Ga0496109_0554441 Ga0496109_0554441_269_511 79
253 3300048912 Ga0496109_0611698 Ga0496109_0611698_83_325 79
254 3300048915 Ga0496112_0049966 Ga0496112_0049966_364_606 79
255 3300048916 Ga0496113_0015849 Ga0496113_0015849_246_488 79
256 3300049513 Ga0501290_000954 Ga0501290_000954_3697_3936 79
257 3300049523 Ga0501300_020371 Ga0501300_020371_423_662 79
258 3300049568 Ga0501031_0066151 Ga0501031_0066151_1993_2235 79
259 3300049569 Ga0501032_0047295 Ga0501032_0047295_2473_2715 79
260 3300049569 Ga0501032_0085984 Ga0501032_0085984_10_252 79
261 3300049570 Ga0501033_0250148 Ga0501033_0250148_272_514 79
262 3300049571 Ga0501034_0517432 Ga0501034_0517432_743_985 79
263 3300049572 Ga0501036_1346133 Ga0501036_1346133_148_390 79
264 3300049573 Ga0501037_0309975 Ga0501037_0309975_382_624 79
265 3300049575 Ga0501039_0059402 Ga0501039_0059402_133_375 79
266 3300049579 Ga0501043_0001953 Ga0501043_0001953_10450_10689 79
267 3300049579 Ga0501043_0032273 Ga0501043_0032273_636_878 79
268 3300049581 Ga0501047_0230843 Ga0501047_0230843_289_531 79
269 3300049586 Ga0501070_0408149 Ga0501070_0408149_46_288 79
270 3300049586 Ga0501070_1113888 Ga0501070_1113888_46_288 79
271 3300049705 Ga0501225_0003691 Ga0501225_0003691_1402_1644 79
272 3300049762 Ga0501265_000288 Ga0501265_000288_1875_2114 79
273 3300049773 Ga0501276_026751 Ga0501276_026751_144_383 79
274 3300049822 Ga0501035_0078536 Ga0501035_0078536_1231_1473 79
275 3300049823 Ga0501044_0100640 Ga0501044_0100640_2054_2296 79
276 3300050491 nmdc:mga00v17_230224_c1 nmdc:mga00v17_230224_c1_467_709 79
277 3300050491 nmdc:mga00v17_248665_c1 nmdc:mga00v17_248665_c1_157_399 79
278 3300050491 nmdc:mga00v17_484369_c1 nmdc:mga00v17_484369_c1_139_381 79
279 3300053178 Ga0500637_0407442 Ga0500637_0407442_316_555 79

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

7

81

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jc0-assembly1.cif.gz_A structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8718 2 79
6jbz-assembly1.cif.gz_D structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8654 2 79
6jc0-assembly1.cif.gz_A structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8519 2 79
6jbz-assembly1.cif.gz_D structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8458 2 79
1vjk-assembly1.cif.gz_A putative molybdopterin converting factor, subunit 1 from pyrococcus furiosus, pfu-562899-001 0.8398 1 76
ID Description Score Start End Superfamily
af_I6XWG2_11_92_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8503 3 79 3.10.20.30
af_P0C919_9_90_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8416 4 79 3.10.20.30
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8365 1 76 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.834 5 76 3.10.20.30
1vjkA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8298 1 77 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A3D2A1Q5-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9864 3 79 GO:0000166
GO:0006777
GO:1990133
AF-A0A3M8SVZ1-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9859 2 79 GO:0000166
GO:0006777
GO:1990133
AF-A0A0S7Z8A9-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.983 1 79 GO:0000166
GO:0006777
GO:1990133
AF-K9RT74-F1-model_v4 Molybdopterin converting factor, subunit 1 0.9808 1 79
AF-Q2JXS8-F1-model_v4 Putative molybdopterin converting factor, subunit 1 0.9806 2 79

Feature Viewer

pLDDT pTM Quality
95.48 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map