F382885
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 279 | 179 | 279 | 328 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_100203029|Ga0070713_1002030292 |
| Length | 345 |
| Sequence | MKPVLGTQYSVASYTLEGSLFMLRKLYLQCLILSVGLAAPAQESRHFTFHYGFTVKNLPAGKRVRIWIPAAQSDAYQDVKVFSALGDLPLKHTHESRYGNEMYFAETRHLVGSELHFDIEYEVTRRERVALRPSPQLSTVALTRRERHDDLQPDALVPITGLPAELAVKVTQGRAQPLDKARAIYDYVFTTLRYDKTGTGWGRGDVRYACDAKKGNCTDFHSLFIAMARSQGIPARFEIGFPLPTDKHSGEIAGYHCWSDFYIDGKGWVPVDVSEAWKHPEKRDYFFGSHDVNRVQFSMGRDLRLSPPQDGKLLNYFVYPYVEVDGKDYPNVSLEFAFQDVGPVM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 47 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 70 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 71 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 72 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 73 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 74 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 120 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 124 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 125 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 126 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 127 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 128 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 129 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 130 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 131 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 132 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 133 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 134 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 135 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 136 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 137 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 138 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 139 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 140 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 141 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 142 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 143 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 146 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 147 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 162 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 163 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 164 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 165 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 166 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 168 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 169 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 170 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 171 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.49 |
| Metatranscriptomes | 2.51 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.09 |
| Rhizosphere | 93.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100186874 | 3300005329 | Unclassified | 1967 |
| 2 | Ga0070690_100032211 | 3300005330 | Bacteria | 3272 |
| 3 | Ga0068869_100034119 | 3300005334 | Unclassified | 3598 |
| 4 | Ga0070680_100010017 | 3300005336 | Bacteria | 7302 |
| 5 | Ga0070660_100013662 | 3300005339 | Bacteria | 5835 |
| 6 | Ga0070689_100405612 | 3300005340 | Bacteria | 1153 |
| 7 | Ga0070661_100024341 | 3300005344 | Bacteria | 4343 |
| 8 | Ga0070668_100020678 | 3300005347 | Bacteria | 4969 |
| 9 | Ga0070674_100132840 | 3300005356 | Unclassified | 1858 |
| 10 | Ga0070667_100033965 | 3300005367 | Bacteria | 4266 |
| 11 | Ga0070709_10059865 | 3300005434 | Bacteria | 2419 |
| 12 | Ga0070714_100000060 | 3300005435 | Bacteria | 100913 |
| 13 | Ga0070714_100049580 | 3300005435 | Bacteria | 3574 |
| 14 | Ga0070714_100456542 | 3300005435 | Unclassified | 1214 |
| 15 | Ga0070713_100014443 | 3300005436 | Bacteria | 5866 |
| 16 | Ga0070713_100090024 | 3300005436 | Bacteria | 2637 |
| 17 | Ga0070713_100165924 | 3300005436 | Bacteria | 1975 |
| 18 | Ga0070713_100203029 | 3300005436 | Unclassified | 1791 |
| 19 | Ga0070710_10006940 | 3300005437 | Bacteria | 5462 |
| 20 | Ga0070711_100000231 | 3300005439 | Bacteria | 29031 |
| 21 | Ga0070711_100007008 | 3300005439 | Bacteria | 6839 |
| 22 | Ga0070711_100023564 | 3300005439 | Bacteria | 4006 |
| 23 | Ga0070708_100016411 | 3300005445 | Bacteria | 6144 |
| 24 | Ga0070708_100024442 | 3300005445 | Bacteria | 5156 |
| 25 | Ga0070708_100061902 | 3300005445 | Bacteria | 3345 |
| 26 | Ga0070708_100095273 | 3300005445 | Bacteria | 2717 |
| 27 | Ga0070708_100284906 | 3300005445 | Bacteria | 1555 |
| 28 | Ga0070662_100001140 | 3300005457 | Bacteria | 16274 |
| 29 | Ga0070681_10066734 | 3300005458 | Bacteria | 3567 |
| 30 | Ga0068867_100002521 | 3300005459 | Bacteria | 12881 |
| 31 | Ga0070706_100001310 | 3300005467 | Bacteria | 26450 |
| 32 | Ga0070706_100068756 | 3300005467 | Bacteria | 3275 |
| 33 | Ga0070706_100097260 | 3300005467 | Bacteria | 2734 |
| 34 | Ga0070707_100003053 | 3300005468 | Bacteria | 15870 |
| 35 | Ga0070707_100074260 | 3300005468 | Unclassified | 3279 |
| 36 | Ga0070698_100010712 | 3300005471 | Bacteria | 9765 |
| 37 | Ga0070698_100023404 | 3300005471 | Bacteria | 6457 |
| 38 | Ga0070699_100011779 | 3300005518 | Bacteria | 7547 |
| 39 | Ga0070699_100029873 | 3300005518 | Bacteria | 4701 |
| 40 | Ga0070679_100261890 | 3300005530 | Bacteria | 1684 |
| 41 | Ga0070684_100123393 | 3300005535 | Unclassified | 2331 |
| 42 | Ga0070697_100000108 | 3300005536 | Bacteria | 64148 |
| 43 | Ga0070697_100000336 | 3300005536 | Bacteria | 37001 |
| 44 | Ga0068853_100014375 | 3300005539 | Bacteria | 6481 |
| 45 | Ga0070672_100114545 | 3300005543 | Bacteria | 2201 |
| 46 | Ga0070686_100058369 | 3300005544 | Bacteria | 2483 |
| 47 | Ga0070665_100016599 | 3300005548 | Bacteria | 7381 |
| 48 | Ga0068857_100061420 | 3300005577 | Bacteria | 3338 |
| 49 | Ga0068854_100020547 | 3300005578 | Bacteria | 4470 |
| 50 | Ga0068856_100584152 | 3300005614 | Bacteria | 1138 |
| 51 | Ga0068852_100030846 | 3300005616 | Bacteria | 4418 |
| 52 | Ga0068859_100040390 | 3300005617 | Bacteria | 4683 |
| 53 | Ga0068864_100094645 | 3300005618 | Unclassified | 2640 |
| 54 | Ga0068851_10076967 | 3300005834 | Bacteria | 1736 |
| 55 | Ga0068858_100030044 | 3300005842 | Bacteria | 5045 |
| 56 | Ga0068860_100128137 | 3300005843 | Unclassified | 2433 |
| 57 | Ga0070717_10001814 | 3300006028 | Bacteria | 14923 |
| 58 | Ga0070717_10003194 | 3300006028 | Bacteria | 11706 |
| 59 | Ga0070717_10008520 | 3300006028 | Bacteria | 7659 |
| 60 | Ga0070717_10027506 | 3300006028 | Bacteria | 4546 |
| 61 | Ga0070717_10054868 | 3300006028 | Bacteria | 3287 |
| 62 | Ga0070715_10013704 | 3300006163 | Bacteria | 2984 |
| 63 | Ga0070716_100010952 | 3300006173 | Bacteria | 4563 |
| 64 | Ga0070716_100117496 | 3300006173 | Unclassified | 1659 |
| 65 | Ga0070712_100000057 | 3300006175 | Bacteria | 56727 |
| 66 | Ga0070712_100024140 | 3300006175 | Bacteria | 4025 |
| 67 | Ga0070712_100158631 | 3300006175 | Bacteria | 1745 |
| 68 | Ga0070712_100190489 | 3300006175 | Unclassified | 1605 |
| 69 | Ga0070712_100255564 | 3300006175 | Unclassified | 1402 |
| 70 | Ga0097621_100005252 | 3300006237 | Bacteria | 9114 |
| 71 | Ga0097621_100038344 | 3300006237 | Bacteria | 3845 |
| 72 | Ga0068871_100027499 | 3300006358 | Bacteria | 4450 |
| 73 | Ga0068871_100031717 | 3300006358 | Bacteria | 4169 |
| 74 | Ga0068871_100176961 | 3300006358 | Bacteria | 1832 |
| 75 | Ga0075434_100021868 | 3300006871 | Bacteria | 6225 |
| 76 | Ga0075436_100001616 | 3300006914 | Bacteria | 15424 |
| 77 | Ga0075436_100022991 | 3300006914 | Bacteria | 4283 |
| 78 | Ga0097620_100040385 | 3300006931 | Bacteria | 4683 |
| 79 | Ga0105240_10028317 | 3300009093 | Bacteria | 7320 |
| 80 | Ga0105240_10216868 | 3300009093 | Bacteria | 2232 |
| 81 | Ga0105240_10572781 | 3300009093 | Unclassified | 1246 |
| 82 | Ga0105245_10133917 | 3300009098 | Bacteria | 2327 |
| 83 | Ga0105245_10162157 | 3300009098 | Unclassified | 2122 |
| 84 | Ga0105245_10380254 | 3300009098 | Bacteria | 1406 |
| 85 | Ga0105247_10084652 | 3300009101 | Bacteria | 2004 |
| 86 | Ga0105243_10022056 | 3300009148 | Bacteria | 4838 |
| 87 | Ga0105241_10031195 | 3300009174 | Unclassified | 3990 |
| 88 | Ga0105242_10028821 | 3300009176 | Bacteria | 4422 |
| 89 | Ga0105248_10006235 | 3300009177 | Bacteria | 13073 |
| 90 | Ga0105248_10379032 | 3300009177 | Bacteria | 1593 |
| 91 | Ga0105237_10234849 | 3300009545 | Bacteria | 1835 |
| 92 | Ga0105237_10290896 | 3300009545 | Bacteria | 1636 |
| 93 | Ga0105237_10386763 | 3300009545 | Unclassified | 1404 |
| 94 | Ga0105238_10004823 | 3300009551 | Bacteria | 13343 |
| 95 | Ga0105249_10002573 | 3300009553 | Bacteria | 15693 |
| 96 | Ga0157373_10073455 | 3300013100 | Unclassified | 2413 |
| 97 | Ga0157369_10011811 | 3300013105 | Bacteria | 9919 |
| 98 | Ga0157369_10050104 | 3300013105 | Bacteria | 4524 |
| 99 | Ga0157369_10205243 | 3300013105 | Bacteria | 2067 |
| 100 | Ga0157374_10078017 | 3300013296 | Bacteria | 3136 |
| 101 | Ga0157374_10108830 | 3300013296 | Bacteria | 2664 |
| 102 | Ga0157374_10214661 | 3300013296 | Bacteria | 1887 |
| 103 | Ga0157374_10373278 | 3300013296 | Bacteria | 1420 |
| 104 | Ga0157378_10071529 | 3300013297 | Bacteria | 3115 |
| 105 | Ga0157378_10090821 | 3300013297 | Bacteria | 2776 |
| 106 | Ga0157378_10186386 | 3300013297 | Unclassified | 1955 |
| 107 | Ga0163162_10024585 | 3300013306 | Bacteria | 5948 |
| 108 | Ga0163162_10127136 | 3300013306 | Unclassified | 2656 |
| 109 | Ga0157372_10000416 | 3300013307 | Bacteria | 46749 |
| 110 | Ga0157372_10015070 | 3300013307 | Bacteria | 8275 |
| 111 | Ga0157372_10038984 | 3300013307 | Bacteria | 5244 |
| 112 | Ga0157372_10161994 | 3300013307 | Bacteria | 2585 |
| 113 | Ga0157372_10749323 | 3300013307 | Unclassified | 1136 |
| 114 | Ga0157375_10053310 | 3300013308 | Bacteria | 3979 |
| 115 | Ga0163163_10071962 | 3300014325 | Bacteria | 3446 |
| 116 | Ga0157379_10001621 | 3300014968 | Bacteria | 18558 |
| 117 | Ga0157379_10041765 | 3300014968 | Bacteria | 4093 |
| 118 | Ga0157376_10139255 | 3300014969 | Bacteria | 2175 |
| 119 | Ga0182005_1027995 | 3300015265 | Unclassified | 1537 |
| 120 | Ga0224569_100079 | 3300022732 | Bacteria | 6430 |
| 121 | Ga0224571_101364 | 3300022734 | Bacteria | 1523 |
| 122 | Ga0224572_1000721 | 3300024225 | Bacteria | 4268 |
| 123 | Ga0224572_1018626 | 3300024225 | Unclassified | 1334 |
| 124 | Ga0228598_1006765 | 3300024227 | Unclassified | 2362 |
| 125 | Ga0228598_1010318 | 3300024227 | Bacteria | 1861 |
| 126 | Ga0207692_10027501 | 3300025898 | Bacteria | 2680 |
| 127 | Ga0207692_10207066 | 3300025898 | Unclassified | 1156 |
| 128 | Ga0207710_10114308 | 3300025900 | Unclassified | 1284 |
| 129 | Ga0207680_10041575 | 3300025903 | Unclassified | 2683 |
| 130 | Ga0207699_10037195 | 3300025906 | Bacteria | 2781 |
| 131 | Ga0207699_10269116 | 3300025906 | Bacteria | 1180 |
| 132 | Ga0207645_10028347 | 3300025907 | Bacteria | 3615 |
| 133 | Ga0207684_10000607 | 3300025910 | Bacteria | 42607 |
| 134 | Ga0207684_10000621 | 3300025910 | Bacteria | 42216 |
| 135 | Ga0207684_10035393 | 3300025910 | Bacteria | 4240 |
| 136 | Ga0207684_10075375 | 3300025910 | Bacteria | 2867 |
| 137 | Ga0207654_10013901 | 3300025911 | Bacteria | 4149 |
| 138 | Ga0207707_10024077 | 3300025912 | Bacteria | 5324 |
| 139 | Ga0207695_10012559 | 3300025913 | Bacteria | 10151 |
| 140 | Ga0207695_10060907 | 3300025913 | Bacteria | 3904 |
| 141 | Ga0207671_10053701 | 3300025914 | Unclassified | 2986 |
| 142 | Ga0207693_10000850 | 3300025915 | Bacteria | 27261 |
| 143 | Ga0207693_10033563 | 3300025915 | Bacteria | 4050 |
| 144 | Ga0207663_10000480 | 3300025916 | Bacteria | 17362 |
| 145 | Ga0207663_10024972 | 3300025916 | Bacteria | 3448 |
| 146 | Ga0207657_10004889 | 3300025919 | Bacteria | 14096 |
| 147 | Ga0207649_10010662 | 3300025920 | Bacteria | 5054 |
| 148 | Ga0207652_10378730 | 3300025921 | Unclassified | 1277 |
| 149 | Ga0207646_10003520 | 3300025922 | Bacteria | 17641 |
| 150 | Ga0207646_10034525 | 3300025922 | Unclassified | 4571 |
| 151 | Ga0207646_10553325 | 3300025922 | Unclassified | 1034 |
| 152 | Ga0207694_10036509 | 3300025924 | Bacteria | 3772 |
| 153 | Ga0207687_10090269 | 3300025927 | Bacteria | 2232 |
| 154 | Ga0207700_10000467 | 3300025928 | Bacteria | 23733 |
| 155 | Ga0207700_10057503 | 3300025928 | Unclassified | 2933 |
| 156 | Ga0207700_10070352 | 3300025928 | Bacteria | 2689 |
| 157 | Ga0207700_10076918 | 3300025928 | Bacteria | 2591 |
| 158 | Ga0207700_10197748 | 3300025928 | Unclassified | 1693 |
| 159 | Ga0207664_10000017 | 3300025929 | Bacteria | 230967 |
| 160 | Ga0207664_10029014 | 3300025929 | Bacteria | 4212 |
| 161 | Ga0207664_10221679 | 3300025929 | Unclassified | 1640 |
| 162 | Ga0207664_10336582 | 3300025929 | Unclassified | 1334 |
| 163 | Ga0207690_10265986 | 3300025932 | Unclassified | 1330 |
| 164 | Ga0207706_10000532 | 3300025933 | Bacteria | 40449 |
| 165 | Ga0207686_10032631 | 3300025934 | Unclassified | 3101 |
| 166 | Ga0207669_10287128 | 3300025937 | Bacteria | 1244 |
| 167 | Ga0207665_10012820 | 3300025939 | Bacteria | 5512 |
| 168 | Ga0207665_10031184 | 3300025939 | Bacteria | 3527 |
| 169 | Ga0207691_10119371 | 3300025940 | Bacteria | 2338 |
| 170 | Ga0207711_10008364 | 3300025941 | Bacteria | 8658 |
| 171 | Ga0207689_10043140 | 3300025942 | Bacteria | 3728 |
| 172 | Ga0207689_10443039 | 3300025942 | Bacteria | 1085 |
| 173 | Ga0207679_10072310 | 3300025945 | Unclassified | 2604 |
| 174 | Ga0207667_10005965 | 3300025949 | Bacteria | 14832 |
| 175 | Ga0207668_10032869 | 3300025972 | Unclassified | 3433 |
| 176 | Ga0207640_10035967 | 3300025981 | Bacteria | 3104 |
| 177 | Ga0207658_10033012 | 3300025986 | Bacteria | 3689 |
| 178 | Ga0207677_10004912 | 3300026023 | Bacteria | 7219 |
| 179 | Ga0207677_10153896 | 3300026023 | Bacteria | 1778 |
| 180 | Ga0207703_10155806 | 3300026035 | Bacteria | 1996 |
| 181 | Ga0207639_10018994 | 3300026041 | Bacteria | 4894 |
| 182 | Ga0207678_10002529 | 3300026067 | Bacteria | 16668 |
| 183 | Ga0207702_10089500 | 3300026078 | Unclassified | 2692 |
| 184 | Ga0207702_10399845 | 3300026078 | Bacteria | 1325 |
| 185 | Ga0207648_10006426 | 3300026089 | Bacteria | 11681 |
| 186 | Ga0207648_10308804 | 3300026089 | Bacteria | 1419 |
| 187 | Ga0207676_10059481 | 3300026095 | Unclassified | 3018 |
| 188 | Ga0207674_10200514 | 3300026116 | Bacteria | 1945 |
| 189 | Ga0207675_100020789 | 3300026118 | Bacteria | 6119 |
| 190 | Ga0207698_10010353 | 3300026142 | Bacteria | 5984 |
| 191 | Ga0268266_10119173 | 3300028379 | Bacteria | 2347 |
| 192 | Ga0268264_10146607 | 3300028381 | Bacteria | 2111 |
| 193 | Ga0265338_10029405 | 3300028800 | Bacteria | 5448 |
| 194 | Ga0265338_10061987 | 3300028800 | Bacteria | 3273 |
| 195 | Ga0265762_1000097 | 3300030760 | Bacteria | 12380 |
| 196 | Ga0265762_1000380 | 3300030760 | Bacteria | 7597 |
| 197 | Ga0265765_1003240 | 3300030879 | Bacteria | 1623 |
| 198 | Ga0265760_10000112 | 3300031090 | Bacteria | 20679 |
| 199 | Ga0265760_10000813 | 3300031090 | Bacteria | 8994 |
| 200 | Ga0265760_10001941 | 3300031090 | Bacteria | 6068 |
| 201 | Ga0265760_10008435 | 3300031090 | Bacteria | 2947 |
| 202 | Ga0265325_10007786 | 3300031241 | Bacteria | 6381 |
| 203 | Ga0265339_10036997 | 3300031249 | Bacteria | 2729 |
| 204 | Ga0265316_10002195 | 3300031344 | Bacteria | 20507 |
| 205 | Ga0265314_10001900 | 3300031711 | Bacteria | 22356 |
| 206 | Ga0265314_10131589 | 3300031711 | Unclassified | 1560 |
| 207 | Ga0373950_0025761 | 3300034818 | Unclassified | 1064 |
| 208 | Ga0373926_0003464 | 3300035083 | Bacteria | 5094 |
| 209 | Ga0373923_0010883 | 3300035111 | Bacteria | 3323 |
| 210 | Ga0373939_0047689 | 3300035114 | Unclassified | 1317 |
| 211 | Ga0373945_0029128 | 3300035116 | Bacteria | 1938 |
| 212 | Ga0373953_0015081 | 3300035117 | Bacteria | 2792 |
| 213 | Ga0373954_0011634 | 3300035118 | Bacteria | 3903 |
| 214 | Ga0373960_0041705 | 3300035121 | Unclassified | 1330 |
| 215 | Ga0373943_0002055 | 3300035170 | Bacteria | 9132 |
| 216 | Ga0373946_0042269 | 3300035171 | Bacteria | 1873 |
| 217 | Ga0373955_0021273 | 3300035172 | Bacteria | 3272 |
| 218 | Ga0373962_0011402 | 3300035242 | Bacteria | 2229 |
| 219 | Ga0373935_0006094 | 3300035692 | Bacteria | 7168 |
| 220 | Ga0373935_0026098 | 3300035692 | Unclassified | 3603 |
| 221 | Ga0373927_0000085 | 3300035695 | Bacteria | 70359 |
| 222 | Ga0373927_0106606 | 3300035695 | Unclassified | 1825 |
| 223 | Ga0373933_0070195 | 3300035724 | Bacteria | 2130 |
| 224 | Ga0373933_0090958 | 3300035724 | Unclassified | 1883 |
| 225 | Ga0373933_0166763 | 3300035724 | Unclassified | 1400 |
| 226 | Ga0373947_0003047 | 3300035725 | Bacteria | 9968 |
| 227 | Ga0373947_0038042 | 3300035725 | Bacteria | 2856 |
| 228 | Ga0373947_0041201 | 3300035725 | Bacteria | 2753 |
| 229 | Ga0373947_0111372 | 3300035725 | Bacteria | 1730 |
| 230 | Ga0373937_0060676 | 3300036401 | Bacteria | 3475 |
| 231 | Ga0373925_0074384 | 3300037068 | Unclassified | 2573 |
| 232 | Ga0373925_0077790 | 3300037068 | Bacteria | 2518 |
| 233 | Ga0451576_0442133 | 3300045051 | Bacteria | 1365 |
| 234 | Ga0451576_0507284 | 3300045051 | Bacteria | 1267 |
| 235 | Ga0466967_0212125 | 3300045976 | Unclassified | 1837 |
| 236 | Ga0495629_0012343 | 3300046459 | Bacteria | 6185 |
| 237 | Ga0495580_0000655 | 3300046472 | Bacteria | 29380 |
| 238 | Ga0495580_0003361 | 3300046472 | Bacteria | 13673 |
| 239 | Ga0495580_0194227 | 3300046472 | Bacteria | 1399 |
| 240 | Ga0495582_0048294 | 3300046473 | Bacteria | 2344 |
| 241 | Ga0495664_0008691 | 3300046477 | Bacteria | 5669 |
| 242 | Ga0495664_0104539 | 3300046477 | Unclassified | 1707 |
| 243 | Ga0495665_0028868 | 3300046531 | Unclassified | 2972 |
| 244 | Ga0495645_0035850 | 3300046543 | Bacteria | 3617 |
| 245 | Ga0495599_0159995 | 3300046678 | Unclassified | 1392 |
| 246 | Ga0495623_0051711 | 3300046679 | Bacteria | 2598 |
| 247 | Ga0495658_0070196 | 3300046683 | Bacteria | 2032 |
| 248 | Ga0495669_0142962 | 3300046684 | Bacteria | 1130 |
| 249 | Ga0495674_0002028 | 3300047319 | Bacteria | 19892 |
| 250 | Ga0495674_0015346 | 3300047319 | Bacteria | 7166 |
| 251 | Ga0495602_0041527 | 3300048088 | Bacteria | 4200 |
| 252 | Ga0496100_0366704 | 3300048903 | Bacteria | 1091 |
| 253 | Ga0496101_0231914 | 3300048904 | Bacteria | 1435 |
| 254 | Ga0496102_0002175 | 3300048905 | Bacteria | 16841 |
| 255 | Ga0496102_0136364 | 3300048905 | Bacteria | 2300 |
| 256 | Ga0496102_0180040 | 3300048905 | Bacteria | 1991 |
| 257 | Ga0496103_0004438 | 3300048906 | Bacteria | 8510 |
| 258 | Ga0496105_0068723 | 3300048908 | Bacteria | 2927 |
| 259 | Ga0496105_0152802 | 3300048908 | Bacteria | 1897 |
| 260 | Ga0496105_0195667 | 3300048908 | Bacteria | 1652 |
| 261 | Ga0496106_0013763 | 3300048909 | Bacteria | 5976 |
| 262 | Ga0496107_0140466 | 3300048910 | Bacteria | 1785 |
| 263 | Ga0496108_0249281 | 3300048911 | Bacteria | 1545 |
| 264 | Ga0496111_0238638 | 3300048914 | Unclassified | 1350 |
| 265 | Ga0496112_0255985 | 3300048915 | Unclassified | 1701 |
| 266 | Ga0496114_0016216 | 3300048917 | Bacteria | 5999 |
| 267 | Ga0496115_0006988 | 3300048918 | Bacteria | 8291 |
| 268 | Ga0496115_0053572 | 3300048918 | Bacteria | 3238 |
| 269 | Ga0501033_0067330 | 3300049570 | Bacteria | 2633 |
| 270 | Ga0501034_0000258 | 3300049571 | Bacteria | 95869 |
| 271 | Ga0501037_0116422 | 3300049573 | Bacteria | 1923 |
| 272 | Ga0501038_0000185 | 3300049574 | Bacteria | 53588 |
| 273 | Ga0501080_0085181 | 3300049742 | Bacteria | 2937 |
| 274 | Ga0501044_0052446 | 3300049823 | Bacteria | 4203 |
| 275 | nmdc:mga08x19_3589_c1 | 3300050514 | Bacteria | 9229 |
| 276 | nmdc:mga08x19_3944_c1 | 3300050514 | Bacteria | 8837 |
| 277 | nmdc:mga08x19_39919_c1 | 3300050514 | Bacteria | 2985 |
| 278 | Ga0495601_0122300 | 3300053077 | Unclassified | 1691 |
| 279 | Ga0495619_0092227 | 3300053085 | Bacteria | 2052 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048908 | Ga0496105_0152802 | Ga0496105_0152802_21_884 | 245 |
| 2 | 3300034818 | Ga0373950_0025761 | Ga0373950_0025761_164_1021 | 285 |
| 3 | 3300045051 | Ga0451576_0442133 | Ga0451576_0442133_443_1300 | 285 |
| 4 | 3300046679 | Ga0495623_0051711 | Ga0495623_0051711_1614_2483 | 289 |
| 5 | 3300053085 | Ga0495619_0092227 | Ga0495619_0092227_38_922 | 294 |
| 6 | 3300005435 | Ga0070714_100456542 | Ga0070714_1004565421 | 305 |
| 7 | 3300005436 | Ga0070713_100090024 | Ga0070713_1000900243 | 305 |
| 8 | 3300025929 | Ga0207664_10336582 | Ga0207664_103365821 | 305 |
| 9 | 3300005467 | Ga0070706_100097260 | Ga0070706_1000972602 | 313 |
| 10 | 3300005518 | Ga0070699_100011779 | Ga0070699_1000117794 | 313 |
| 11 | 3300025910 | Ga0207684_10000607 | Ga0207684_1000060714 | 313 |
| 12 | 3300005445 | Ga0070708_100095273 | Ga0070708_1000952732 | 314 |
| 13 | 3300005468 | Ga0070707_100003053 | Ga0070707_10000305311 | 314 |
| 14 | 3300005471 | Ga0070698_100023404 | Ga0070698_1000234043 | 314 |
| 15 | 3300025922 | Ga0207646_10003520 | Ga0207646_100035209 | 314 |
| 16 | 3300049571 | Ga0501034_0000258 | Ga0501034_0000258_37829_38851 | 314 |
| 17 | 3300049573 | Ga0501037_0116422 | Ga0501037_0116422_676_1698 | 314 |
| 18 | 3300049742 | Ga0501080_0085181 | Ga0501080_0085181_1386_2408 | 314 |
| 19 | 3300049823 | Ga0501044_0052446 | Ga0501044_0052446_641_1663 | 314 |
| 20 | 3300005445 | Ga0070708_100016411 | Ga0070708_1000164116 | 318 |
| 21 | 3300005467 | Ga0070706_100068756 | Ga0070706_1000687563 | 318 |
| 22 | 3300005518 | Ga0070699_100029873 | Ga0070699_1000298734 | 318 |
| 23 | 3300013105 | Ga0157369_10011811 | Ga0157369_100118119 | 318 |
| 24 | 3300025910 | Ga0207684_10075375 | Ga0207684_100753754 | 318 |
| 25 | 3300025922 | Ga0207646_10553325 | Ga0207646_105533251 | 318 |
| 26 | 3300006358 | Ga0068871_100176961 | Ga0068871_1001769614 | 319 |
| 27 | 3300035725 | Ga0373947_0038042 | Ga0373947_0038042_173_1165 | 323 |
| 28 | 3300049570 | Ga0501033_0067330 | Ga0501033_0067330_602_1627 | 323 |
| 29 | 3300049574 | Ga0501038_0000185 | Ga0501038_0000185_13851_14876 | 323 |
| 30 | 3300005434 | Ga0070709_10059865 | Ga0070709_100598653 | 324 |
| 31 | 3300005436 | Ga0070713_100203029 | Ga0070713_1002030292 | 324 |
| 32 | 3300005439 | Ga0070711_100023564 | Ga0070711_1000235642 | 324 |
| 33 | 3300005458 | Ga0070681_10066734 | Ga0070681_100667345 | 324 |
| 34 | 3300006173 | Ga0070716_100117496 | Ga0070716_1001174961 | 324 |
| 35 | 3300006175 | Ga0070712_100024140 | Ga0070712_1000241402 | 324 |
| 36 | 3300006175 | Ga0070712_100190489 | Ga0070712_1001904892 | 324 |
| 37 | 3300006914 | Ga0075436_100001616 | Ga0075436_1000016168 | 324 |
| 38 | 3300006914 | Ga0075436_100022991 | Ga0075436_1000229914 | 324 |
| 39 | 3300009093 | Ga0105240_10028317 | Ga0105240_100283177 | 324 |
| 40 | 3300009545 | Ga0105237_10386763 | Ga0105237_103867632 | 324 |
| 41 | 3300013105 | Ga0157369_10205243 | Ga0157369_102052432 | 324 |
| 42 | 3300013307 | Ga0157372_10161994 | Ga0157372_101619943 | 324 |
| 43 | 3300013307 | Ga0157372_10749323 | Ga0157372_107493231 | 324 |
| 44 | 3300015265 | Ga0182005_1027995 | Ga0182005_10279952 | 324 |
| 45 | 3300025898 | Ga0207692_10207066 | Ga0207692_102070661 | 324 |
| 46 | 3300025906 | Ga0207699_10037195 | Ga0207699_100371952 | 324 |
| 47 | 3300025915 | Ga0207693_10033563 | Ga0207693_100335633 | 324 |
| 48 | 3300025916 | Ga0207663_10024972 | Ga0207663_100249723 | 324 |
| 49 | 3300025928 | Ga0207700_10057503 | Ga0207700_100575033 | 324 |
| 50 | 3300025928 | Ga0207700_10197748 | Ga0207700_101977481 | 324 |
| 51 | 3300025929 | Ga0207664_10029014 | Ga0207664_100290144 | 324 |
| 52 | 3300025929 | Ga0207664_10221679 | Ga0207664_102216792 | 324 |
| 53 | 3300025939 | Ga0207665_10031184 | Ga0207665_100311842 | 324 |
| 54 | 3300026078 | Ga0207702_10089500 | Ga0207702_100895002 | 324 |
| 55 | 3300048915 | Ga0496112_0255985 | Ga0496112_0255985_627_1601 | 324 |
| 56 | 3300050514 | nmdc:mga08x19_3589_c1 | nmdc:mga08x19_3589_c1_2703_3698 | 324 |
| 57 | 3300050514 | nmdc:mga08x19_39919_c1 | nmdc:mga08x19_39919_c1_977_1972 | 324 |
| 58 | 3300009093 | Ga0105240_10572781 | Ga0105240_105727811 | 325 |
| 59 | 3300050514 | nmdc:mga08x19_3944_c1 | nmdc:mga08x19_3944_c1_3605_4582 | 325 |
| 60 | 3300013297 | Ga0157378_10186386 | Ga0157378_101863862 | 326 |
| 61 | 3300024225 | Ga0224572_1000721 | Ga0224572_10007213 | 326 |
| 62 | 3300024227 | Ga0228598_1010318 | Ga0228598_10103182 | 326 |
| 63 | 3300025906 | Ga0207699_10269116 | Ga0207699_102691161 | 326 |
| 64 | 3300030760 | Ga0265762_1000380 | Ga0265762_10003807 | 326 |
| 65 | 3300035083 | Ga0373926_0003464 | Ga0373926_0003464_1011_1991 | 326 |
| 66 | 3300035116 | Ga0373945_0029128 | Ga0373945_0029128_920_1900 | 326 |
| 67 | 3300035170 | Ga0373943_0002055 | Ga0373943_0002055_740_1720 | 326 |
| 68 | 3300035692 | Ga0373935_0006094 | Ga0373935_0006094_1096_2076 | 326 |
| 69 | 3300035695 | Ga0373927_0000085 | Ga0373927_0000085_34763_35743 | 326 |
| 70 | 3300035725 | Ga0373947_0003047 | Ga0373947_0003047_441_1421 | 326 |
| 71 | 3300046477 | Ga0495664_0008691 | Ga0495664_0008691_4482_5462 | 326 |
| 72 | 3300046543 | Ga0495645_0035850 | Ga0495645_0035850_1058_2038 | 326 |
| 73 | 3300047319 | Ga0495674_0002028 | Ga0495674_0002028_2338_3318 | 326 |
| 74 | 3300048088 | Ga0495602_0041527 | Ga0495602_0041527_2857_3837 | 326 |
| 75 | 3300005330 | Ga0070690_100032211 | Ga0070690_1000322112 | 327 |
| 76 | 3300005334 | Ga0068869_100034119 | Ga0068869_1000341193 | 327 |
| 77 | 3300005336 | Ga0070680_100010017 | Ga0070680_1000100176 | 327 |
| 78 | 3300005339 | Ga0070660_100013662 | Ga0070660_1000136621 | 327 |
| 79 | 3300005340 | Ga0070689_100405612 | Ga0070689_1004056121 | 327 |
| 80 | 3300005344 | Ga0070661_100024341 | Ga0070661_1000243414 | 327 |
| 81 | 3300005347 | Ga0070668_100020678 | Ga0070668_1000206782 | 327 |
| 82 | 3300005356 | Ga0070674_100132840 | Ga0070674_1001328402 | 327 |
| 83 | 3300005367 | Ga0070667_100033965 | Ga0070667_1000339652 | 327 |
| 84 | 3300005435 | Ga0070714_100000060 | Ga0070714_10000006054 | 327 |
| 85 | 3300005439 | Ga0070711_100007008 | Ga0070711_1000070083 | 327 |
| 86 | 3300005457 | Ga0070662_100001140 | Ga0070662_10000114016 | 327 |
| 87 | 3300005459 | Ga0068867_100002521 | Ga0068867_10000252110 | 327 |
| 88 | 3300005530 | Ga0070679_100261890 | Ga0070679_1002618902 | 327 |
| 89 | 3300005535 | Ga0070684_100123393 | Ga0070684_1001233931 | 327 |
| 90 | 3300005539 | Ga0068853_100014375 | Ga0068853_1000143756 | 327 |
| 91 | 3300005543 | Ga0070672_100114545 | Ga0070672_1001145452 | 327 |
| 92 | 3300005544 | Ga0070686_100058369 | Ga0070686_1000583692 | 327 |
| 93 | 3300005548 | Ga0070665_100016599 | Ga0070665_1000165992 | 327 |
| 94 | 3300005577 | Ga0068857_100061420 | Ga0068857_1000614203 | 327 |
| 95 | 3300005578 | Ga0068854_100020547 | Ga0068854_1000205473 | 327 |
| 96 | 3300005614 | Ga0068856_100584152 | Ga0068856_1005841521 | 327 |
| 97 | 3300005616 | Ga0068852_100030846 | Ga0068852_1000308462 | 327 |
| 98 | 3300005617 | Ga0068859_100040390 | Ga0068859_1000403902 | 327 |
| 99 | 3300005618 | Ga0068864_100094645 | Ga0068864_1000946453 | 327 |
| 100 | 3300005834 | Ga0068851_10076967 | Ga0068851_100769672 | 327 |
| 101 | 3300005842 | Ga0068858_100030044 | Ga0068858_1000300444 | 327 |
| 102 | 3300005843 | Ga0068860_100128137 | Ga0068860_1001281372 | 327 |
| 103 | 3300006028 | Ga0070717_10008520 | Ga0070717_100085203 | 327 |
| 104 | 3300006237 | Ga0097621_100005252 | Ga0097621_1000052522 | 327 |
| 105 | 3300006237 | Ga0097621_100038344 | Ga0097621_1000383442 | 327 |
| 106 | 3300006358 | Ga0068871_100027499 | Ga0068871_1000274992 | 327 |
| 107 | 3300006358 | Ga0068871_100031717 | Ga0068871_1000317175 | 327 |
| 108 | 3300006871 | Ga0075434_100021868 | Ga0075434_1000218682 | 327 |
| 109 | 3300006931 | Ga0097620_100040385 | Ga0097620_1000403852 | 327 |
| 110 | 3300009098 | Ga0105245_10133917 | Ga0105245_101339172 | 327 |
| 111 | 3300009098 | Ga0105245_10162157 | Ga0105245_101621572 | 327 |
| 112 | 3300009101 | Ga0105247_10084652 | Ga0105247_100846521 | 327 |
| 113 | 3300009148 | Ga0105243_10022056 | Ga0105243_100220563 | 327 |
| 114 | 3300009176 | Ga0105242_10028821 | Ga0105242_100288212 | 327 |
| 115 | 3300009177 | Ga0105248_10006235 | Ga0105248_100062352 | 327 |
| 116 | 3300009177 | Ga0105248_10379032 | Ga0105248_103790322 | 327 |
| 117 | 3300009545 | Ga0105237_10234849 | Ga0105237_102348492 | 327 |
| 118 | 3300009545 | Ga0105237_10290896 | Ga0105237_102908961 | 327 |
| 119 | 3300009551 | Ga0105238_10004823 | Ga0105238_1000482310 | 327 |
| 120 | 3300009553 | Ga0105249_10002573 | Ga0105249_100025731 | 327 |
| 121 | 3300013100 | Ga0157373_10073455 | Ga0157373_100734552 | 327 |
| 122 | 3300013105 | Ga0157369_10050104 | Ga0157369_100501043 | 327 |
| 123 | 3300013296 | Ga0157374_10078017 | Ga0157374_100780172 | 327 |
| 124 | 3300013296 | Ga0157374_10108830 | Ga0157374_101088302 | 327 |
| 125 | 3300013296 | Ga0157374_10373278 | Ga0157374_103732781 | 327 |
| 126 | 3300013297 | Ga0157378_10071529 | Ga0157378_100715293 | 327 |
| 127 | 3300013297 | Ga0157378_10090821 | Ga0157378_100908212 | 327 |
| 128 | 3300013306 | Ga0163162_10024585 | Ga0163162_100245853 | 327 |
| 129 | 3300013306 | Ga0163162_10127136 | Ga0163162_101271361 | 327 |
| 130 | 3300013307 | Ga0157372_10015070 | Ga0157372_100150707 | 327 |
| 131 | 3300013308 | Ga0157375_10053310 | Ga0157375_100533102 | 327 |
| 132 | 3300014325 | Ga0163163_10071962 | Ga0163163_100719623 | 327 |
| 133 | 3300014968 | Ga0157379_10041765 | Ga0157379_100417655 | 327 |
| 134 | 3300014969 | Ga0157376_10139255 | Ga0157376_101392551 | 327 |
| 135 | 3300025900 | Ga0207710_10114308 | Ga0207710_101143081 | 327 |
| 136 | 3300025903 | Ga0207680_10041575 | Ga0207680_100415752 | 327 |
| 137 | 3300025907 | Ga0207645_10028347 | Ga0207645_100283472 | 327 |
| 138 | 3300025911 | Ga0207654_10013901 | Ga0207654_100139012 | 327 |
| 139 | 3300025912 | Ga0207707_10024077 | Ga0207707_100240772 | 327 |
| 140 | 3300025913 | Ga0207695_10012559 | Ga0207695_100125598 | 327 |
| 141 | 3300025914 | Ga0207671_10053701 | Ga0207671_100537013 | 327 |
| 142 | 3300025919 | Ga0207657_10004889 | Ga0207657_100048897 | 327 |
| 143 | 3300025920 | Ga0207649_10010662 | Ga0207649_100106624 | 327 |
| 144 | 3300025921 | Ga0207652_10378730 | Ga0207652_103787301 | 327 |
| 145 | 3300025924 | Ga0207694_10036509 | Ga0207694_100365092 | 327 |
| 146 | 3300025927 | Ga0207687_10090269 | Ga0207687_100902692 | 327 |
| 147 | 3300025929 | Ga0207664_10000017 | Ga0207664_10000017170 | 327 |
| 148 | 3300025932 | Ga0207690_10265986 | Ga0207690_102659861 | 327 |
| 149 | 3300025933 | Ga0207706_10000532 | Ga0207706_1000053224 | 327 |
| 150 | 3300025934 | Ga0207686_10032631 | Ga0207686_100326313 | 327 |
| 151 | 3300025937 | Ga0207669_10287128 | Ga0207669_102871281 | 327 |
| 152 | 3300025940 | Ga0207691_10119371 | Ga0207691_101193711 | 327 |
| 153 | 3300025941 | Ga0207711_10008364 | Ga0207711_100083642 | 327 |
| 154 | 3300025942 | Ga0207689_10043140 | Ga0207689_100431403 | 327 |
| 155 | 3300025945 | Ga0207679_10072310 | Ga0207679_100723101 | 327 |
| 156 | 3300025949 | Ga0207667_10005965 | Ga0207667_1000596512 | 327 |
| 157 | 3300025972 | Ga0207668_10032869 | Ga0207668_100328692 | 327 |
| 158 | 3300025981 | Ga0207640_10035967 | Ga0207640_100359672 | 327 |
| 159 | 3300025986 | Ga0207658_10033012 | Ga0207658_100330121 | 327 |
| 160 | 3300026023 | Ga0207677_10004912 | Ga0207677_100049122 | 327 |
| 161 | 3300026023 | Ga0207677_10153896 | Ga0207677_101538962 | 327 |
| 162 | 3300026041 | Ga0207639_10018994 | Ga0207639_100189942 | 327 |
| 163 | 3300026067 | Ga0207678_10002529 | Ga0207678_100025292 | 327 |
| 164 | 3300026078 | Ga0207702_10399845 | Ga0207702_103998451 | 327 |
| 165 | 3300026089 | Ga0207648_10006426 | Ga0207648_100064266 | 327 |
| 166 | 3300026089 | Ga0207648_10308804 | Ga0207648_103088042 | 327 |
| 167 | 3300026095 | Ga0207676_10059481 | Ga0207676_100594811 | 327 |
| 168 | 3300026116 | Ga0207674_10200514 | Ga0207674_102005142 | 327 |
| 169 | 3300026118 | Ga0207675_100020789 | Ga0207675_1000207894 | 327 |
| 170 | 3300026142 | Ga0207698_10010353 | Ga0207698_100103533 | 327 |
| 171 | 3300028379 | Ga0268266_10119173 | Ga0268266_101191732 | 327 |
| 172 | 3300028381 | Ga0268264_10146607 | Ga0268264_101466071 | 327 |
| 173 | 3300028800 | Ga0265338_10029405 | Ga0265338_100294052 | 327 |
| 174 | 3300028800 | Ga0265338_10061987 | Ga0265338_100619873 | 327 |
| 175 | 3300031241 | Ga0265325_10007786 | Ga0265325_100077861 | 327 |
| 176 | 3300031249 | Ga0265339_10036997 | Ga0265339_100369972 | 327 |
| 177 | 3300035114 | Ga0373939_0047689 | Ga0373939_0047689_282_1265 | 327 |
| 178 | 3300035117 | Ga0373953_0015081 | Ga0373953_0015081_934_1917 | 327 |
| 179 | 3300035118 | Ga0373954_0011634 | Ga0373954_0011634_1078_2061 | 327 |
| 180 | 3300035121 | Ga0373960_0041705 | Ga0373960_0041705_107_1090 | 327 |
| 181 | 3300035172 | Ga0373955_0021273 | Ga0373955_0021273_958_1941 | 327 |
| 182 | 3300035242 | Ga0373962_0011402 | Ga0373962_0011402_126_1109 | 327 |
| 183 | 3300035724 | Ga0373933_0070195 | Ga0373933_0070195_733_1716 | 327 |
| 184 | 3300035725 | Ga0373947_0111372 | Ga0373947_0111372_457_1440 | 327 |
| 185 | 3300045051 | Ga0451576_0507284 | Ga0451576_0507284_182_1165 | 327 |
| 186 | 3300046472 | Ga0495580_0003361 | Ga0495580_0003361_12337_13320 | 327 |
| 187 | 3300046684 | Ga0495669_0142962 | Ga0495669_0142962_25_1008 | 327 |
| 188 | 3300048904 | Ga0496101_0231914 | Ga0496101_0231914_215_1198 | 327 |
| 189 | 3300048905 | Ga0496102_0180040 | Ga0496102_0180040_717_1700 | 327 |
| 190 | 3300048911 | Ga0496108_0249281 | Ga0496108_0249281_157_1140 | 327 |
| 191 | 3300048914 | Ga0496111_0238638 | Ga0496111_0238638_165_1148 | 327 |
| 192 | 3300048917 | Ga0496114_0016216 | Ga0496114_0016216_3763_4746 | 327 |
| 193 | 3300048918 | Ga0496115_0053572 | Ga0496115_0053572_195_1178 | 327 |
| 194 | 3300005471 | Ga0070698_100010712 | Ga0070698_1000107124 | 328 |
| 195 | 3300006173 | Ga0070716_100010952 | Ga0070716_1000109522 | 328 |
| 196 | 3300006175 | Ga0070712_100255564 | Ga0070712_1002555642 | 328 |
| 197 | 3300009098 | Ga0105245_10380254 | Ga0105245_103802541 | 328 |
| 198 | 3300009174 | Ga0105241_10031195 | Ga0105241_100311952 | 328 |
| 199 | 3300014968 | Ga0157379_10001621 | Ga0157379_1000162111 | 328 |
| 200 | 3300022732 | Ga0224569_100079 | Ga0224569_1000793 | 328 |
| 201 | 3300022734 | Ga0224571_101364 | Ga0224571_1013641 | 328 |
| 202 | 3300024225 | Ga0224572_1018626 | Ga0224572_10186261 | 328 |
| 203 | 3300024227 | Ga0228598_1006765 | Ga0228598_10067651 | 328 |
| 204 | 3300025910 | Ga0207684_10035393 | Ga0207684_100353934 | 328 |
| 205 | 3300025939 | Ga0207665_10012820 | Ga0207665_100128202 | 328 |
| 206 | 3300025942 | Ga0207689_10443039 | Ga0207689_104430391 | 328 |
| 207 | 3300026035 | Ga0207703_10155806 | Ga0207703_101558063 | 328 |
| 208 | 3300030760 | Ga0265762_1000097 | Ga0265762_10000977 | 328 |
| 209 | 3300031090 | Ga0265760_10008435 | Ga0265760_100084352 | 328 |
| 210 | 3300035111 | Ga0373923_0010883 | Ga0373923_0010883_454_1440 | 328 |
| 211 | 3300035171 | Ga0373946_0042269 | Ga0373946_0042269_262_1248 | 328 |
| 212 | 3300035692 | Ga0373935_0026098 | Ga0373935_0026098_2231_3217 | 328 |
| 213 | 3300035695 | Ga0373927_0106606 | Ga0373927_0106606_329_1315 | 328 |
| 214 | 3300035724 | Ga0373933_0166763 | Ga0373933_0166763_111_1097 | 328 |
| 215 | 3300035725 | Ga0373947_0041201 | Ga0373947_0041201_982_1968 | 328 |
| 216 | 3300036401 | Ga0373937_0060676 | Ga0373937_0060676_67_1053 | 328 |
| 217 | 3300037068 | Ga0373925_0074384 | Ga0373925_0074384_1023_2009 | 328 |
| 218 | 3300037068 | Ga0373925_0077790 | Ga0373925_0077790_1406_2392 | 328 |
| 219 | 3300046459 | Ga0495629_0012343 | Ga0495629_0012343_3625_4611 | 328 |
| 220 | 3300046472 | Ga0495580_0000655 | Ga0495580_0000655_23148_24134 | 328 |
| 221 | 3300046473 | Ga0495582_0048294 | Ga0495582_0048294_44_1030 | 328 |
| 222 | 3300046477 | Ga0495664_0104539 | Ga0495664_0104539_287_1273 | 328 |
| 223 | 3300046531 | Ga0495665_0028868 | Ga0495665_0028868_1954_2940 | 328 |
| 224 | 3300046678 | Ga0495599_0159995 | Ga0495599_0159995_158_1144 | 328 |
| 225 | 3300046683 | Ga0495658_0070196 | Ga0495658_0070196_768_1754 | 328 |
| 226 | 3300047319 | Ga0495674_0015346 | Ga0495674_0015346_359_1345 | 328 |
| 227 | 3300048903 | Ga0496100_0366704 | Ga0496100_0366704_36_1022 | 328 |
| 228 | 3300048905 | Ga0496102_0002175 | Ga0496102_0002175_13879_14865 | 328 |
| 229 | 3300048906 | Ga0496103_0004438 | Ga0496103_0004438_6685_7671 | 328 |
| 230 | 3300048909 | Ga0496106_0013763 | Ga0496106_0013763_353_1339 | 328 |
| 231 | 3300048910 | Ga0496107_0140466 | Ga0496107_0140466_364_1350 | 328 |
| 232 | 3300053077 | Ga0495601_0122300 | Ga0495601_0122300_74_1060 | 328 |
| 233 | 3300031090 | Ga0265760_10000813 | Ga0265760_100008135 | 329 |
| 234 | 3300048908 | Ga0496105_0195667 | Ga0496105_0195667_133_1122 | 329 |
| 235 | 3300005536 | Ga0070697_100000108 | Ga0070697_10000010825 | 330 |
| 236 | 3300031090 | Ga0265760_10000112 | Ga0265760_1000011222 | 330 |
| 237 | 3300005436 | Ga0070713_100165924 | Ga0070713_1001659242 | 331 |
| 238 | 3300006028 | Ga0070717_10027506 | Ga0070717_100275063 | 331 |
| 239 | 3300006028 | Ga0070717_10054868 | Ga0070717_100548683 | 331 |
| 240 | 3300013296 | Ga0157374_10214661 | Ga0157374_102146612 | 331 |
| 241 | 3300013307 | Ga0157372_10000416 | Ga0157372_1000041636 | 331 |
| 242 | 3300025928 | Ga0207700_10076918 | Ga0207700_100769181 | 331 |
| 243 | 3300031711 | Ga0265314_10131589 | Ga0265314_101315891 | 331 |
| 244 | 3300048905 | Ga0496102_0136364 | Ga0496102_0136364_1055_2056 | 331 |
| 245 | 3300005445 | Ga0070708_100024442 | Ga0070708_1000244424 | 332 |
| 246 | 3300005467 | Ga0070706_100001310 | Ga0070706_1000013102 | 332 |
| 247 | 3300005468 | Ga0070707_100074260 | Ga0070707_1000742603 | 332 |
| 248 | 3300005536 | Ga0070697_100000336 | Ga0070697_10000033629 | 332 |
| 249 | 3300025910 | Ga0207684_10000621 | Ga0207684_1000062115 | 332 |
| 250 | 3300025922 | Ga0207646_10034525 | Ga0207646_100345252 | 332 |
| 251 | 3300030879 | Ga0265765_1003240 | Ga0265765_10032402 | 332 |
| 252 | 3300031090 | Ga0265760_10001941 | Ga0265760_100019415 | 332 |
| 253 | 3300031344 | Ga0265316_10002195 | Ga0265316_1000219511 | 332 |
| 254 | 3300031711 | Ga0265314_10001900 | Ga0265314_100019001 | 332 |
| 255 | 3300005437 | Ga0070710_10006940 | Ga0070710_100069405 | 333 |
| 256 | 3300005439 | Ga0070711_100000231 | Ga0070711_1000002319 | 333 |
| 257 | 3300006028 | Ga0070717_10001814 | Ga0070717_100018142 | 333 |
| 258 | 3300006163 | Ga0070715_10013704 | Ga0070715_100137043 | 333 |
| 259 | 3300006175 | Ga0070712_100000057 | Ga0070712_10000005713 | 333 |
| 260 | 3300025898 | Ga0207692_10027501 | Ga0207692_100275012 | 333 |
| 261 | 3300025915 | Ga0207693_10000850 | Ga0207693_1000085016 | 333 |
| 262 | 3300025916 | Ga0207663_10000480 | Ga0207663_100004809 | 333 |
| 263 | 3300025928 | Ga0207700_10000467 | Ga0207700_1000046720 | 333 |
| 264 | 3300035724 | Ga0373933_0090958 | Ga0373933_0090958_102_1103 | 333 |
| 265 | 3300046472 | Ga0495580_0194227 | Ga0495580_0194227_16_1026 | 333 |
| 266 | 3300048908 | Ga0496105_0068723 | Ga0496105_0068723_190_1200 | 333 |
| 267 | 3300048918 | Ga0496115_0006988 | Ga0496115_0006988_3047_4057 | 333 |
| 268 | 3300005329 | Ga0070683_100186874 | Ga0070683_1001868742 | 334 |
| 269 | 3300005435 | Ga0070714_100049580 | Ga0070714_1000495803 | 334 |
| 270 | 3300005436 | Ga0070713_100014443 | Ga0070713_1000144435 | 334 |
| 271 | 3300005445 | Ga0070708_100061902 | Ga0070708_1000619023 | 334 |
| 272 | 3300005445 | Ga0070708_100284906 | Ga0070708_1002849062 | 334 |
| 273 | 3300006028 | Ga0070717_10003194 | Ga0070717_1000319411 | 334 |
| 274 | 3300006175 | Ga0070712_100158631 | Ga0070712_1001586311 | 334 |
| 275 | 3300009093 | Ga0105240_10216868 | Ga0105240_102168681 | 334 |
| 276 | 3300013307 | Ga0157372_10038984 | Ga0157372_100389842 | 334 |
| 277 | 3300025913 | Ga0207695_10060907 | Ga0207695_100609072 | 334 |
| 278 | 3300025928 | Ga0207700_10070352 | Ga0207700_100703522 | 334 |
| 279 | 3300045976 | Ga0466967_0212125 | Ga0466967_0212125_367_1377 | 334 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3isr-assembly1.cif.gz_B | the crystal structure of a putative cysteine protease from cytophaga hutchinsonii to 1.9a | 0.6979 | 23 | 325 |
| 3isr-assembly1.cif.gz_B | the crystal structure of a putative cysteine protease from cytophaga hutchinsonii to 1.9a | 0.6537 | 23 | 325 |
| 8tid-assembly1.cif.gz_H | combined linker domain of n-drc and associated proteins tetrahymena | 0.6369 | 137 | 255 |
| 2pqt-assembly1.cif.gz_A | human n-acetyltransferase 1 | 0.6291 | 141 | 255 |
| 4x5y-assembly1.cif.gz_A | menin in complex with mi-503 | 0.6261 | 144 | 255 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53920_94_280_3.10.620.30 | Alpha Beta;Roll;C8orf32 fold; | 0.8478 | 108 | 290 | 3.10.620.30 |
| af_O53920_94_280_3.10.620.30 | Alpha Beta;Roll;C8orf32 fold; | 0.8265 | 108 | 290 | 3.10.620.30 |
| af_Q54IX2_591_772_3.10.620.30 | Alpha Beta;Roll;C8orf32 fold; | 0.8116 | 111 | 281 | 3.10.620.30 |
| af_Q54IX2_1026_1205_3.10.620.30 | Alpha Beta;Roll;C8orf32 fold; | 0.8034 | 107 | 279 | 3.10.620.30 |
| af_Q86AX0_679_844_3.10.620.30 | Alpha Beta;Roll;C8orf32 fold; | 0.7996 | 111 | 269 | 3.10.620.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W0BLI0-F1-model_v4 | Transglutaminase | 0.9616 | 105 | 326 |
|
| AF-A0A2E3MLN5-F1-model_v4 | Transglutaminase | 0.9605 | 20 | 328 |
GO:0016020
|
| AF-A0A1G3BIV1-F1-model_v4 | Transglutaminase-like domain-containing protein | 0.9591 | 22 | 323 |
|
| AF-A0A2V6CV66-F1-model_v4 | Transglutaminase | 0.9566 | 158 | 311 |
|
| AF-A0A7C7GI16-F1-model_v4 | Transglutaminase domain-containing protein | 0.9558 | 54 | 323 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar