F383045

General Info

Members Datasets Scaffolds Average Seq Length
279 151 558 360

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10000006|Ga0105239_1000000634
Length 399
Sequence MLRYDAYMIANYLIGEMIKIIEITKTNKLKCTRLVISTMNRLLTKLEKIGRDPKVTAKSVGLRYVADSTPGYTRKKSGKGWSYYDKEGSLVKDKELIRRFNKLIIPPAYTNVWISPYENGHLQFTGTDAAGRKQYRYHPDWNKIRNQSKYHRMQMFAAHLPAIRRQVDKDLSRHNLDHDKIVALIVRLMELTSIRIGNESYKKLYGSFGLTTLMNRHVKIEGSTINFEFKGKKGVYHKVALQSRKLAGLVKQCREIPGKELFQYYNADGTRCTVGSGDVNSYLKEITGEDFTAKDFRTWAGSVSALYAFKQAGEFDTITECRKKIVSVLDEVALNLGNTRTVCKKYYVHPTVIKSYEDGAIFKYIRNIDEEKDVSSAELNVAEKALLNILENEKLAEAS

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
109 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
112 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
115 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
116 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
117 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
118 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
119 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
120 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
121 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
122 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
125 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
126 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
127 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
133 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
134 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
135 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
136 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
137 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
138 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
139 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
140 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
141 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
142 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
143 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
144 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
145 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
146 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
147 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
148 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
149 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
150 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
151 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.06
Metatranscriptomes 0
Isolates 3.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.09
Nodule 0
Rhizoplane 1.43
Rhizosphere 86.38
Stem 0
Stem Tuber 0
Unclassified 3.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10000006 3300010375 Bacteria 442319
2 JGI24739J22299_10004594 3300001989 Bacteria 5279
3 JGI24737J22298_10015917 3300001990 Bacteria 2429
4 JGI24743J22301_10012794 3300001991 Bacteria 1531
5 JGI24735J21928_10000002 3300002067 Bacteria 624895
6 JGI25162J39368_1000427 3300002737 Bacteria 33903
7 JGI25406J46586_10000481 3300003203 Bacteria 18605
8 JGI25165J46597_1000548 3300003214 Bacteria 34311
9 rootH2_10005324 3300003320 Bacteria 32959
10 rootH2_10006566 3300003320 Bacteria 99379
11 rootL2_10002169 3300003322 Bacteria 13252
12 rootH1_10015057 3300003323 Bacteria 6188
13 rootH1_10018087 3300003323 Bacteria 6102
14 rootH1_10227823 3300003323 Bacteria 6705
15 Ga0065714_10066685 3300005288 Bacteria 6468
16 Ga0070658_10000045 3300005327 Bacteria 130728
17 Ga0070658_10148520 3300005327 Bacteria 1961
18 Ga0070658_10274493 3300005327 Bacteria 1434
19 Ga0070676_10012953 3300005328 Bacteria 4568
20 Ga0070683_100010201 3300005329 Bacteria 8065
21 Ga0070683_100055694 3300005329 Bacteria 3670
22 Ga0070683_100434607 3300005329 Unclassified 1252
23 Ga0070690_100040161 3300005330 Unclassified 2958
24 Ga0070680_100026855 3300005336 Bacteria 4606
25 Ga0070660_100025581 3300005339 Bacteria 4388
26 Ga0070660_100030784 3300005339 Unclassified 4027
27 Ga0070661_100045951 3300005344 Bacteria 3193
28 Ga0070675_100025984 3300005354 Bacteria 4696
29 Ga0070673_100005217 3300005364 Bacteria 8296
30 Ga0070673_100011628 3300005364 Bacteria 6013
31 Ga0070659_100000100 3300005366 Bacteria 63786
32 Ga0070659_100007598 3300005366 Bacteria 7880
33 Ga0070659_100021347 3300005366 Bacteria 4931
34 Ga0070659_100157772 3300005366 Bacteria 1854
35 Ga0070663_100013896 3300005455 Bacteria 5150
36 Ga0070678_100006999 3300005456 Bacteria 6661
37 Ga0070662_100000103 3300005457 Bacteria 46838
38 Ga0070662_100011894 3300005457 Bacteria 5753
39 Ga0070681_10018112 3300005458 Bacteria 7042
40 Ga0070681_10227875 3300005458 Bacteria 1778
41 Ga0070679_100016656 3300005530 Bacteria 7099
42 Ga0070679_100085478 3300005530 Unclassified 3142
43 Ga0070684_100012103 3300005535 Bacteria 6900
44 Ga0068853_100013617 3300005539 Bacteria 6647
45 Ga0068853_100057797 3300005539 Bacteria 3348
46 Ga0068853_100095670 3300005539 Bacteria 2619
47 Ga0070693_100118013 3300005547 Unclassified 1642
48 Ga0070665_100000083 3300005548 Bacteria 181044
49 Ga0068855_100000026 3300005563 Bacteria 175140
50 Ga0068855_100000621 3300005563 Bacteria 43643
51 Ga0068855_100023301 3300005563 Bacteria 7414
52 Ga0068855_100086362 3300005563 Bacteria 3628
53 Ga0068855_100088165 3300005563 Bacteria 3584
54 Ga0068855_100246746 3300005563 Bacteria 1993
55 Ga0070664_100041213 3300005564 Bacteria 3895
56 Ga0068857_100030463 3300005577 Bacteria 4764
57 Ga0068854_100054523 3300005578 Bacteria 2876
58 Ga0068856_100000263 3300005614 Bacteria 57295
59 Ga0068856_100011583 3300005614 Bacteria 8553
60 Ga0068856_100013971 3300005614 Bacteria 7764
61 Ga0068856_100047192 3300005614 Bacteria 4243
62 Ga0068856_100084300 3300005614 Bacteria 3157
63 Ga0068859_100024845 3300005617 Bacteria 6013
64 Ga0068866_10038064 3300005718 Bacteria 2366
65 Ga0075366_10004531 3300006195 Bacteria 7459
66 Ga0075366_10020929 3300006195 Bacteria 3800
67 Ga0097621_100000440 3300006237 Bacteria 29027
68 Ga0097621_100010696 3300006237 Bacteria 6725
69 Ga0068871_100000181 3300006358 Bacteria 42792
70 Ga0068871_100400498 3300006358 Unclassified 1222
71 Ga0068865_100006733 3300006881 Bacteria 7030
72 Ga0097620_100024845 3300006931 Bacteria 6013
73 Ga0105240_10000722 3300009093 Bacteria 60400
74 Ga0105240_10005447 3300009093 Bacteria 18965
75 Ga0105240_10005860 3300009093 Bacteria 18220
76 Ga0105240_10058012 3300009093 Bacteria 4833
77 Ga0105240_10244914 3300009093 Bacteria 2076
78 Ga0105245_10118624 3300009098 Bacteria 2469
79 Ga0105243_10009284 3300009148 Bacteria 7504
80 Ga0105241_10006426 3300009174 Bacteria 8660
81 Ga0105241_10044190 3300009174 Bacteria 3375
82 Ga0105241_10060404 3300009174 Bacteria 2916
83 Ga0105241_10078019 3300009174 Bacteria 2587
84 Ga0105241_10124483 3300009174 Bacteria 2080
85 Ga0105237_10000173 3300009545 Bacteria 90612
86 Ga0105237_10001717 3300009545 Bacteria 28335
87 Ga0105237_10002523 3300009545 Bacteria 22682
88 Ga0105237_10015023 3300009545 Bacteria 8068
89 Ga0105237_10034633 3300009545 Bacteria 5112
90 Ga0105237_10052671 3300009545 Bacteria 4084
91 Ga0105237_10081158 3300009545 Bacteria 3233
92 Ga0105238_10005256 3300009551 Bacteria 12801
93 Ga0105238_10034068 3300009551 Bacteria 5182
94 Ga0105239_10000002 3300010375 Bacteria 610298
95 Ga0105239_10000578 3300010375 Bacteria 52273
96 Ga0105239_10002733 3300010375 Bacteria 22146
97 Ga0105239_10004552 3300010375 Bacteria 16523
98 Ga0105239_10013932 3300010375 Bacteria 8927
99 Ga0105239_10425880 3300010375 Bacteria 1504
100 Ga0105239_10508615 3300010375 Bacteria 1370
101 Ga0157373_10000265 3300013100 Bacteria 42223
102 Ga0157373_10005193 3300013100 Bacteria 9786
103 Ga0157373_10093740 3300013100 Bacteria 2115
104 Ga0157371_10000141 3300013102 Bacteria 104396
105 Ga0157371_10028295 3300013102 Bacteria 4060
106 Ga0157371_10031605 3300013102 Bacteria 3814
107 Ga0157371_10093791 3300013102 Unclassified 2127
108 Ga0157370_10089534 3300013104 Bacteria 2891
109 Ga0157369_10000940 3300013105 Bacteria 36995
110 Ga0157369_10021123 3300013105 Bacteria 7278
111 Ga0157369_10118200 3300013105 Bacteria 2814
112 Ga0157374_10000129 3300013296 Bacteria 69468
113 Ga0157374_10004070 3300013296 Bacteria 12276
114 Ga0157374_10008076 3300013296 Bacteria 8999
115 Ga0157374_10016021 3300013296 Bacteria 6585
116 Ga0157378_10015548 3300013297 Bacteria 6665
117 Ga0157378_10157218 3300013297 Bacteria 2123
118 Ga0163162_10000068 3300013306 Bacteria 97068
119 Ga0163162_10002705 3300013306 Bacteria 16819
120 Ga0163162_10005929 3300013306 Bacteria 11823
121 Ga0163162_10009936 3300013306 Bacteria 9257
122 Ga0163162_10045128 3300013306 Bacteria 4415
123 Ga0163162_10202909 3300013306 Bacteria 2112
124 Ga0157372_10000061 3300013307 Bacteria 119814
125 Ga0157372_10005116 3300013307 Bacteria 13933
126 Ga0157372_10010950 3300013307 Bacteria 9651
127 Ga0157372_10011189 3300013307 Bacteria 9542
128 Ga0157372_10029423 3300013307 Bacteria 5997
129 Ga0157372_10039043 3300013307 Bacteria 5240
130 Ga0157372_10052070 3300013307 Bacteria 4557
131 Ga0157372_10094599 3300013307 Bacteria 3403
132 Ga0157375_10028945 3300013308 Bacteria 5202
133 Ga0163163_10064911 3300014325 Bacteria 3623
134 Ga0157377_10121546 3300014745 Unclassified 1583
135 Ga0157376_10067575 3300014969 Bacteria 3024
136 Ga0182006_1015455 3300015261 Bacteria 3272
137 Ga0209563_106528 3300025230 Bacteria 1997
138 Ga0207427_100090 3300025231 Bacteria 133759
139 Ga0209437_100034 3300025233 Bacteria 494007
140 Ga0209437_100070 3300025233 Bacteria 306718
141 Ga0209026_1000552 3300025250 Bacteria 25752
142 Ga0209026_1004309 3300025250 Bacteria 4277
143 Ga0209233_1000038 3300025261 Bacteria 548972
144 Ga0207647_10000062 3300025904 Bacteria 83809
145 Ga0207647_10000263 3300025904 Bacteria 43120
146 Ga0207645_10000224 3300025907 Bacteria 46998
147 Ga0207705_10000080 3300025909 Bacteria 119562
148 Ga0207705_10193972 3300025909 Bacteria 1537
149 Ga0207705_10228101 3300025909 Bacteria 1416
150 Ga0207707_10013803 3300025912 Bacteria 7045
151 Ga0207695_10000013 3300025913 Bacteria 821265
152 Ga0207695_10003717 3300025913 Bacteria 21241
153 Ga0207695_10004794 3300025913 Bacteria 18302
154 Ga0207695_10007634 3300025913 Bacteria 13710
155 Ga0207695_10370151 3300025913 Bacteria 1319
156 Ga0207671_10004324 3300025914 Bacteria 13650
157 Ga0207671_10006722 3300025914 Bacteria 10184
158 Ga0207671_10011558 3300025914 Bacteria 7169
159 Ga0207671_10013157 3300025914 Bacteria 6608
160 Ga0207671_10021066 3300025914 Bacteria 4952
161 Ga0207671_10082089 3300025914 Bacteria 2418
162 Ga0207660_10031463 3300025917 Bacteria 3655
163 Ga0207657_10010760 3300025919 Bacteria 9107
164 Ga0207657_10031823 3300025919 Bacteria 4772
165 Ga0207657_10084379 3300025919 Bacteria 2662
166 Ga0207652_10050806 3300025921 Bacteria 3553
167 Ga0207652_10081777 3300025921 Bacteria 2825
168 Ga0207694_10064132 3300025924 Bacteria 2863
169 Ga0207690_10000381 3300025932 Bacteria 29417
170 Ga0207690_10047870 3300025932 Bacteria 2839
171 Ga0207706_10000851 3300025933 Bacteria 31416
172 Ga0207706_10005475 3300025933 Bacteria 11837
173 Ga0207686_10144752 3300025934 Bacteria 1647
174 Ga0207704_10000037 3300025938 Bacteria 93990
175 Ga0207661_10023218 3300025944 Bacteria 4685
176 Ga0207661_10040925 3300025944 Bacteria 3646
177 Ga0207679_10031757 3300025945 Bacteria 3699
178 Ga0207667_10000022 3300025949 Bacteria 369570
179 Ga0207667_10001434 3300025949 Bacteria 29877
180 Ga0207667_10024897 3300025949 Bacteria 6563
181 Ga0207667_10050588 3300025949 Bacteria 4384
182 Ga0207667_10064097 3300025949 Bacteria 3838
183 Ga0207667_10072717 3300025949 Bacteria 3574
184 Ga0207667_10173905 3300025949 Bacteria 2213
185 Ga0207667_10241141 3300025949 Bacteria 1850
186 Ga0207651_10003243 3300025960 Bacteria 7964
187 Ga0207640_10089480 3300025981 Bacteria 2128
188 Ga0207677_10053113 3300026023 Bacteria 2756
189 Ga0207639_10007010 3300026041 Bacteria 7681
190 Ga0207639_10082199 3300026041 Bacteria 2553
191 Ga0207639_10170172 3300026041 Bacteria 1844
192 Ga0207639_10211030 3300026041 Unclassified 1671
193 Ga0207678_10037411 3300026067 Bacteria 4220
194 Ga0207702_10000273 3300026078 Bacteria 59343
195 Ga0207702_10088772 3300026078 Bacteria 2702
196 Ga0207641_10102035 3300026088 Unclassified 2529
197 Ga0207648_10000241 3300026089 Bacteria 58974
198 Ga0207674_10097300 3300026116 Bacteria 2927
199 Ga0207683_10004019 3300026121 Bacteria 12724
200 Ga0207698_10001086 3300026142 Bacteria 15810
201 Ga0207698_10193182 3300026142 Unclassified 1815
202 Ga0268266_10000095 3300028379 Bacteria 186169
203 Ga0307517_10000719 3300028786 Bacteria 56987
204 Ga0307515_10000144 3300028794 Bacteria 170910
205 Ga0307515_10006611 3300028794 Bacteria 23131
206 Ga0307509_10231199 3300031507 Bacteria 1651
207 Ga0307405_10000007 3300031731 Bacteria 348101
208 Ga0307406_10065407 3300031901 Bacteria 2363
209 Ga0307510_10006060 3300033180 Bacteria 14412
210 Ga0395899_0000001 3300037312 Bacteria 1750322
211 Ga0395899_0000382 3300037312 Bacteria 52888
212 Ga0395899_0001182 3300037312 Bacteria 23011
213 Ga0395900_0000362 3300037418 Bacteria 65661
214 Ga0395900_0000694 3300037418 Bacteria 44919
215 Ga0395900_0006049 3300037418 Bacteria 12620
216 Ga0395900_0336604 3300037418 Bacteria 1486
217 Ga0395898_0141146 3300037466 Bacteria 2306
218 Ga0395898_0407699 3300037466 Bacteria 1296
219 Ga0395905_0000841 3300037471 Bacteria 40055
220 Ga0395905_0002834 3300037471 Bacteria 18986
221 Ga0395901_0005109 3300038443 Bacteria 13255
222 Ga0436361_0215474 3300039447 Bacteria 8137
223 Ga0439448_0002495 3300042005 Bacteria 5012
224 Ga0466961_0189677 3300044693 Bacteria 1274
225 Ga0495650_0000003 3300046471 Bacteria 900730
226 Ga0495585_0000771 3300046492 Bacteria 28305
227 Ga0495585_0002283 3300046492 Bacteria 13840
228 Ga0495606_0000116 3300046507 Bacteria 134901
229 Ga0495606_0037300 3300046507 Bacteria 3302
230 Ga0495610_0002083 3300046512 Bacteria 17078
231 Ga0495616_0001938 3300046513 Bacteria 13915
232 Ga0495616_0019427 3300046513 Bacteria 3709
233 Ga0495631_0027513 3300046518 Bacteria 2601
234 Ga0495631_0056715 3300046518 Bacteria 1706
235 Ga0495644_0036707 3300046523 Bacteria 1848
236 Ga0495648_0080212 3300046524 Bacteria 1860
237 Ga0495609_0023245 3300046538 Bacteria 2850
238 Ga0495633_0000027 3300046558 Bacteria 204613
239 Ga0495633_0003745 3300046558 Bacteria 10007
240 Ga0495656_0031336 3300046615 Bacteria 2156
241 Ga0495668_0000010 3300046616 Bacteria 487308
242 Ga0495625_0000219 3300046660 Bacteria 90690
243 Ga0495625_0000381 3300046660 Bacteria 67732
244 Ga0495625_0000939 3300046660 Bacteria 39095
245 Ga0495625_0044432 3300046660 Bacteria 3216
246 Ga0495625_0162761 3300046660 Bacteria 1494
247 Ga0495661_0000244 3300046665 Bacteria 62633
248 Ga0495649_0000037 3300046694 Bacteria 133848
249 Ga0495660_0112156 3300046810 Bacteria 1390
250 Ga0495687_004576 3300047443 Bacteria 9260
251 Ga0495687_036758 3300047443 Bacteria 2188
252 Ga0495686_0002723 3300047472 Bacteria 16166
253 Ga0495686_0002885 3300047472 Bacteria 15434
254 Ga0496108_0096046 3300048911 Bacteria 2524
255 Ga0496109_0064741 3300048912 Bacteria 3345
256 Ga0496113_0147201 3300048916 Bacteria 1856
257 Ga0495678_010265 3300049459 Bacteria 4562
258 Ga0501300_001451 3300049523 Bacteria 3550
259 Ga0501202_010181 3300049652 Bacteria 1740
260 Ga0501257_013081 3300049686 Bacteria 1901
261 nmdc:mga0k408_113409_c1 3300050493 Bacteria 1603
262 nmdc:mga0k408_1566_c1 3300050493 Bacteria 10893
263 nmdc:mga0k408_4422_c1 3300050493 Bacteria 7459
264 Ga0500635_0000844 3300053080 Bacteria 7544
265 Ga0500608_002103 3300053122 Bacteria 7145
266 Ga0500608_002178 3300053122 Bacteria 7048
267 Ga0500618_000013 3300053125 Bacteria 183026
268 Ga0500564_089668 3300053138 Bacteria 1370
269 2599478572 2599185184 Bacteria 6430550
270 2819681781 2818991460 Bacteria 7595395
271 2852624087 2852623160 Bacteria 4376875
272 2881247947 2881247448 Bacteria 3717788
273 2884936991 2884933994 Bacteria 4535041
274 2919442300 2919437846 Bacteria 6199444
275 2928080373 2928078545 Bacteria 6534839
276 2928149454 2928147474 Bacteria 6512076
277 2932083282 2932082852 Bacteria 6563563
278 2965320727 2965320100 Bacteria 3975600
279 2977236721 2977232053 Bacteria 5485925
280 Ga0105239_10000006
281 JGI24739J22299_10004594
282 JGI24737J22298_10015917
283 JGI24743J22301_10012794
284 JGI24735J21928_10000002
285 JGI25162J39368_1000427
286 JGI25406J46586_10000481
287 JGI25165J46597_1000548
288 rootH2_10005324
289 rootH2_10006566
290 rootL2_10002169
291 rootH1_10015057
292 rootH1_10018087
293 rootH1_10227823
294 Ga0065714_10066685
295 Ga0070658_10000045
296 Ga0070658_10148520
297 Ga0070658_10274493
298 Ga0070676_10012953
299 Ga0070683_100010201
300 Ga0070683_100055694
301 Ga0070683_100434607
302 Ga0070690_100040161
303 Ga0070680_100026855
304 Ga0070660_100025581
305 Ga0070660_100030784
306 Ga0070661_100045951
307 Ga0070675_100025984
308 Ga0070673_100005217
309 Ga0070673_100011628
310 Ga0070659_100000100
311 Ga0070659_100007598
312 Ga0070659_100021347
313 Ga0070659_100157772
314 Ga0070663_100013896
315 Ga0070678_100006999
316 Ga0070662_100000103
317 Ga0070662_100011894
318 Ga0070681_10018112
319 Ga0070681_10227875
320 Ga0070679_100016656
321 Ga0070679_100085478
322 Ga0070684_100012103
323 Ga0068853_100013617
324 Ga0068853_100057797
325 Ga0068853_100095670
326 Ga0070693_100118013
327 Ga0070665_100000083
328 Ga0068855_100000026
329 Ga0068855_100000621
330 Ga0068855_100023301
331 Ga0068855_100086362
332 Ga0068855_100088165
333 Ga0068855_100246746
334 Ga0070664_100041213
335 Ga0068857_100030463
336 Ga0068854_100054523
337 Ga0068856_100000263
338 Ga0068856_100011583
339 Ga0068856_100013971
340 Ga0068856_100047192
341 Ga0068856_100084300
342 Ga0068859_100024845
343 Ga0068866_10038064
344 Ga0075366_10004531
345 Ga0075366_10020929
346 Ga0097621_100000440
347 Ga0097621_100010696
348 Ga0068871_100000181
349 Ga0068871_100400498
350 Ga0068865_100006733
351 Ga0097620_100024845
352 Ga0105240_10000722
353 Ga0105240_10005447
354 Ga0105240_10005860
355 Ga0105240_10058012
356 Ga0105240_10244914
357 Ga0105245_10118624
358 Ga0105243_10009284
359 Ga0105241_10006426
360 Ga0105241_10044190
361 Ga0105241_10060404
362 Ga0105241_10078019
363 Ga0105241_10124483
364 Ga0105237_10000173
365 Ga0105237_10001717
366 Ga0105237_10002523
367 Ga0105237_10015023
368 Ga0105237_10034633
369 Ga0105237_10052671
370 Ga0105237_10081158
371 Ga0105238_10005256
372 Ga0105238_10034068
373 Ga0105239_10000002
374 Ga0105239_10000578
375 Ga0105239_10002733
376 Ga0105239_10004552
377 Ga0105239_10013932
378 Ga0105239_10425880
379 Ga0105239_10508615
380 Ga0157373_10000265
381 Ga0157373_10005193
382 Ga0157373_10093740
383 Ga0157371_10000141
384 Ga0157371_10028295
385 Ga0157371_10031605
386 Ga0157371_10093791
387 Ga0157370_10089534
388 Ga0157369_10000940
389 Ga0157369_10021123
390 Ga0157369_10118200
391 Ga0157374_10000129
392 Ga0157374_10004070
393 Ga0157374_10008076
394 Ga0157374_10016021
395 Ga0157378_10015548
396 Ga0157378_10157218
397 Ga0163162_10000068
398 Ga0163162_10002705
399 Ga0163162_10005929
400 Ga0163162_10009936
401 Ga0163162_10045128
402 Ga0163162_10202909
403 Ga0157372_10000061
404 Ga0157372_10005116
405 Ga0157372_10010950
406 Ga0157372_10011189
407 Ga0157372_10029423
408 Ga0157372_10039043
409 Ga0157372_10052070
410 Ga0157372_10094599
411 Ga0157375_10028945
412 Ga0163163_10064911
413 Ga0157377_10121546
414 Ga0157376_10067575
415 Ga0182006_1015455
416 Ga0209563_106528
417 Ga0207427_100090
418 Ga0209437_100034
419 Ga0209437_100070
420 Ga0209026_1000552
421 Ga0209026_1004309
422 Ga0209233_1000038
423 Ga0207647_10000062
424 Ga0207647_10000263
425 Ga0207645_10000224
426 Ga0207705_10000080
427 Ga0207705_10193972
428 Ga0207705_10228101
429 Ga0207707_10013803
430 Ga0207695_10000013
431 Ga0207695_10003717
432 Ga0207695_10004794
433 Ga0207695_10007634
434 Ga0207695_10370151
435 Ga0207671_10004324
436 Ga0207671_10006722
437 Ga0207671_10011558
438 Ga0207671_10013157
439 Ga0207671_10021066
440 Ga0207671_10082089
441 Ga0207660_10031463
442 Ga0207657_10010760
443 Ga0207657_10031823
444 Ga0207657_10084379
445 Ga0207652_10050806
446 Ga0207652_10081777
447 Ga0207694_10064132
448 Ga0207690_10000381
449 Ga0207690_10047870
450 Ga0207706_10000851
451 Ga0207706_10005475
452 Ga0207686_10144752
453 Ga0207704_10000037
454 Ga0207661_10023218
455 Ga0207661_10040925
456 Ga0207679_10031757
457 Ga0207667_10000022
458 Ga0207667_10001434
459 Ga0207667_10024897
460 Ga0207667_10050588
461 Ga0207667_10064097
462 Ga0207667_10072717
463 Ga0207667_10173905
464 Ga0207667_10241141
465 Ga0207651_10003243
466 Ga0207640_10089480
467 Ga0207677_10053113
468 Ga0207639_10007010
469 Ga0207639_10082199
470 Ga0207639_10170172
471 Ga0207639_10211030
472 Ga0207678_10037411
473 Ga0207702_10000273
474 Ga0207702_10088772
475 Ga0207641_10102035
476 Ga0207648_10000241
477 Ga0207674_10097300
478 Ga0207683_10004019
479 Ga0207698_10001086
480 Ga0207698_10193182
481 Ga0268266_10000095
482 Ga0307517_10000719
483 Ga0307515_10000144
484 Ga0307515_10006611
485 Ga0307509_10231199
486 Ga0307405_10000007
487 Ga0307406_10065407
488 Ga0307510_10006060
489 Ga0395899_0000001
490 Ga0395899_0000382
491 Ga0395899_0001182
492 Ga0395900_0000362
493 Ga0395900_0000694
494 Ga0395900_0006049
495 Ga0395900_0336604
496 Ga0395898_0141146
497 Ga0395898_0407699
498 Ga0395905_0000841
499 Ga0395905_0002834
500 Ga0395901_0005109
501 Ga0436361_0215474
502 Ga0439448_0002495
503 Ga0466961_0189677
504 Ga0495650_0000003
505 Ga0495585_0000771
506 Ga0495585_0002283
507 Ga0495606_0000116
508 Ga0495606_0037300
509 Ga0495610_0002083
510 Ga0495616_0001938
511 Ga0495616_0019427
512 Ga0495631_0027513
513 Ga0495631_0056715
514 Ga0495644_0036707
515 Ga0495648_0080212
516 Ga0495609_0023245
517 Ga0495633_0000027
518 Ga0495633_0003745
519 Ga0495656_0031336
520 Ga0495668_0000010
521 Ga0495625_0000219
522 Ga0495625_0000381
523 Ga0495625_0000939
524 Ga0495625_0044432
525 Ga0495625_0162761
526 Ga0495661_0000244
527 Ga0495649_0000037
528 Ga0495660_0112156
529 Ga0495687_004576
530 Ga0495687_036758
531 Ga0495686_0002723
532 Ga0495686_0002885
533 Ga0496108_0096046
534 Ga0496109_0064741
535 Ga0496113_0147201
536 Ga0495678_010265
537 Ga0501300_001451
538 Ga0501202_010181
539 Ga0501257_013081
540 nmdc:mga0k408_113409_c1
541 nmdc:mga0k408_1566_c1
542 nmdc:mga0k408_4422_c1
543 Ga0500635_0000844
544 Ga0500608_002103
545 Ga0500608_002178
546 Ga0500618_000013
547 Ga0500564_089668
548 2599478572
549 2819681781
550 2852624087
551 2881247947
552 2884936991
553 2919442300
554 2928080373
555 2928149454
556 2932083282
557 2965320727
558 2977236721

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21338

Top1B_N_bact

Bacterial DNA topoisomerase IB, N-terminal domain

80

128

0.99

PF01028

Topoisom_I

Eukaryotic DNA topoisomerase I, catalytic core

138

374

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h7g-assembly1.cif.gz_X structure of variola topoisomerase non-covalently bound to dna 0.7687 34 358
2h7g-assembly1.cif.gz_X structure of variola topoisomerase non-covalently bound to dna 0.7599 34 358
1k4s-assembly1.cif.gz_A human dna topoisomerase i in covalent complex with a 22 base pair dna duplex 0.7377 81 336
2b9s-assembly1.cif.gz_A crystal structure of heterodimeric l. donovani topoisomerase i-vanadate-dna complex 0.7344 67 301
3m4a-assembly1.cif.gz_A crystal structure of a bacterial topoisomerase ib in complex with dna reveals a secondary dna binding site 0.7343 57 357
ID Description Score Start End Superfamily
3m4aA03 Alpha Beta;Alpha-Beta Complex;Topoisomerase I; Chain A, domain 3;Topoisomerase I; Chain A, domain 3 0.951 135 250 3.90.15.10
3m4aA03 Alpha Beta;Alpha-Beta Complex;Topoisomerase I; Chain A, domain 3;Topoisomerase I; Chain A, domain 3 0.9279 135 250 3.90.15.10
2f4qA03 Alpha Beta;Alpha-Beta Complex;Topoisomerase I; Chain A, domain 3;Topoisomerase I; Chain A, domain 3 0.9084 144 250 3.90.15.10
af_Q9USZ0_628_894_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8831 180 205 2.130.10.10
af_A0A2R8S0L3_185_312_3.90.15.10 Alpha Beta;Alpha-Beta Complex;Topoisomerase I; Chain A, domain 3;Topoisomerase I; Chain A, domain 3 0.8752 108 210 3.90.15.10
ID Description Score Start End GO Terms
AF-A0A2A2KIQ3-F1-model_v4 DNA topoisomerase I catalytic core eukaryotic-type domain-containing protein 0.987 117 237 GO:0003677
GO:0003917
GO:0006265
AF-A0A7X7H7H0-F1-model_v4 DNA topoisomerase (EC 5.6.2.1) 0.9791 116 355 GO:0003677
GO:0003917
GO:0006265
AF-A0A3C0BSX0-F1-model_v4 Topoisomerase I 0.9755 13 100 GO:0016853
AF-A0A436L3U7-F1-model_v4 deleted 0.9739 132 289
AF-A0A536GTZ5-F1-model_v4 DNA topoisomerase (EC 5.6.2.1) 0.9735 135 273 GO:0003677
GO:0003917
GO:0006265

Map