F383045
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 279 | 151 | 558 | 360 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10000006|Ga0105239_1000000634 |
| Length | 399 |
| Sequence | MLRYDAYMIANYLIGEMIKIIEITKTNKLKCTRLVISTMNRLLTKLEKIGRDPKVTAKSVGLRYVADSTPGYTRKKSGKGWSYYDKEGSLVKDKELIRRFNKLIIPPAYTNVWISPYENGHLQFTGTDAAGRKQYRYHPDWNKIRNQSKYHRMQMFAAHLPAIRRQVDKDLSRHNLDHDKIVALIVRLMELTSIRIGNESYKKLYGSFGLTTLMNRHVKIEGSTINFEFKGKKGVYHKVALQSRKLAGLVKQCREIPGKELFQYYNADGTRCTVGSGDVNSYLKEITGEDFTAKDFRTWAGSVSALYAFKQAGEFDTITECRKKIVSVLDEVALNLGNTRTVCKKYYVHPTVIKSYEDGAIFKYIRNIDEEKDVSSAELNVAEKALLNILENEKLAEAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 43 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 63 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 67 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 98 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 99 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 100 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 101 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 102 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 103 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 104 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 105 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 106 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 107 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 108 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 109 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 110 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 111 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 130 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 132 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 134 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 135 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 136 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 137 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 138 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 139 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 140 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 141 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 142 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 143 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 144 | 2881247448 | Flavobacterium beibuense RSKm HC5 | Isolate | Rhizosphere |
| 145 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 146 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 147 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 148 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 149 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 150 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 151 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.06 |
| Metatranscriptomes | 0 |
| Isolates | 3.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.09 |
| Nodule | 0 |
| Rhizoplane | 1.43 |
| Rhizosphere | 86.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105239_10000006 | 3300010375 | Bacteria | 442319 |
| 2 | JGI24739J22299_10004594 | 3300001989 | Bacteria | 5279 |
| 3 | JGI24737J22298_10015917 | 3300001990 | Bacteria | 2429 |
| 4 | JGI24743J22301_10012794 | 3300001991 | Bacteria | 1531 |
| 5 | JGI24735J21928_10000002 | 3300002067 | Bacteria | 624895 |
| 6 | JGI25162J39368_1000427 | 3300002737 | Bacteria | 33903 |
| 7 | JGI25406J46586_10000481 | 3300003203 | Bacteria | 18605 |
| 8 | JGI25165J46597_1000548 | 3300003214 | Bacteria | 34311 |
| 9 | rootH2_10005324 | 3300003320 | Bacteria | 32959 |
| 10 | rootH2_10006566 | 3300003320 | Bacteria | 99379 |
| 11 | rootL2_10002169 | 3300003322 | Bacteria | 13252 |
| 12 | rootH1_10015057 | 3300003323 | Bacteria | 6188 |
| 13 | rootH1_10018087 | 3300003323 | Bacteria | 6102 |
| 14 | rootH1_10227823 | 3300003323 | Bacteria | 6705 |
| 15 | Ga0065714_10066685 | 3300005288 | Bacteria | 6468 |
| 16 | Ga0070658_10000045 | 3300005327 | Bacteria | 130728 |
| 17 | Ga0070658_10148520 | 3300005327 | Bacteria | 1961 |
| 18 | Ga0070658_10274493 | 3300005327 | Bacteria | 1434 |
| 19 | Ga0070676_10012953 | 3300005328 | Bacteria | 4568 |
| 20 | Ga0070683_100010201 | 3300005329 | Bacteria | 8065 |
| 21 | Ga0070683_100055694 | 3300005329 | Bacteria | 3670 |
| 22 | Ga0070683_100434607 | 3300005329 | Unclassified | 1252 |
| 23 | Ga0070690_100040161 | 3300005330 | Unclassified | 2958 |
| 24 | Ga0070680_100026855 | 3300005336 | Bacteria | 4606 |
| 25 | Ga0070660_100025581 | 3300005339 | Bacteria | 4388 |
| 26 | Ga0070660_100030784 | 3300005339 | Unclassified | 4027 |
| 27 | Ga0070661_100045951 | 3300005344 | Bacteria | 3193 |
| 28 | Ga0070675_100025984 | 3300005354 | Bacteria | 4696 |
| 29 | Ga0070673_100005217 | 3300005364 | Bacteria | 8296 |
| 30 | Ga0070673_100011628 | 3300005364 | Bacteria | 6013 |
| 31 | Ga0070659_100000100 | 3300005366 | Bacteria | 63786 |
| 32 | Ga0070659_100007598 | 3300005366 | Bacteria | 7880 |
| 33 | Ga0070659_100021347 | 3300005366 | Bacteria | 4931 |
| 34 | Ga0070659_100157772 | 3300005366 | Bacteria | 1854 |
| 35 | Ga0070663_100013896 | 3300005455 | Bacteria | 5150 |
| 36 | Ga0070678_100006999 | 3300005456 | Bacteria | 6661 |
| 37 | Ga0070662_100000103 | 3300005457 | Bacteria | 46838 |
| 38 | Ga0070662_100011894 | 3300005457 | Bacteria | 5753 |
| 39 | Ga0070681_10018112 | 3300005458 | Bacteria | 7042 |
| 40 | Ga0070681_10227875 | 3300005458 | Bacteria | 1778 |
| 41 | Ga0070679_100016656 | 3300005530 | Bacteria | 7099 |
| 42 | Ga0070679_100085478 | 3300005530 | Unclassified | 3142 |
| 43 | Ga0070684_100012103 | 3300005535 | Bacteria | 6900 |
| 44 | Ga0068853_100013617 | 3300005539 | Bacteria | 6647 |
| 45 | Ga0068853_100057797 | 3300005539 | Bacteria | 3348 |
| 46 | Ga0068853_100095670 | 3300005539 | Bacteria | 2619 |
| 47 | Ga0070693_100118013 | 3300005547 | Unclassified | 1642 |
| 48 | Ga0070665_100000083 | 3300005548 | Bacteria | 181044 |
| 49 | Ga0068855_100000026 | 3300005563 | Bacteria | 175140 |
| 50 | Ga0068855_100000621 | 3300005563 | Bacteria | 43643 |
| 51 | Ga0068855_100023301 | 3300005563 | Bacteria | 7414 |
| 52 | Ga0068855_100086362 | 3300005563 | Bacteria | 3628 |
| 53 | Ga0068855_100088165 | 3300005563 | Bacteria | 3584 |
| 54 | Ga0068855_100246746 | 3300005563 | Bacteria | 1993 |
| 55 | Ga0070664_100041213 | 3300005564 | Bacteria | 3895 |
| 56 | Ga0068857_100030463 | 3300005577 | Bacteria | 4764 |
| 57 | Ga0068854_100054523 | 3300005578 | Bacteria | 2876 |
| 58 | Ga0068856_100000263 | 3300005614 | Bacteria | 57295 |
| 59 | Ga0068856_100011583 | 3300005614 | Bacteria | 8553 |
| 60 | Ga0068856_100013971 | 3300005614 | Bacteria | 7764 |
| 61 | Ga0068856_100047192 | 3300005614 | Bacteria | 4243 |
| 62 | Ga0068856_100084300 | 3300005614 | Bacteria | 3157 |
| 63 | Ga0068859_100024845 | 3300005617 | Bacteria | 6013 |
| 64 | Ga0068866_10038064 | 3300005718 | Bacteria | 2366 |
| 65 | Ga0075366_10004531 | 3300006195 | Bacteria | 7459 |
| 66 | Ga0075366_10020929 | 3300006195 | Bacteria | 3800 |
| 67 | Ga0097621_100000440 | 3300006237 | Bacteria | 29027 |
| 68 | Ga0097621_100010696 | 3300006237 | Bacteria | 6725 |
| 69 | Ga0068871_100000181 | 3300006358 | Bacteria | 42792 |
| 70 | Ga0068871_100400498 | 3300006358 | Unclassified | 1222 |
| 71 | Ga0068865_100006733 | 3300006881 | Bacteria | 7030 |
| 72 | Ga0097620_100024845 | 3300006931 | Bacteria | 6013 |
| 73 | Ga0105240_10000722 | 3300009093 | Bacteria | 60400 |
| 74 | Ga0105240_10005447 | 3300009093 | Bacteria | 18965 |
| 75 | Ga0105240_10005860 | 3300009093 | Bacteria | 18220 |
| 76 | Ga0105240_10058012 | 3300009093 | Bacteria | 4833 |
| 77 | Ga0105240_10244914 | 3300009093 | Bacteria | 2076 |
| 78 | Ga0105245_10118624 | 3300009098 | Bacteria | 2469 |
| 79 | Ga0105243_10009284 | 3300009148 | Bacteria | 7504 |
| 80 | Ga0105241_10006426 | 3300009174 | Bacteria | 8660 |
| 81 | Ga0105241_10044190 | 3300009174 | Bacteria | 3375 |
| 82 | Ga0105241_10060404 | 3300009174 | Bacteria | 2916 |
| 83 | Ga0105241_10078019 | 3300009174 | Bacteria | 2587 |
| 84 | Ga0105241_10124483 | 3300009174 | Bacteria | 2080 |
| 85 | Ga0105237_10000173 | 3300009545 | Bacteria | 90612 |
| 86 | Ga0105237_10001717 | 3300009545 | Bacteria | 28335 |
| 87 | Ga0105237_10002523 | 3300009545 | Bacteria | 22682 |
| 88 | Ga0105237_10015023 | 3300009545 | Bacteria | 8068 |
| 89 | Ga0105237_10034633 | 3300009545 | Bacteria | 5112 |
| 90 | Ga0105237_10052671 | 3300009545 | Bacteria | 4084 |
| 91 | Ga0105237_10081158 | 3300009545 | Bacteria | 3233 |
| 92 | Ga0105238_10005256 | 3300009551 | Bacteria | 12801 |
| 93 | Ga0105238_10034068 | 3300009551 | Bacteria | 5182 |
| 94 | Ga0105239_10000002 | 3300010375 | Bacteria | 610298 |
| 95 | Ga0105239_10000578 | 3300010375 | Bacteria | 52273 |
| 96 | Ga0105239_10002733 | 3300010375 | Bacteria | 22146 |
| 97 | Ga0105239_10004552 | 3300010375 | Bacteria | 16523 |
| 98 | Ga0105239_10013932 | 3300010375 | Bacteria | 8927 |
| 99 | Ga0105239_10425880 | 3300010375 | Bacteria | 1504 |
| 100 | Ga0105239_10508615 | 3300010375 | Bacteria | 1370 |
| 101 | Ga0157373_10000265 | 3300013100 | Bacteria | 42223 |
| 102 | Ga0157373_10005193 | 3300013100 | Bacteria | 9786 |
| 103 | Ga0157373_10093740 | 3300013100 | Bacteria | 2115 |
| 104 | Ga0157371_10000141 | 3300013102 | Bacteria | 104396 |
| 105 | Ga0157371_10028295 | 3300013102 | Bacteria | 4060 |
| 106 | Ga0157371_10031605 | 3300013102 | Bacteria | 3814 |
| 107 | Ga0157371_10093791 | 3300013102 | Unclassified | 2127 |
| 108 | Ga0157370_10089534 | 3300013104 | Bacteria | 2891 |
| 109 | Ga0157369_10000940 | 3300013105 | Bacteria | 36995 |
| 110 | Ga0157369_10021123 | 3300013105 | Bacteria | 7278 |
| 111 | Ga0157369_10118200 | 3300013105 | Bacteria | 2814 |
| 112 | Ga0157374_10000129 | 3300013296 | Bacteria | 69468 |
| 113 | Ga0157374_10004070 | 3300013296 | Bacteria | 12276 |
| 114 | Ga0157374_10008076 | 3300013296 | Bacteria | 8999 |
| 115 | Ga0157374_10016021 | 3300013296 | Bacteria | 6585 |
| 116 | Ga0157378_10015548 | 3300013297 | Bacteria | 6665 |
| 117 | Ga0157378_10157218 | 3300013297 | Bacteria | 2123 |
| 118 | Ga0163162_10000068 | 3300013306 | Bacteria | 97068 |
| 119 | Ga0163162_10002705 | 3300013306 | Bacteria | 16819 |
| 120 | Ga0163162_10005929 | 3300013306 | Bacteria | 11823 |
| 121 | Ga0163162_10009936 | 3300013306 | Bacteria | 9257 |
| 122 | Ga0163162_10045128 | 3300013306 | Bacteria | 4415 |
| 123 | Ga0163162_10202909 | 3300013306 | Bacteria | 2112 |
| 124 | Ga0157372_10000061 | 3300013307 | Bacteria | 119814 |
| 125 | Ga0157372_10005116 | 3300013307 | Bacteria | 13933 |
| 126 | Ga0157372_10010950 | 3300013307 | Bacteria | 9651 |
| 127 | Ga0157372_10011189 | 3300013307 | Bacteria | 9542 |
| 128 | Ga0157372_10029423 | 3300013307 | Bacteria | 5997 |
| 129 | Ga0157372_10039043 | 3300013307 | Bacteria | 5240 |
| 130 | Ga0157372_10052070 | 3300013307 | Bacteria | 4557 |
| 131 | Ga0157372_10094599 | 3300013307 | Bacteria | 3403 |
| 132 | Ga0157375_10028945 | 3300013308 | Bacteria | 5202 |
| 133 | Ga0163163_10064911 | 3300014325 | Bacteria | 3623 |
| 134 | Ga0157377_10121546 | 3300014745 | Unclassified | 1583 |
| 135 | Ga0157376_10067575 | 3300014969 | Bacteria | 3024 |
| 136 | Ga0182006_1015455 | 3300015261 | Bacteria | 3272 |
| 137 | Ga0209563_106528 | 3300025230 | Bacteria | 1997 |
| 138 | Ga0207427_100090 | 3300025231 | Bacteria | 133759 |
| 139 | Ga0209437_100034 | 3300025233 | Bacteria | 494007 |
| 140 | Ga0209437_100070 | 3300025233 | Bacteria | 306718 |
| 141 | Ga0209026_1000552 | 3300025250 | Bacteria | 25752 |
| 142 | Ga0209026_1004309 | 3300025250 | Bacteria | 4277 |
| 143 | Ga0209233_1000038 | 3300025261 | Bacteria | 548972 |
| 144 | Ga0207647_10000062 | 3300025904 | Bacteria | 83809 |
| 145 | Ga0207647_10000263 | 3300025904 | Bacteria | 43120 |
| 146 | Ga0207645_10000224 | 3300025907 | Bacteria | 46998 |
| 147 | Ga0207705_10000080 | 3300025909 | Bacteria | 119562 |
| 148 | Ga0207705_10193972 | 3300025909 | Bacteria | 1537 |
| 149 | Ga0207705_10228101 | 3300025909 | Bacteria | 1416 |
| 150 | Ga0207707_10013803 | 3300025912 | Bacteria | 7045 |
| 151 | Ga0207695_10000013 | 3300025913 | Bacteria | 821265 |
| 152 | Ga0207695_10003717 | 3300025913 | Bacteria | 21241 |
| 153 | Ga0207695_10004794 | 3300025913 | Bacteria | 18302 |
| 154 | Ga0207695_10007634 | 3300025913 | Bacteria | 13710 |
| 155 | Ga0207695_10370151 | 3300025913 | Bacteria | 1319 |
| 156 | Ga0207671_10004324 | 3300025914 | Bacteria | 13650 |
| 157 | Ga0207671_10006722 | 3300025914 | Bacteria | 10184 |
| 158 | Ga0207671_10011558 | 3300025914 | Bacteria | 7169 |
| 159 | Ga0207671_10013157 | 3300025914 | Bacteria | 6608 |
| 160 | Ga0207671_10021066 | 3300025914 | Bacteria | 4952 |
| 161 | Ga0207671_10082089 | 3300025914 | Bacteria | 2418 |
| 162 | Ga0207660_10031463 | 3300025917 | Bacteria | 3655 |
| 163 | Ga0207657_10010760 | 3300025919 | Bacteria | 9107 |
| 164 | Ga0207657_10031823 | 3300025919 | Bacteria | 4772 |
| 165 | Ga0207657_10084379 | 3300025919 | Bacteria | 2662 |
| 166 | Ga0207652_10050806 | 3300025921 | Bacteria | 3553 |
| 167 | Ga0207652_10081777 | 3300025921 | Bacteria | 2825 |
| 168 | Ga0207694_10064132 | 3300025924 | Bacteria | 2863 |
| 169 | Ga0207690_10000381 | 3300025932 | Bacteria | 29417 |
| 170 | Ga0207690_10047870 | 3300025932 | Bacteria | 2839 |
| 171 | Ga0207706_10000851 | 3300025933 | Bacteria | 31416 |
| 172 | Ga0207706_10005475 | 3300025933 | Bacteria | 11837 |
| 173 | Ga0207686_10144752 | 3300025934 | Bacteria | 1647 |
| 174 | Ga0207704_10000037 | 3300025938 | Bacteria | 93990 |
| 175 | Ga0207661_10023218 | 3300025944 | Bacteria | 4685 |
| 176 | Ga0207661_10040925 | 3300025944 | Bacteria | 3646 |
| 177 | Ga0207679_10031757 | 3300025945 | Bacteria | 3699 |
| 178 | Ga0207667_10000022 | 3300025949 | Bacteria | 369570 |
| 179 | Ga0207667_10001434 | 3300025949 | Bacteria | 29877 |
| 180 | Ga0207667_10024897 | 3300025949 | Bacteria | 6563 |
| 181 | Ga0207667_10050588 | 3300025949 | Bacteria | 4384 |
| 182 | Ga0207667_10064097 | 3300025949 | Bacteria | 3838 |
| 183 | Ga0207667_10072717 | 3300025949 | Bacteria | 3574 |
| 184 | Ga0207667_10173905 | 3300025949 | Bacteria | 2213 |
| 185 | Ga0207667_10241141 | 3300025949 | Bacteria | 1850 |
| 186 | Ga0207651_10003243 | 3300025960 | Bacteria | 7964 |
| 187 | Ga0207640_10089480 | 3300025981 | Bacteria | 2128 |
| 188 | Ga0207677_10053113 | 3300026023 | Bacteria | 2756 |
| 189 | Ga0207639_10007010 | 3300026041 | Bacteria | 7681 |
| 190 | Ga0207639_10082199 | 3300026041 | Bacteria | 2553 |
| 191 | Ga0207639_10170172 | 3300026041 | Bacteria | 1844 |
| 192 | Ga0207639_10211030 | 3300026041 | Unclassified | 1671 |
| 193 | Ga0207678_10037411 | 3300026067 | Bacteria | 4220 |
| 194 | Ga0207702_10000273 | 3300026078 | Bacteria | 59343 |
| 195 | Ga0207702_10088772 | 3300026078 | Bacteria | 2702 |
| 196 | Ga0207641_10102035 | 3300026088 | Unclassified | 2529 |
| 197 | Ga0207648_10000241 | 3300026089 | Bacteria | 58974 |
| 198 | Ga0207674_10097300 | 3300026116 | Bacteria | 2927 |
| 199 | Ga0207683_10004019 | 3300026121 | Bacteria | 12724 |
| 200 | Ga0207698_10001086 | 3300026142 | Bacteria | 15810 |
| 201 | Ga0207698_10193182 | 3300026142 | Unclassified | 1815 |
| 202 | Ga0268266_10000095 | 3300028379 | Bacteria | 186169 |
| 203 | Ga0307517_10000719 | 3300028786 | Bacteria | 56987 |
| 204 | Ga0307515_10000144 | 3300028794 | Bacteria | 170910 |
| 205 | Ga0307515_10006611 | 3300028794 | Bacteria | 23131 |
| 206 | Ga0307509_10231199 | 3300031507 | Bacteria | 1651 |
| 207 | Ga0307405_10000007 | 3300031731 | Bacteria | 348101 |
| 208 | Ga0307406_10065407 | 3300031901 | Bacteria | 2363 |
| 209 | Ga0307510_10006060 | 3300033180 | Bacteria | 14412 |
| 210 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 211 | Ga0395899_0000382 | 3300037312 | Bacteria | 52888 |
| 212 | Ga0395899_0001182 | 3300037312 | Bacteria | 23011 |
| 213 | Ga0395900_0000362 | 3300037418 | Bacteria | 65661 |
| 214 | Ga0395900_0000694 | 3300037418 | Bacteria | 44919 |
| 215 | Ga0395900_0006049 | 3300037418 | Bacteria | 12620 |
| 216 | Ga0395900_0336604 | 3300037418 | Bacteria | 1486 |
| 217 | Ga0395898_0141146 | 3300037466 | Bacteria | 2306 |
| 218 | Ga0395898_0407699 | 3300037466 | Bacteria | 1296 |
| 219 | Ga0395905_0000841 | 3300037471 | Bacteria | 40055 |
| 220 | Ga0395905_0002834 | 3300037471 | Bacteria | 18986 |
| 221 | Ga0395901_0005109 | 3300038443 | Bacteria | 13255 |
| 222 | Ga0436361_0215474 | 3300039447 | Bacteria | 8137 |
| 223 | Ga0439448_0002495 | 3300042005 | Bacteria | 5012 |
| 224 | Ga0466961_0189677 | 3300044693 | Bacteria | 1274 |
| 225 | Ga0495650_0000003 | 3300046471 | Bacteria | 900730 |
| 226 | Ga0495585_0000771 | 3300046492 | Bacteria | 28305 |
| 227 | Ga0495585_0002283 | 3300046492 | Bacteria | 13840 |
| 228 | Ga0495606_0000116 | 3300046507 | Bacteria | 134901 |
| 229 | Ga0495606_0037300 | 3300046507 | Bacteria | 3302 |
| 230 | Ga0495610_0002083 | 3300046512 | Bacteria | 17078 |
| 231 | Ga0495616_0001938 | 3300046513 | Bacteria | 13915 |
| 232 | Ga0495616_0019427 | 3300046513 | Bacteria | 3709 |
| 233 | Ga0495631_0027513 | 3300046518 | Bacteria | 2601 |
| 234 | Ga0495631_0056715 | 3300046518 | Bacteria | 1706 |
| 235 | Ga0495644_0036707 | 3300046523 | Bacteria | 1848 |
| 236 | Ga0495648_0080212 | 3300046524 | Bacteria | 1860 |
| 237 | Ga0495609_0023245 | 3300046538 | Bacteria | 2850 |
| 238 | Ga0495633_0000027 | 3300046558 | Bacteria | 204613 |
| 239 | Ga0495633_0003745 | 3300046558 | Bacteria | 10007 |
| 240 | Ga0495656_0031336 | 3300046615 | Bacteria | 2156 |
| 241 | Ga0495668_0000010 | 3300046616 | Bacteria | 487308 |
| 242 | Ga0495625_0000219 | 3300046660 | Bacteria | 90690 |
| 243 | Ga0495625_0000381 | 3300046660 | Bacteria | 67732 |
| 244 | Ga0495625_0000939 | 3300046660 | Bacteria | 39095 |
| 245 | Ga0495625_0044432 | 3300046660 | Bacteria | 3216 |
| 246 | Ga0495625_0162761 | 3300046660 | Bacteria | 1494 |
| 247 | Ga0495661_0000244 | 3300046665 | Bacteria | 62633 |
| 248 | Ga0495649_0000037 | 3300046694 | Bacteria | 133848 |
| 249 | Ga0495660_0112156 | 3300046810 | Bacteria | 1390 |
| 250 | Ga0495687_004576 | 3300047443 | Bacteria | 9260 |
| 251 | Ga0495687_036758 | 3300047443 | Bacteria | 2188 |
| 252 | Ga0495686_0002723 | 3300047472 | Bacteria | 16166 |
| 253 | Ga0495686_0002885 | 3300047472 | Bacteria | 15434 |
| 254 | Ga0496108_0096046 | 3300048911 | Bacteria | 2524 |
| 255 | Ga0496109_0064741 | 3300048912 | Bacteria | 3345 |
| 256 | Ga0496113_0147201 | 3300048916 | Bacteria | 1856 |
| 257 | Ga0495678_010265 | 3300049459 | Bacteria | 4562 |
| 258 | Ga0501300_001451 | 3300049523 | Bacteria | 3550 |
| 259 | Ga0501202_010181 | 3300049652 | Bacteria | 1740 |
| 260 | Ga0501257_013081 | 3300049686 | Bacteria | 1901 |
| 261 | nmdc:mga0k408_113409_c1 | 3300050493 | Bacteria | 1603 |
| 262 | nmdc:mga0k408_1566_c1 | 3300050493 | Bacteria | 10893 |
| 263 | nmdc:mga0k408_4422_c1 | 3300050493 | Bacteria | 7459 |
| 264 | Ga0500635_0000844 | 3300053080 | Bacteria | 7544 |
| 265 | Ga0500608_002103 | 3300053122 | Bacteria | 7145 |
| 266 | Ga0500608_002178 | 3300053122 | Bacteria | 7048 |
| 267 | Ga0500618_000013 | 3300053125 | Bacteria | 183026 |
| 268 | Ga0500564_089668 | 3300053138 | Bacteria | 1370 |
| 269 | 2599478572 | 2599185184 | Bacteria | 6430550 |
| 270 | 2819681781 | 2818991460 | Bacteria | 7595395 |
| 271 | 2852624087 | 2852623160 | Bacteria | 4376875 |
| 272 | 2881247947 | 2881247448 | Bacteria | 3717788 |
| 273 | 2884936991 | 2884933994 | Bacteria | 4535041 |
| 274 | 2919442300 | 2919437846 | Bacteria | 6199444 |
| 275 | 2928080373 | 2928078545 | Bacteria | 6534839 |
| 276 | 2928149454 | 2928147474 | Bacteria | 6512076 |
| 277 | 2932083282 | 2932082852 | Bacteria | 6563563 |
| 278 | 2965320727 | 2965320100 | Bacteria | 3975600 |
| 279 | 2977236721 | 2977232053 | Bacteria | 5485925 |
| 280 | Ga0105239_10000006 | |||
| 281 | JGI24739J22299_10004594 | |||
| 282 | JGI24737J22298_10015917 | |||
| 283 | JGI24743J22301_10012794 | |||
| 284 | JGI24735J21928_10000002 | |||
| 285 | JGI25162J39368_1000427 | |||
| 286 | JGI25406J46586_10000481 | |||
| 287 | JGI25165J46597_1000548 | |||
| 288 | rootH2_10005324 | |||
| 289 | rootH2_10006566 | |||
| 290 | rootL2_10002169 | |||
| 291 | rootH1_10015057 | |||
| 292 | rootH1_10018087 | |||
| 293 | rootH1_10227823 | |||
| 294 | Ga0065714_10066685 | |||
| 295 | Ga0070658_10000045 | |||
| 296 | Ga0070658_10148520 | |||
| 297 | Ga0070658_10274493 | |||
| 298 | Ga0070676_10012953 | |||
| 299 | Ga0070683_100010201 | |||
| 300 | Ga0070683_100055694 | |||
| 301 | Ga0070683_100434607 | |||
| 302 | Ga0070690_100040161 | |||
| 303 | Ga0070680_100026855 | |||
| 304 | Ga0070660_100025581 | |||
| 305 | Ga0070660_100030784 | |||
| 306 | Ga0070661_100045951 | |||
| 307 | Ga0070675_100025984 | |||
| 308 | Ga0070673_100005217 | |||
| 309 | Ga0070673_100011628 | |||
| 310 | Ga0070659_100000100 | |||
| 311 | Ga0070659_100007598 | |||
| 312 | Ga0070659_100021347 | |||
| 313 | Ga0070659_100157772 | |||
| 314 | Ga0070663_100013896 | |||
| 315 | Ga0070678_100006999 | |||
| 316 | Ga0070662_100000103 | |||
| 317 | Ga0070662_100011894 | |||
| 318 | Ga0070681_10018112 | |||
| 319 | Ga0070681_10227875 | |||
| 320 | Ga0070679_100016656 | |||
| 321 | Ga0070679_100085478 | |||
| 322 | Ga0070684_100012103 | |||
| 323 | Ga0068853_100013617 | |||
| 324 | Ga0068853_100057797 | |||
| 325 | Ga0068853_100095670 | |||
| 326 | Ga0070693_100118013 | |||
| 327 | Ga0070665_100000083 | |||
| 328 | Ga0068855_100000026 | |||
| 329 | Ga0068855_100000621 | |||
| 330 | Ga0068855_100023301 | |||
| 331 | Ga0068855_100086362 | |||
| 332 | Ga0068855_100088165 | |||
| 333 | Ga0068855_100246746 | |||
| 334 | Ga0070664_100041213 | |||
| 335 | Ga0068857_100030463 | |||
| 336 | Ga0068854_100054523 | |||
| 337 | Ga0068856_100000263 | |||
| 338 | Ga0068856_100011583 | |||
| 339 | Ga0068856_100013971 | |||
| 340 | Ga0068856_100047192 | |||
| 341 | Ga0068856_100084300 | |||
| 342 | Ga0068859_100024845 | |||
| 343 | Ga0068866_10038064 | |||
| 344 | Ga0075366_10004531 | |||
| 345 | Ga0075366_10020929 | |||
| 346 | Ga0097621_100000440 | |||
| 347 | Ga0097621_100010696 | |||
| 348 | Ga0068871_100000181 | |||
| 349 | Ga0068871_100400498 | |||
| 350 | Ga0068865_100006733 | |||
| 351 | Ga0097620_100024845 | |||
| 352 | Ga0105240_10000722 | |||
| 353 | Ga0105240_10005447 | |||
| 354 | Ga0105240_10005860 | |||
| 355 | Ga0105240_10058012 | |||
| 356 | Ga0105240_10244914 | |||
| 357 | Ga0105245_10118624 | |||
| 358 | Ga0105243_10009284 | |||
| 359 | Ga0105241_10006426 | |||
| 360 | Ga0105241_10044190 | |||
| 361 | Ga0105241_10060404 | |||
| 362 | Ga0105241_10078019 | |||
| 363 | Ga0105241_10124483 | |||
| 364 | Ga0105237_10000173 | |||
| 365 | Ga0105237_10001717 | |||
| 366 | Ga0105237_10002523 | |||
| 367 | Ga0105237_10015023 | |||
| 368 | Ga0105237_10034633 | |||
| 369 | Ga0105237_10052671 | |||
| 370 | Ga0105237_10081158 | |||
| 371 | Ga0105238_10005256 | |||
| 372 | Ga0105238_10034068 | |||
| 373 | Ga0105239_10000002 | |||
| 374 | Ga0105239_10000578 | |||
| 375 | Ga0105239_10002733 | |||
| 376 | Ga0105239_10004552 | |||
| 377 | Ga0105239_10013932 | |||
| 378 | Ga0105239_10425880 | |||
| 379 | Ga0105239_10508615 | |||
| 380 | Ga0157373_10000265 | |||
| 381 | Ga0157373_10005193 | |||
| 382 | Ga0157373_10093740 | |||
| 383 | Ga0157371_10000141 | |||
| 384 | Ga0157371_10028295 | |||
| 385 | Ga0157371_10031605 | |||
| 386 | Ga0157371_10093791 | |||
| 387 | Ga0157370_10089534 | |||
| 388 | Ga0157369_10000940 | |||
| 389 | Ga0157369_10021123 | |||
| 390 | Ga0157369_10118200 | |||
| 391 | Ga0157374_10000129 | |||
| 392 | Ga0157374_10004070 | |||
| 393 | Ga0157374_10008076 | |||
| 394 | Ga0157374_10016021 | |||
| 395 | Ga0157378_10015548 | |||
| 396 | Ga0157378_10157218 | |||
| 397 | Ga0163162_10000068 | |||
| 398 | Ga0163162_10002705 | |||
| 399 | Ga0163162_10005929 | |||
| 400 | Ga0163162_10009936 | |||
| 401 | Ga0163162_10045128 | |||
| 402 | Ga0163162_10202909 | |||
| 403 | Ga0157372_10000061 | |||
| 404 | Ga0157372_10005116 | |||
| 405 | Ga0157372_10010950 | |||
| 406 | Ga0157372_10011189 | |||
| 407 | Ga0157372_10029423 | |||
| 408 | Ga0157372_10039043 | |||
| 409 | Ga0157372_10052070 | |||
| 410 | Ga0157372_10094599 | |||
| 411 | Ga0157375_10028945 | |||
| 412 | Ga0163163_10064911 | |||
| 413 | Ga0157377_10121546 | |||
| 414 | Ga0157376_10067575 | |||
| 415 | Ga0182006_1015455 | |||
| 416 | Ga0209563_106528 | |||
| 417 | Ga0207427_100090 | |||
| 418 | Ga0209437_100034 | |||
| 419 | Ga0209437_100070 | |||
| 420 | Ga0209026_1000552 | |||
| 421 | Ga0209026_1004309 | |||
| 422 | Ga0209233_1000038 | |||
| 423 | Ga0207647_10000062 | |||
| 424 | Ga0207647_10000263 | |||
| 425 | Ga0207645_10000224 | |||
| 426 | Ga0207705_10000080 | |||
| 427 | Ga0207705_10193972 | |||
| 428 | Ga0207705_10228101 | |||
| 429 | Ga0207707_10013803 | |||
| 430 | Ga0207695_10000013 | |||
| 431 | Ga0207695_10003717 | |||
| 432 | Ga0207695_10004794 | |||
| 433 | Ga0207695_10007634 | |||
| 434 | Ga0207695_10370151 | |||
| 435 | Ga0207671_10004324 | |||
| 436 | Ga0207671_10006722 | |||
| 437 | Ga0207671_10011558 | |||
| 438 | Ga0207671_10013157 | |||
| 439 | Ga0207671_10021066 | |||
| 440 | Ga0207671_10082089 | |||
| 441 | Ga0207660_10031463 | |||
| 442 | Ga0207657_10010760 | |||
| 443 | Ga0207657_10031823 | |||
| 444 | Ga0207657_10084379 | |||
| 445 | Ga0207652_10050806 | |||
| 446 | Ga0207652_10081777 | |||
| 447 | Ga0207694_10064132 | |||
| 448 | Ga0207690_10000381 | |||
| 449 | Ga0207690_10047870 | |||
| 450 | Ga0207706_10000851 | |||
| 451 | Ga0207706_10005475 | |||
| 452 | Ga0207686_10144752 | |||
| 453 | Ga0207704_10000037 | |||
| 454 | Ga0207661_10023218 | |||
| 455 | Ga0207661_10040925 | |||
| 456 | Ga0207679_10031757 | |||
| 457 | Ga0207667_10000022 | |||
| 458 | Ga0207667_10001434 | |||
| 459 | Ga0207667_10024897 | |||
| 460 | Ga0207667_10050588 | |||
| 461 | Ga0207667_10064097 | |||
| 462 | Ga0207667_10072717 | |||
| 463 | Ga0207667_10173905 | |||
| 464 | Ga0207667_10241141 | |||
| 465 | Ga0207651_10003243 | |||
| 466 | Ga0207640_10089480 | |||
| 467 | Ga0207677_10053113 | |||
| 468 | Ga0207639_10007010 | |||
| 469 | Ga0207639_10082199 | |||
| 470 | Ga0207639_10170172 | |||
| 471 | Ga0207639_10211030 | |||
| 472 | Ga0207678_10037411 | |||
| 473 | Ga0207702_10000273 | |||
| 474 | Ga0207702_10088772 | |||
| 475 | Ga0207641_10102035 | |||
| 476 | Ga0207648_10000241 | |||
| 477 | Ga0207674_10097300 | |||
| 478 | Ga0207683_10004019 | |||
| 479 | Ga0207698_10001086 | |||
| 480 | Ga0207698_10193182 | |||
| 481 | Ga0268266_10000095 | |||
| 482 | Ga0307517_10000719 | |||
| 483 | Ga0307515_10000144 | |||
| 484 | Ga0307515_10006611 | |||
| 485 | Ga0307509_10231199 | |||
| 486 | Ga0307405_10000007 | |||
| 487 | Ga0307406_10065407 | |||
| 488 | Ga0307510_10006060 | |||
| 489 | Ga0395899_0000001 | |||
| 490 | Ga0395899_0000382 | |||
| 491 | Ga0395899_0001182 | |||
| 492 | Ga0395900_0000362 | |||
| 493 | Ga0395900_0000694 | |||
| 494 | Ga0395900_0006049 | |||
| 495 | Ga0395900_0336604 | |||
| 496 | Ga0395898_0141146 | |||
| 497 | Ga0395898_0407699 | |||
| 498 | Ga0395905_0000841 | |||
| 499 | Ga0395905_0002834 | |||
| 500 | Ga0395901_0005109 | |||
| 501 | Ga0436361_0215474 | |||
| 502 | Ga0439448_0002495 | |||
| 503 | Ga0466961_0189677 | |||
| 504 | Ga0495650_0000003 | |||
| 505 | Ga0495585_0000771 | |||
| 506 | Ga0495585_0002283 | |||
| 507 | Ga0495606_0000116 | |||
| 508 | Ga0495606_0037300 | |||
| 509 | Ga0495610_0002083 | |||
| 510 | Ga0495616_0001938 | |||
| 511 | Ga0495616_0019427 | |||
| 512 | Ga0495631_0027513 | |||
| 513 | Ga0495631_0056715 | |||
| 514 | Ga0495644_0036707 | |||
| 515 | Ga0495648_0080212 | |||
| 516 | Ga0495609_0023245 | |||
| 517 | Ga0495633_0000027 | |||
| 518 | Ga0495633_0003745 | |||
| 519 | Ga0495656_0031336 | |||
| 520 | Ga0495668_0000010 | |||
| 521 | Ga0495625_0000219 | |||
| 522 | Ga0495625_0000381 | |||
| 523 | Ga0495625_0000939 | |||
| 524 | Ga0495625_0044432 | |||
| 525 | Ga0495625_0162761 | |||
| 526 | Ga0495661_0000244 | |||
| 527 | Ga0495649_0000037 | |||
| 528 | Ga0495660_0112156 | |||
| 529 | Ga0495687_004576 | |||
| 530 | Ga0495687_036758 | |||
| 531 | Ga0495686_0002723 | |||
| 532 | Ga0495686_0002885 | |||
| 533 | Ga0496108_0096046 | |||
| 534 | Ga0496109_0064741 | |||
| 535 | Ga0496113_0147201 | |||
| 536 | Ga0495678_010265 | |||
| 537 | Ga0501300_001451 | |||
| 538 | Ga0501202_010181 | |||
| 539 | Ga0501257_013081 | |||
| 540 | nmdc:mga0k408_113409_c1 | |||
| 541 | nmdc:mga0k408_1566_c1 | |||
| 542 | nmdc:mga0k408_4422_c1 | |||
| 543 | Ga0500635_0000844 | |||
| 544 | Ga0500608_002103 | |||
| 545 | Ga0500608_002178 | |||
| 546 | Ga0500618_000013 | |||
| 547 | Ga0500564_089668 | |||
| 548 | 2599478572 | |||
| 549 | 2819681781 | |||
| 550 | 2852624087 | |||
| 551 | 2881247947 | |||
| 552 | 2884936991 | |||
| 553 | 2919442300 | |||
| 554 | 2928080373 | |||
| 555 | 2928149454 | |||
| 556 | 2932083282 | |||
| 557 | 2965320727 | |||
| 558 | 2977236721 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2h7g-assembly1.cif.gz_X | structure of variola topoisomerase non-covalently bound to dna | 0.7687 | 34 | 358 |
| 2h7g-assembly1.cif.gz_X | structure of variola topoisomerase non-covalently bound to dna | 0.7599 | 34 | 358 |
| 1k4s-assembly1.cif.gz_A | human dna topoisomerase i in covalent complex with a 22 base pair dna duplex | 0.7377 | 81 | 336 |
| 2b9s-assembly1.cif.gz_A | crystal structure of heterodimeric l. donovani topoisomerase i-vanadate-dna complex | 0.7344 | 67 | 301 |
| 3m4a-assembly1.cif.gz_A | crystal structure of a bacterial topoisomerase ib in complex with dna reveals a secondary dna binding site | 0.7343 | 57 | 357 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3m4aA03 | Alpha Beta;Alpha-Beta Complex;Topoisomerase I; Chain A, domain 3;Topoisomerase I; Chain A, domain 3 | 0.951 | 135 | 250 | 3.90.15.10 |
| 3m4aA03 | Alpha Beta;Alpha-Beta Complex;Topoisomerase I; Chain A, domain 3;Topoisomerase I; Chain A, domain 3 | 0.9279 | 135 | 250 | 3.90.15.10 |
| 2f4qA03 | Alpha Beta;Alpha-Beta Complex;Topoisomerase I; Chain A, domain 3;Topoisomerase I; Chain A, domain 3 | 0.9084 | 144 | 250 | 3.90.15.10 |
| af_Q9USZ0_628_894_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8831 | 180 | 205 | 2.130.10.10 |
| af_A0A2R8S0L3_185_312_3.90.15.10 | Alpha Beta;Alpha-Beta Complex;Topoisomerase I; Chain A, domain 3;Topoisomerase I; Chain A, domain 3 | 0.8752 | 108 | 210 | 3.90.15.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2A2KIQ3-F1-model_v4 | DNA topoisomerase I catalytic core eukaryotic-type domain-containing protein | 0.987 | 117 | 237 |
GO:0003677
GO:0003917 GO:0006265 |
| AF-A0A7X7H7H0-F1-model_v4 | DNA topoisomerase (EC 5.6.2.1) | 0.9791 | 116 | 355 |
GO:0003677
GO:0003917 GO:0006265 |
| AF-A0A3C0BSX0-F1-model_v4 | Topoisomerase I | 0.9755 | 13 | 100 |
GO:0016853
|
| AF-A0A436L3U7-F1-model_v4 | deleted | 0.9739 | 132 | 289 |
|
| AF-A0A536GTZ5-F1-model_v4 | DNA topoisomerase (EC 5.6.2.1) | 0.9735 | 135 | 273 |
GO:0003677
GO:0003917 GO:0006265 |