F383103

General Info

Members Datasets Scaffolds Average Seq Length
279 222 258 264

Family's Representative Sequence

Representative Sequence 3300025292|Ga0209676_1005425|Ga0209676_10054257
Length 302
Sequence VADPAFYPLSGLFQVAAVESVKFLALSAPLRPHYRSFALLRITSINLNGIRSAFKKGLQPWMEKHAADVLCLQEIKVSHEDLTDELRHPPGYTGHFHHAVKKGYSGVGIYLRDAAERVNNGFDCEEFDSEGRIIRADWKDLSVISAYLPSGSSGDERQQAKYRFLDSFGPWIDALMHEHKTTGREFVICGDWNIAHKEIDLKNWKGNMKNSGFLPEERAWLTDVFDKRGFVDVFRTIDDRPDQYTWWSNRGQAWAKNVGWRIDYQIATPGIAAKARSVAIYKDERFSDHAPLTIDYDFTLRA

Samples

Sample ID Description Type Environment
1 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
2 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
3 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
4 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
5 2643221569 Achromobacter sp. Root565 Isolate Unclassified
6 2643221585 Pelomonas sp. Root662 Isolate Unclassified
7 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
8 2643221594 Achromobacter sp. Root170 Isolate Unclassified
9 2643221621 Achromobacter sp. Root83 Isolate Unclassified
10 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
11 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
12 2643221656 Pelomonas sp. Root405 Isolate Unclassified
13 2738541337 Pelomonas sp. BT06 Isolate Unclassified
14 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
15 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
16 2858950400 Achromobacter sp. K91 Isolate Unclassified
17 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
18 2941479691
19 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
20 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
21 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
22 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
23 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
27 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
28 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
29 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
73 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
109 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
112 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
113 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
114 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
124 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
140 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
141 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
142 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
143 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
144 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
145 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
146 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
147 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
148 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
199 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
200 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
201 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
202 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
203 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
204 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
205 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
206 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
207 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
208 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
209 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
210 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
211 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
216 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
217 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
218 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
219 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
221 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
222 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.47
Metatranscriptomes 0
Isolates 7.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.19
Nodule 0
Rhizoplane 2.87
Rhizosphere 64.87
Stem 0
Stem Tuber 0
Unclassified 20.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000118 3300002705 Bacteria 57694
2 JGI25154J39366_1002573 3300002738 Bacteria 4568
3 JGI25157J39369_1000278 3300002741 Bacteria 37495
4 JGI25164J39214_1003809 3300002772 Bacteria 1829
5 rootH1_10007734 3300003316 Bacteria 4607
6 rootH2_10002613 3300003320 Bacteria 10338
7 Ga0055533_1000048 3300003756 Bacteria 212106
8 Ga0055533_1000068 3300003756 Bacteria 155215
9 Ga0055525_1001273 3300003759 Bacteria 5282
10 Ga0055535_1000306 3300003761 Bacteria 49813
11 Ga0055529_1000291 3300003763 Bacteria 58444
12 Ga0055530_10039349 3300003791 Bacteria 1168
13 Ga0055531_10000022 3300003794 Bacteria 166362
14 Ga0065707_10002290 3300005295 Bacteria 6325
15 Ga0070676_10044611 3300005328 Bacteria 2581
16 Ga0070683_100141879 3300005329 Bacteria 2276
17 Ga0070690_100012689 3300005330 Bacteria 4962
18 Ga0070670_100048842 3300005331 Bacteria 3640
19 Ga0068869_100178887 3300005334 Bacteria 1662
20 Ga0068868_100204747 3300005338 Bacteria 1647
21 Ga0070661_100230093 3300005344 Bacteria 1424
22 Ga0070671_100011504 3300005355 Bacteria 7114
23 Ga0070674_100252787 3300005356 Bacteria 1385
24 Ga0070673_100012678 3300005364 Bacteria 5798
25 Ga0070673_100019279 3300005364 Bacteria 4896
26 Ga0068867_100025658 3300005459 Bacteria 4229
27 Ga0070679_100374246 3300005530 Bacteria 1371
28 Ga0070684_100032022 3300005535 Bacteria 4479
29 Ga0070697_100024026 3300005536 Bacteria 4851
30 Ga0070672_100073297 3300005543 Bacteria 2729
31 Ga0070693_100151673 3300005547 Bacteria 1469
32 Ga0068855_100461765 3300005563 Bacteria 1384
33 Ga0068854_100267748 3300005578 Bacteria 1370
34 Ga0068856_100001787 3300005614 Bacteria 22472
35 Ga0068856_100179551 3300005614 Bacteria 2130
36 Ga0068852_100212119 3300005616 Bacteria 1837
37 Ga0068852_100965400 3300005616 Bacteria 870
38 Ga0068861_100034413 3300005719 Bacteria 3746
39 Ga0068860_100190847 3300005843 Bacteria 1983
40 Ga0081455_10064427 3300005937 Bacteria 3068
41 Ga0075364_10000711 3300006051 Bacteria 17429
42 Ga0075364_10049175 3300006051 Bacteria 2749
43 Ga0075366_10062084 3300006195 Bacteria 2221
44 Ga0075370_10002458 3300006353 Bacteria 8592
45 Ga0075370_10011382 3300006353 Bacteria 4671
46 Ga0075434_100000011 3300006871 Bacteria 86261
47 Ga0068865_100029907 3300006881 Bacteria 3619
48 Ga0105244_10060113 3300009036 Bacteria 1915
49 Ga0105244_10129989 3300009036 Bacteria 1215
50 Ga0105245_10098804 3300009098 Bacteria 2697
51 Ga0105243_10440596 3300009148 Bacteria 1220
52 Ga0105242_10042687 3300009176 Bacteria 3664
53 Ga0105237_10221909 3300009545 Bacteria 1890
54 Ga0105238_10098802 3300009551 Bacteria 2902
55 Ga0105239_10369990 3300010375 Bacteria 1620
56 Ga0105246_10066580 3300011119 Bacteria 2522
57 Ga0105246_10140792 3300011119 Bacteria 1814
58 Ga0157347_1002983 3300012502 Bacteria 1488
59 Ga0157369_10089139 3300013105 Bacteria 3293
60 Ga0157369_10301520 3300013105 Bacteria 1666
61 Ga0157375_10061686 3300013308 Bacteria 3724
62 Ga0213872_10002028 3300021361 Bacteria 12306
63 Ga0209674_100024 3300025226 Bacteria 535481
64 Ga0209563_100101 3300025230 Bacteria 152297
65 Ga0207427_101602 3300025231 Bacteria 7735
66 Ga0209258_100180 3300025242 Bacteria 137306
67 Ga0209258_100719 3300025242 Bacteria 22138
68 Ga0209646_1000012 3300025246 Bacteria 573300
69 Ga0209026_1000004 3300025250 Bacteria 949012
70 Ga0209677_100091 3300025253 Bacteria 106743
71 Ga0209759_1000003 3300025256 Bacteria 792130
72 Ga0209759_1000067 3300025256 Bacteria 183764
73 Ga0209759_1002004 3300025256 Bacteria 9697
74 Ga0209759_1002222 3300025256 Bacteria 8867
75 Ga0209455_1000144 3300025272 Bacteria 137313
76 Ga0209676_1005425 3300025292 Bacteria 6668
77 Ga0209050_1005661 3300025298 Bacteria 7735
78 Ga0209050_1005921 3300025298 Bacteria 7454
79 Ga0209051_1013918 3300025303 Bacteria 3792
80 Ga0209257_1000061 3300025304 Bacteria 367698
81 Ga0209257_1008788 3300025304 Bacteria 5611
82 Ga0207647_10058799 3300025904 Bacteria 2353
83 Ga0207654_10121168 3300025911 Bacteria 1643
84 Ga0207695_10014938 3300025913 Bacteria 9164
85 Ga0207671_10039624 3300025914 Bacteria 3489
86 Ga0207657_10037174 3300025919 Bacteria 4352
87 Ga0207649_10205761 3300025920 Bacteria 1393
88 Ga0207694_10018427 3300025924 Bacteria 5276
89 Ga0207650_10100122 3300025925 Bacteria 2229
90 Ga0207687_10178141 3300025927 Bacteria 1645
91 Ga0207644_10090212 3300025931 Bacteria 2283
92 Ga0207686_10138754 3300025934 Bacteria 1678
93 Ga0207691_10038444 3300025940 Bacteria 4429
94 Ga0207691_10256523 3300025940 Bacteria 1508
95 Ga0207689_10029951 3300025942 Bacteria 4539
96 Ga0207689_10182107 3300025942 Bacteria 1732
97 Ga0207661_10334921 3300025944 Bacteria 1363
98 Ga0207667_10004177 3300025949 Bacteria 17738
99 Ga0207667_10407108 3300025949 Bacteria 1385
100 Ga0207651_10000865 3300025960 Bacteria 13233
101 Ga0207651_10031453 3300025960 Bacteria 3393
102 Ga0207702_10000441 3300026078 Bacteria 47113
103 Ga0207702_10144211 3300026078 Bacteria 2159
104 Ga0207648_10006795 3300026089 Bacteria 11341
105 Ga0207674_10014262 3300026116 Bacteria 8781
106 Ga0207683_10296131 3300026121 Bacteria 1480
107 Ga0209371_1008204 3300027312 Bacteria 3513
108 Ga0209371_1022800 3300027312 Bacteria 1488
109 Ga0209371_1031927 3300027312 Bacteria 1137
110 Ga0268264_10107618 3300028381 Bacteria 2436
111 Ga0265323_10010026 3300028653 Bacteria 3850
112 Ga0265336_10000030 3300028666 Bacteria 169335
113 Ga0265336_10000081 3300028666 Bacteria 76621
114 Ga0307515_10064558 3300028794 Bacteria 5117
115 Ga0265324_10000018 3300029957 Bacteria 184238
116 Ga0265324_10000522 3300029957 Bacteria 26385
117 Ga0268256_1007886 3300030500 Bacteria 3727
118 Ga0268256_1025792 3300030500 Bacteria 1488
119 Ga0307512_10089886 3300030522 Bacteria 2145
120 Ga0265328_10018889 3300031239 Bacteria 2653
121 Ga0265325_10000035 3300031241 Bacteria 99051
122 Ga0265327_10000147 3300031251 Bacteria 153254
123 Ga0265316_10002522 3300031344 Bacteria 18928
124 Ga0265316_10215402 3300031344 Bacteria 1419
125 Ga0307513_10089204 3300031456 Bacteria 3149
126 Ga0307513_10127317 3300031456 Bacteria 2499
127 Ga0307509_10000145 3300031507 Bacteria 107492
128 Ga0307408_100000006 3300031548 Bacteria 472824
129 Ga0307514_10000595 3300031649 Bacteria 67797
130 Ga0265314_10062888 3300031711 Bacteria 2520
131 Ga0307516_10000243 3300031730 Bacteria 70407
132 Ga0316577_10017492 3300031733 Bacteria 3959
133 Ga0307412_10000162 3300031911 Bacteria 47157
134 Ga0307414_10010953 3300032004 Bacteria 5296
135 Ga0307411_10003380 3300032005 Bacteria 7388
136 Ga0307507_10116125 3300033179 Bacteria 2163
137 Ga0373931_0006262 3300035691 Bacteria 5550
138 Ga0373931_0105403 3300035691 Bacteria 1592
139 Ga0373927_0017513 3300035695 Bacteria 4714
140 Ga0373933_0137124 3300035724 Bacteria 1542
141 Ga0373925_0004020 3300037068 Bacteria 11182
142 Ga0395900_0000147 3300037418 Bacteria 118678
143 Ga0395898_0000747 3300037466 Bacteria 56704
144 Ga0395898_0002803 3300037466 Bacteria 19977
145 Ga0395898_0006871 3300037466 Bacteria 12104
146 Ga0395905_0000713 3300037471 Bacteria 43906
147 Ga0395905_0002445 3300037471 Bacteria 20576
148 Ga0395901_0059075 3300038443 Bacteria 3989
149 Ga0436361_0522086 3300039447 Bacteria 2069
150 Ga0436361_0802941 3300039447 Bacteria 44636
151 Ga0436361_1066747 3300039447 Bacteria 5372
152 Ga0451853_1286128 3300041512 Bacteria 1161
153 Ga0451853_3631845 3300041512 Bacteria 1157
154 Ga0439437_005987 3300042000 Bacteria 1344
155 Ga0450917_000549 3300042120 Bacteria 2803
156 Ga0450888_000246 3300042126 Bacteria 4961
157 Ga0450890_001317 3300042127 Bacteria 3585
158 Ga0450903_009357 3300042138 Bacteria 1598
159 Ga0450904_002869 3300042139 Bacteria 1956
160 Ga0450889_001756 3300042144 Bacteria 2194
161 Ga0450893_0012131 3300042532 Bacteria 1429
162 Ga0466969_0000009 3300044656 Bacteria 125464
163 Ga0466969_0171266 3300044656 Bacteria 995
164 Ga0466972_0001989 3300044658 Bacteria 9996
165 Ga0466972_0125213 3300044658 Bacteria 1211
166 Ga0466965_0032033 3300044683 Bacteria 2567
167 Ga0466965_0039477 3300044683 Bacteria 2320
168 Ga0466966_0009962 3300044684 Bacteria 6298
169 Ga0466966_0045959 3300044684 Bacteria 2789
170 Ga0466966_0120541 3300044684 Bacteria 1611
171 Ga0466963_0084674 3300044694 Bacteria 2151
172 Ga0466963_0115444 3300044694 Bacteria 1845
173 Ga0466964_0005250 3300044706 Bacteria 4801
174 Ga0453684_0205460 3300044712 Bacteria 2293
175 Ga0453684_0324210 3300044712 Bacteria 1743
176 Ga0466971_0007614 3300044719 Bacteria 4722
177 Ga0466970_0076695 3300044765 Bacteria 1801
178 Ga0466960_0020308 3300044901 Bacteria 2940
179 Ga0466959_0000590 3300045049 Bacteria 21130
180 Ga0466959_0143578 3300045049 Bacteria 1685
181 Ga0451576_0043488 3300045051 Bacteria 4739
182 Ga0451576_0100423 3300045051 Bacteria 3009
183 Ga0451576_0410136 3300045051 Bacteria 1421
184 Ga0466958_0382900 3300045836 Bacteria 907
185 Ga0466967_0038451 3300045976 Bacteria 4104
186 Ga0466967_0102401 3300045976 Bacteria 2619
187 Ga0495592_0235275 3300046454 Bacteria 1218
188 Ga0495651_0104758 3300046462 Bacteria 2099
189 Ga0495650_0009460 3300046471 Bacteria 5537
190 Ga0495639_0008218 3300046475 Bacteria 4481
191 Ga0495585_0064170 3300046492 Bacteria 2014
192 Ga0495585_0108234 3300046492 Bacteria 1481
193 Ga0495583_0000022 3300046506 Bacteria 282544
194 Ga0495606_0004058 3300046507 Bacteria 14914
195 Ga0495630_0308399 3300046517 Bacteria 1210
196 Ga0495625_0010539 3300046660 Bacteria 7635
197 Ga0495669_0005248 3300046684 Bacteria 5398
198 Ga0495671_0250129 3300046692 Bacteria 855
199 Ga0495649_0000276 3300046694 Bacteria 45246
200 Ga0495589_0001955 3300046794 Bacteria 11669
201 Ga0495686_0019391 3300047472 Bacteria 4544
202 Ga0496100_0140233 3300048903 Bacteria 1712
203 Ga0496101_0212832 3300048904 Bacteria 1498
204 Ga0496104_0506395 3300048907 Bacteria 1119
205 Ga0496106_0072766 3300048909 Bacteria 2629
206 Ga0496109_0044317 3300048912 Bacteria 4036
207 Ga0496110_0186342 3300048913 Bacteria 1884
208 Ga0496114_0082100 3300048917 Bacteria 2724
209 Ga0496116_0018432 3300048919 Bacteria 5382
210 Ga0496117_0020736 3300048920 Bacteria 5348
211 Ga0496117_0025151 3300048920 Bacteria 4688
212 Ga0496118_0012713 3300048921 Bacteria 8048
213 Ga0496118_0085970 3300048921 Bacteria 2187
214 Ga0496119_0005298 3300048922 Bacteria 12421
215 Ga0496120_0046389 3300048923 Bacteria 2511
216 Ga0496121_0000195 3300048924 Bacteria 136162
217 Ga0496122_0001745 3300048925 Bacteria 33579
218 Ga0496122_0025818 3300048925 Bacteria 5087
219 Ga0496123_0001434 3300048926 Bacteria 33265
220 Ga0496123_0032104 3300048926 Bacteria 3809
221 Ga0496124_0000273 3300048927 Bacteria 99505
222 Ga0496124_0024545 3300048927 Bacteria 5477
223 Ga0496125_0000364 3300048928 Bacteria 85440
224 Ga0496125_0015987 3300048928 Bacteria 7226
225 Ga0496125_0073621 3300048928 Bacteria 2654
226 Ga0496126_0100632 3300048929 Bacteria 2529
227 Ga0496126_0174005 3300048929 Bacteria 1832
228 Ga0501297_001489 3300049520 Bacteria 2156
229 Ga0501031_0067158 3300049568 Bacteria 2336
230 Ga0501034_0242285 3300049571 Bacteria 1749
231 Ga0501038_0076710 3300049574 Bacteria 2823
232 Ga0501038_0289871 3300049574 Bacteria 1287
233 Ga0501048_0229173 3300049582 Bacteria 1318
234 Ga0501198_000003 3300049649 Bacteria 175301
235 Ga0501199_000857 3300049650 Bacteria 2690
236 Ga0501202_016762 3300049652 Bacteria 1425
237 Ga0501211_002140 3300049658 Bacteria 2101
238 Ga0501222_000001 3300049662 Bacteria 307689
239 Ga0501222_006509 3300049662 Bacteria 1569
240 Ga0501223_012055 3300049663 Bacteria 1733
241 Ga0501233_000345 3300049668 Bacteria 7227
242 Ga0501235_007267 3300049669 Bacteria 2415
243 Ga0501253_001277 3300049683 Bacteria 2513
244 Ga0501257_013452 3300049686 Bacteria 1876
245 Ga0501258_000107 3300049687 Bacteria 4567
246 Ga0501232_000149 3300049757 Bacteria 3931
247 Ga0501267_000803 3300049764 Bacteria 2541
248 Ga0501269_003509 3300049766 Bacteria 1899
249 Ga0501044_0036758 3300049823 Bacteria 5122
250 nmdc:mga00v17_844_c1 3300050491 Bacteria 16611
251 nmdc:mga0k408_60420_c1 3300050493 Bacteria 2202
252 nmdc:mga07m45_1920_c1 3300050496 Bacteria 9607
253 nmdc:mga07m45_314223_c1 3300050496 Bacteria 911
254 Ga0500635_0000312 3300053080 Bacteria 16996
255 Ga0500559_0071712 3300053136 Bacteria 1560
256 Ga0500636_0011853 3300053177 Bacteria 5106
257 Ga0500661_010936 3300055283 Bacteria 1647
258 Ga0466962_0030813 3300061719 Bacteria 2568

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048903 Ga0496100_0140233 Ga0496100_0140233_368_1045 217
2 3300005530 Ga0070679_100374246 Ga0070679_1003742462 225
3 3300035691 Ga0373931_0105403 Ga0373931_0105403_57_770 237
4 3300045976 Ga0466967_0102401 Ga0466967_0102401_17_730 237
5 3300046692 Ga0495671_0250129 Ga0495671_0250129_32_745 237
6 3300035724 Ga0373933_0137124 Ga0373933_0137124_268_987 238
7 3300050496 nmdc:mga07m45_1920_c1 nmdc:mga07m45_1920_c1_4281_5009 242
8 3300005614 Ga0068856_100179551 Ga0068856_1001795511 243
9 3300026078 Ga0207702_10144211 Ga0207702_101442112 243
10 3300035695 Ga0373927_0017513 Ga0373927_0017513_3124_3870 243
11 3300037068 Ga0373925_0004020 Ga0373925_0004020_8098_8844 243
12 3300048907 Ga0496104_0506395 Ga0496104_0506395_18_764 248
13 3300037466 Ga0395898_0006871 Ga0395898_0006871_6539_7324 249
14 3300031456 Ga0307513_10127317 Ga0307513_101273173 250
15 iso_pu_bacteria 2526164512 2526212494 250
16 3300005937 Ga0081455_10064427 Ga0081455_100644273 251
17 3300009036 Ga0105244_10060113 Ga0105244_100601133 251
18 3300009148 Ga0105243_10440596 Ga0105243_104405962 251
19 3300025904 Ga0207647_10058799 Ga0207647_100587993 251
20 3300027312 Ga0209371_1031927 Ga0209371_10319271 251
21 3300030522 Ga0307512_10089886 Ga0307512_100898863 251
22 3300031344 Ga0265316_10215402 Ga0265316_102154022 251
23 3300031456 Ga0307513_10089204 Ga0307513_100892043 251
24 3300033179 Ga0307507_10116125 Ga0307507_101161251 251
25 3300041512 Ga0451853_3631845 Ga0451853_3631845_136_990 251
26 3300045051 Ga0451576_0410136 Ga0451576_0410136_275_1051 251
27 3300046462 Ga0495651_0104758 Ga0495651_0104758_52_915 251
28 3300046517 Ga0495630_0308399 Ga0495630_0308399_29_811 251
29 3300049571 Ga0501034_0242285 Ga0501034_0242285_400_1203 251
30 3300049582 Ga0501048_0229173 Ga0501048_0229173_337_1140 251
31 3300049823 Ga0501044_0036758 Ga0501044_0036758_4083_4886 251
32 iso_pu_bacteria 2582581314 2585318742 251
33 iso_pu_bacteria 2643221587 2643948272 251
34 iso_pu_bacteria 2946072368 2946075768 251
35 iso_pu_bacteria 8008574985 8008578986 251
36 3300027312 Ga0209371_1008204 Ga0209371_10082043 252
37 3300028666 Ga0265336_10000081 Ga0265336_1000008167 252
38 3300029957 Ga0265324_10000018 Ga0265324_10000018104 252
39 3300030500 Ga0268256_1007886 Ga0268256_10078863 252
40 3300031241 Ga0265325_10000035 Ga0265325_1000003555 252
41 3300031711 Ga0265314_10062888 Ga0265314_100628882 252
42 3300044658 Ga0466972_0125213 Ga0466972_0125213_303_1073 252
43 3300044684 Ga0466966_0120541 Ga0466966_0120541_137_907 252
44 3300044765 Ga0466970_0076695 Ga0466970_0076695_146_916 252
45 3300045836 Ga0466958_0382900 Ga0466958_0382900_16_786 252
46 3300061719 Ga0466962_0030813 Ga0466962_0030813_169_939 252
47 iso_pu_bacteria 8039098773 8039098896 252
48 3300005536 Ga0070697_100024026 Ga0070697_1000240265 253
49 3300005547 Ga0070693_100151673 Ga0070693_1001516732 253
50 3300005616 Ga0068852_100965400 Ga0068852_1009654001 253
51 3300006051 Ga0075364_10000711 Ga0075364_100007112 253
52 3300006051 Ga0075364_10049175 Ga0075364_100491752 253
53 3300006871 Ga0075434_100000011 Ga0075434_10000001193 253
54 3300009036 Ga0105244_10129989 Ga0105244_101299892 253
55 3300025292 Ga0209676_1005425 Ga0209676_10054257 253
56 3300025298 Ga0209050_1005921 Ga0209050_10059213 253
57 3300025303 Ga0209051_1013918 Ga0209051_10139182 253
58 3300027312 Ga0209371_1022800 Ga0209371_10228002 253
59 3300028653 Ga0265323_10010026 Ga0265323_100100262 253
60 3300030500 Ga0268256_1025792 Ga0268256_10257922 253
61 3300031507 Ga0307509_10000145 Ga0307509_1000014587 253
62 3300031733 Ga0316577_10017492 Ga0316577_100174924 253
63 3300031911 Ga0307412_10000162 Ga0307412_1000016237 253
64 3300044712 Ga0453684_0205460 Ga0453684_0205460_403_1185 253
65 3300048904 Ga0496101_0212832 Ga0496101_0212832_615_1403 253
66 3300048909 Ga0496106_0072766 Ga0496106_0072766_1245_2024 253
67 3300048917 Ga0496114_0082100 Ga0496114_0082100_880_1659 253
68 3300048919 Ga0496116_0018432 Ga0496116_0018432_1413_2279 253
69 3300048920 Ga0496117_0020736 Ga0496117_0020736_4401_5189 253
70 3300048920 Ga0496117_0025151 Ga0496117_0025151_2405_3271 253
71 3300048921 Ga0496118_0012713 Ga0496118_0012713_5301_6089 253
72 3300048921 Ga0496118_0085970 Ga0496118_0085970_667_1533 253
73 3300048922 Ga0496119_0005298 Ga0496119_0005298_10944_11732 253
74 3300048923 Ga0496120_0046389 Ga0496120_0046389_1068_1934 253
75 3300048924 Ga0496121_0000195 Ga0496121_0000195_101655_102443 253
76 3300048925 Ga0496122_0001745 Ga0496122_0001745_12396_13184 253
77 3300048925 Ga0496122_0025818 Ga0496122_0025818_3243_4031 253
78 3300048926 Ga0496123_0001434 Ga0496123_0001434_20385_21173 253
79 3300048926 Ga0496123_0032104 Ga0496123_0032104_1141_1929 253
80 3300048927 Ga0496124_0024545 Ga0496124_0024545_860_1726 253
81 3300048928 Ga0496125_0000364 Ga0496125_0000364_21082_21948 253
82 3300048928 Ga0496125_0073621 Ga0496125_0073621_914_1702 253
83 3300048929 Ga0496126_0100632 Ga0496126_0100632_850_1716 253
84 3300048929 Ga0496126_0174005 Ga0496126_0174005_175_963 253
85 3300049568 Ga0501031_0067158 Ga0501031_0067158_1533_2306 253
86 3300049574 Ga0501038_0076710 Ga0501038_0076710_1242_2015 253
87 3300049574 Ga0501038_0289871 Ga0501038_0289871_34_813 253
88 3300049649 Ga0501198_000003 Ga0501198_000003_97852_98613 253
89 3300049662 Ga0501222_000001 Ga0501222_000001_292559_293320 253
90 3300050491 nmdc:mga00v17_844_c1 nmdc:mga00v17_844_c1_7322_8110 253
91 iso_pu_bacteria 2599185292 2599904261 253
92 iso_pu_bacteria 2643221569 2643859410 253
93 iso_pu_bacteria 2643221594 2643979683 253
94 iso_pu_bacteria 2643221621 2644123171 253
95 iso_pu_bacteria 2808606395 2809033588 253
96 iso_pu_bacteria 2857537821 2857537929 253
97 iso_pu_bacteria 2858950400 2858954324 253
98 iso_pu_bacteria 2941479691 2941484154 253
99 iso_pu_bacteria 2643221544 2643744403 256
100 iso_pu_bacteria 2643221585 2643934398 256
101 iso_pu_bacteria 2643221639 2644219384 256
102 iso_pu_bacteria 2643221646 2644255821 256
103 iso_pu_bacteria 2643221656 2644315885 256
104 iso_pu_bacteria 2738541337 2739054279 256
105 iso_pu_bacteria 2939631187 2939636306 256
106 3300003791 Ga0055530_10039349 Ga0055530_100393491 257
107 3300003794 Ga0055531_10000022 Ga0055531_10000022137 257
108 3300005295 Ga0065707_10002290 Ga0065707_100022906 257
109 3300005328 Ga0070676_10044611 Ga0070676_100446113 257
110 3300005331 Ga0070670_100048842 Ga0070670_1000488424 257
111 3300005334 Ga0068869_100178887 Ga0068869_1001788872 257
112 3300005338 Ga0068868_100204747 Ga0068868_1002047472 257
113 3300005355 Ga0070671_100011504 Ga0070671_1000115045 257
114 3300005364 Ga0070673_100012678 Ga0070673_1000126785 257
115 3300005459 Ga0068867_100025658 Ga0068867_1000256585 257
116 3300005543 Ga0070672_100073297 Ga0070672_1000732973 257
117 3300005616 Ga0068852_100212119 Ga0068852_1002121192 257
118 3300005843 Ga0068860_100190847 Ga0068860_1001908472 257
119 3300006195 Ga0075366_10062084 Ga0075366_100620842 257
120 3300006353 Ga0075370_10002458 Ga0075370_100024582 257
121 3300006881 Ga0068865_100029907 Ga0068865_1000299073 257
122 3300009098 Ga0105245_10098804 Ga0105245_100988041 257
123 3300011119 Ga0105246_10140792 Ga0105246_101407922 257
124 3300012502 Ga0157347_1002983 Ga0157347_10029831 257
125 3300013308 Ga0157375_10061686 Ga0157375_100616865 257
126 3300021361 Ga0213872_10002028 Ga0213872_100020288 257
127 3300025298 Ga0209050_1005661 Ga0209050_10056613 257
128 3300025304 Ga0209257_1000061 Ga0209257_1000061350 257
129 3300025304 Ga0209257_1008788 Ga0209257_10087885 257
130 3300025925 Ga0207650_10100122 Ga0207650_101001222 257
131 3300025927 Ga0207687_10178141 Ga0207687_101781413 257
132 3300025931 Ga0207644_10090212 Ga0207644_100902122 257
133 3300025940 Ga0207691_10038444 Ga0207691_100384443 257
134 3300025942 Ga0207689_10182107 Ga0207689_101821072 257
135 3300025960 Ga0207651_10031453 Ga0207651_100314533 257
136 3300026089 Ga0207648_10006795 Ga0207648_100067956 257
137 3300026116 Ga0207674_10014262 Ga0207674_100142625 257
138 3300028381 Ga0268264_10107618 Ga0268264_101076182 257
139 3300028794 Ga0307515_10064558 Ga0307515_100645584 257
140 3300031239 Ga0265328_10018889 Ga0265328_100188893 257
141 3300031251 Ga0265327_10000147 Ga0265327_10000147112 257
142 3300031344 Ga0265316_10002522 Ga0265316_1000252212 257
143 3300031548 Ga0307408_100000006 Ga0307408_100000006104 257
144 3300031649 Ga0307514_10000595 Ga0307514_1000059529 257
145 3300032004 Ga0307414_10010953 Ga0307414_100109532 257
146 3300032005 Ga0307411_10003380 Ga0307411_100033806 257
147 3300037418 Ga0395900_0000147 Ga0395900_0000147_85143_85928 257
148 3300037466 Ga0395898_0000747 Ga0395898_0000747_12713_13498 257
149 3300037471 Ga0395905_0000713 Ga0395905_0000713_30492_31274 257
150 3300037471 Ga0395905_0002445 Ga0395905_0002445_14444_15229 257
151 3300039447 Ga0436361_0802941 Ga0436361_0802941_27406_28188 257
152 3300041512 Ga0451853_1286128 Ga0451853_1286128_228_1019 257
153 3300042000 Ga0439437_005987 Ga0439437_005987_66_860 257
154 3300042120 Ga0450917_000549 Ga0450917_000549_704_1498 257
155 3300042126 Ga0450888_000246 Ga0450888_000246_2571_3365 257
156 3300042127 Ga0450890_001317 Ga0450890_001317_2504_3298 257
157 3300042138 Ga0450903_009357 Ga0450903_009357_727_1521 257
158 3300042139 Ga0450904_002869 Ga0450904_002869_998_1792 257
159 3300042144 Ga0450889_001756 Ga0450889_001756_680_1474 257
160 3300042532 Ga0450893_0012131 Ga0450893_0012131_166_960 257
161 3300044656 Ga0466969_0000009 Ga0466969_0000009_114509_115297 257
162 3300044656 Ga0466969_0171266 Ga0466969_0171266_12_800 257
163 3300044658 Ga0466972_0001989 Ga0466972_0001989_7997_8782 257
164 3300044683 Ga0466965_0032033 Ga0466965_0032033_1054_1839 257
165 3300044683 Ga0466965_0039477 Ga0466965_0039477_934_1719 257
166 3300044684 Ga0466966_0009962 Ga0466966_0009962_2870_3658 257
167 3300044684 Ga0466966_0045959 Ga0466966_0045959_353_1141 257
168 3300044694 Ga0466963_0084674 Ga0466963_0084674_212_1000 257
169 3300044706 Ga0466964_0005250 Ga0466964_0005250_3105_3893 257
170 3300044712 Ga0453684_0324210 Ga0453684_0324210_583_1389 257
171 3300044719 Ga0466971_0007614 Ga0466971_0007614_1736_2524 257
172 3300044901 Ga0466960_0020308 Ga0466960_0020308_1843_2628 257
173 3300045049 Ga0466959_0000590 Ga0466959_0000590_51_839 257
174 3300045049 Ga0466959_0143578 Ga0466959_0143578_505_1293 257
175 3300045051 Ga0451576_0043488 Ga0451576_0043488_2575_3378 257
176 3300045051 Ga0451576_0100423 Ga0451576_0100423_1569_2360 257
177 3300045976 Ga0466967_0038451 Ga0466967_0038451_667_1455 257
178 3300048912 Ga0496109_0044317 Ga0496109_0044317_2772_3599 257
179 3300048913 Ga0496110_0186342 Ga0496110_0186342_104_931 257
180 3300048927 Ga0496124_0000273 Ga0496124_0000273_30720_31508 257
181 3300048928 Ga0496125_0015987 Ga0496125_0015987_5827_6615 257
182 3300049520 Ga0501297_001489 Ga0501297_001489_1312_2106 257
183 3300049650 Ga0501199_000857 Ga0501199_000857_1364_2158 257
184 3300049652 Ga0501202_016762 Ga0501202_016762_51_845 257
185 3300049658 Ga0501211_002140 Ga0501211_002140_611_1405 257
186 3300049662 Ga0501222_006509 Ga0501222_006509_628_1422 257
187 3300049663 Ga0501223_012055 Ga0501223_012055_747_1541 257
188 3300049668 Ga0501233_000345 Ga0501233_000345_3696_4490 257
189 3300049669 Ga0501235_007267 Ga0501235_007267_772_1566 257
190 3300049683 Ga0501253_001277 Ga0501253_001277_968_1762 257
191 3300049686 Ga0501257_013452 Ga0501257_013452_884_1678 257
192 3300049687 Ga0501258_000107 Ga0501258_000107_2926_3720 257
193 3300049757 Ga0501232_000149 Ga0501232_000149_2691_3485 257
194 3300049764 Ga0501267_000803 Ga0501267_000803_1057_1851 257
195 3300049766 Ga0501269_003509 Ga0501269_003509_349_1143 257
196 3300050496 nmdc:mga07m45_314223_c1 nmdc:mga07m45_314223_c1_34_825 257
197 3300039447 Ga0436361_0522086 Ga0436361_0522086_256_1038 260
198 3300046684 Ga0495669_0005248 Ga0495669_0005248_79_867 262
199 3300046694 Ga0495649_0000276 Ga0495649_0000276_20029_20817 262
200 3300046794 Ga0495589_0001955 Ga0495589_0001955_3841_4629 262
201 3300053080 Ga0500635_0000312 Ga0500635_0000312_6008_6796 262
202 3300053136 Ga0500559_0071712 Ga0500559_0071712_447_1235 262
203 3300002705 JGI25156J39149_1000118 JGI25156J39149_100011811 264
204 3300002738 JGI25154J39366_1002573 JGI25154J39366_10025734 264
205 3300002741 JGI25157J39369_1000278 JGI25157J39369_100027814 264
206 3300002772 JGI25164J39214_1003809 JGI25164J39214_10038092 264
207 3300003316 rootH1_10007734 rootH1_100077342 264
208 3300003320 rootH2_10002613 rootH2_100026132 264
209 3300003756 Ga0055533_1000048 Ga0055533_100004863 264
210 3300003756 Ga0055533_1000068 Ga0055533_100006820 264
211 3300003759 Ga0055525_1001273 Ga0055525_10012735 264
212 3300003761 Ga0055535_1000306 Ga0055535_100030614 264
213 3300003763 Ga0055529_1000291 Ga0055529_10002914 264
214 3300005329 Ga0070683_100141879 Ga0070683_1001418791 264
215 3300005330 Ga0070690_100012689 Ga0070690_1000126897 264
216 3300005344 Ga0070661_100230093 Ga0070661_1002300932 264
217 3300005356 Ga0070674_100252787 Ga0070674_1002527872 264
218 3300005364 Ga0070673_100019279 Ga0070673_1000192795 264
219 3300005535 Ga0070684_100032022 Ga0070684_1000320225 264
220 3300005563 Ga0068855_100461765 Ga0068855_1004617652 264
221 3300005578 Ga0068854_100267748 Ga0068854_1002677482 264
222 3300005614 Ga0068856_100001787 Ga0068856_1000017873 264
223 3300005719 Ga0068861_100034413 Ga0068861_1000344135 264
224 3300006353 Ga0075370_10011382 Ga0075370_100113824 264
225 3300009176 Ga0105242_10042687 Ga0105242_100426873 264
226 3300009545 Ga0105237_10221909 Ga0105237_102219092 264
227 3300009551 Ga0105238_10098802 Ga0105238_100988022 264
228 3300010375 Ga0105239_10369990 Ga0105239_103699902 264
229 3300011119 Ga0105246_10066580 Ga0105246_100665802 264
230 3300013105 Ga0157369_10089139 Ga0157369_100891392 264
231 3300013105 Ga0157369_10301520 Ga0157369_103015202 264
232 3300025226 Ga0209674_100024 Ga0209674_100024359 264
233 3300025230 Ga0209563_100101 Ga0209563_10010121 264
234 3300025231 Ga0207427_101602 Ga0207427_1016025 264
235 3300025242 Ga0209258_100180 Ga0209258_10018080 264
236 3300025242 Ga0209258_100719 Ga0209258_10071910 264
237 3300025246 Ga0209646_1000012 Ga0209646_1000012148 264
238 3300025250 Ga0209026_1000004 Ga0209026_1000004469 264
239 3300025253 Ga0209677_100091 Ga0209677_10009191 264
240 3300025256 Ga0209759_1000003 Ga0209759_1000003256 264
241 3300025256 Ga0209759_1000067 Ga0209759_1000067159 264
242 3300025256 Ga0209759_1002004 Ga0209759_100200410 264
243 3300025256 Ga0209759_1002222 Ga0209759_10022226 264
244 3300025272 Ga0209455_1000144 Ga0209455_100014480 264
245 3300025911 Ga0207654_10121168 Ga0207654_101211682 264
246 3300025913 Ga0207695_10014938 Ga0207695_100149388 264
247 3300025914 Ga0207671_10039624 Ga0207671_100396243 264
248 3300025919 Ga0207657_10037174 Ga0207657_100371742 264
249 3300025920 Ga0207649_10205761 Ga0207649_102057612 264
250 3300025924 Ga0207694_10018427 Ga0207694_100184274 264
251 3300025934 Ga0207686_10138754 Ga0207686_101387542 264
252 3300025940 Ga0207691_10256523 Ga0207691_102565232 264
253 3300025942 Ga0207689_10029951 Ga0207689_100299513 264
254 3300025944 Ga0207661_10334921 Ga0207661_103349212 264
255 3300025949 Ga0207667_10004177 Ga0207667_1000417710 264
256 3300025949 Ga0207667_10407108 Ga0207667_104071082 264
257 3300025960 Ga0207651_10000865 Ga0207651_100008659 264
258 3300026078 Ga0207702_10000441 Ga0207702_100004415 264
259 3300026121 Ga0207683_10296131 Ga0207683_102961311 264
260 3300028666 Ga0265336_10000030 Ga0265336_10000030123 264
261 3300029957 Ga0265324_10000522 Ga0265324_1000052223 264
262 3300031730 Ga0307516_10000243 Ga0307516_1000024326 264
263 3300035691 Ga0373931_0006262 Ga0373931_0006262_3217_4014 264
264 3300037466 Ga0395898_0002803 Ga0395898_0002803_17550_18344 264
265 3300038443 Ga0395901_0059075 Ga0395901_0059075_646_1440 264
266 3300039447 Ga0436361_1066747 Ga0436361_1066747_1720_2529 264
267 3300044694 Ga0466963_0115444 Ga0466963_0115444_267_1076 264
268 3300046454 Ga0495592_0235275 Ga0495592_0235275_391_1200 264
269 3300046471 Ga0495650_0009460 Ga0495650_0009460_3022_3816 264
270 3300046475 Ga0495639_0008218 Ga0495639_0008218_1980_2789 264
271 3300046492 Ga0495585_0064170 Ga0495585_0064170_169_966 264
272 3300046492 Ga0495585_0108234 Ga0495585_0108234_162_971 264
273 3300046506 Ga0495583_0000022 Ga0495583_0000022_262272_263066 264
274 3300046507 Ga0495606_0004058 Ga0495606_0004058_10214_11008 264
275 3300046660 Ga0495625_0010539 Ga0495625_0010539_2445_3239 264
276 3300047472 Ga0495686_0019391 Ga0495686_0019391_1853_2674 264
277 3300050493 nmdc:mga0k408_60420_c1 nmdc:mga0k408_60420_c1_180_998 264
278 3300053177 Ga0500636_0011853 Ga0500636_0011853_221_1030 264
279 3300055283 Ga0500661_010936 Ga0500661_010936_747_1556 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03372

Exo_endo_phos

Endonuclease/Exonuclease/phosphatase family

43

289

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b5m-assembly2.cif.gz_B neisseria ap endonuclease bound to the substrate with a cytosine orphan base 0.9781 2 261
4b5h-assembly1.cif.gz_A substate bound inactive mutant of neisseria ap endonuclease in presence of metal ions 0.978 3 261
3w2y-assembly2.cif.gz_D crystal structure of dna uridine endonuclease mth212 mutant w205s 0.9618 2 261
3g4t-assembly1.cif.gz_A mth0212 (wt) in complex with a 7bp dsdna 0.9598 2 261
8igi-assembly2.cif.gz_B crystal structure of hp1526 (xtha)- a base excision dna repair protein in helicobacter pylori 0.9591 2 260
ID Description Score Start End Superfamily
4b5gC00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9751 2 264 3.60.10.10
3g3cB00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9592 2 261 3.60.10.10
4b5gC00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9492 2 264 3.60.10.10
5cfeA00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9483 2 261 3.60.10.10
4qh9A00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.9463 2 258 3.60.10.10
ID Description Score Start End GO Terms
AF-A0A7C7WWY8-F1-model_v4 Exodeoxyribonuclease III 0.9922 148 234 GO:0003906
GO:0006284
GO:0008081
GO:0008311
GO:0046872
AF-A0A2M8BM52-F1-model_v4 Exodeoxyribonuclease III 0.9896 2 98 GO:0006281
GO:0008311
AF-A0A0S8AA80-F1-model_v4 Endonuclease/exonuclease/phosphatase domain-containing protein 0.9882 151 261 GO:0003906
GO:0006284
GO:0008081
GO:0008311
GO:0046872
AF-A0A378Z4L5-F1-model_v4 deleted 0.9842 2 264
AF-F3LPB9-F1-model_v4 deleted 0.9836 31 264

Feature Viewer

pLDDT pTM Quality
94.59 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map