F383145
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 279 | 225 | 271 | 185 |
Family's Representative Sequence
| Representative Sequence | 3300031456|Ga0307513_10360298|Ga0307513_103602982 |
| Length | 199 |
| Sequence | MLMRRLEFAALAAITLLCVTSAKAQGPYGIGRVATPAEIAGWNIDVGGDGSNLPSGIGSVSHGSEVFGQQCAACHGAKGEGGIGDRLVGGQGTLGTSKPVRTVGSYWPYAPTLFDYIRRAMPQNAPQSLGNDDVYAVSAYILSLNGLLPADATLDAKALTKIKMPNRNMFVGDPRPDVKNPECMTGCQGNNTNSGISKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 3 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 4 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 5 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 6 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 44 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 47 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 48 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 49 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 50 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 67 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 68 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 102 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 103 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 104 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 105 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 106 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 107 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 108 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 109 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 110 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 111 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 112 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 114 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 115 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 116 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 117 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 118 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 119 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 120 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 121 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 122 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 123 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 124 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 125 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 126 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 127 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 128 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 129 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 130 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 131 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 132 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 133 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 134 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 135 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 136 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 137 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 138 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 139 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 140 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 141 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 187 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 188 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 189 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 190 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 193 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 194 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 195 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 196 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 197 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 198 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 199 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 200 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 201 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 204 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 205 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 210 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 211 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 212 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 213 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 214 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 215 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 216 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 217 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 218 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 219 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 220 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 221 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 222 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 223 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 224 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 225 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.13 |
| Metatranscriptomes | 0 |
| Isolates | 2.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.17 |
| Nodule | 1.08 |
| Rhizoplane | 6.45 |
| Rhizosphere | 77.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10000396 | 3300003659 | Bacteria | 6017 |
| 2 | JGI25404J52841_10002951 | 3300003659 | Bacteria | 3301 |
| 3 | JGI25404J52841_10005232 | 3300003659 | Bacteria | 2677 |
| 4 | JGI25404J52841_10015718 | 3300003659 | Bacteria | 1642 |
| 5 | Ga0070658_10134236 | 3300005327 | Bacteria | 2064 |
| 6 | Ga0070683_100022259 | 3300005329 | Bacteria | 5662 |
| 7 | Ga0068869_100000485 | 3300005334 | Bacteria | 22024 |
| 8 | Ga0070680_100002115 | 3300005336 | Bacteria | 14670 |
| 9 | Ga0068868_100202137 | 3300005338 | Bacteria | 1657 |
| 10 | Ga0070661_100604711 | 3300005344 | Bacteria | 887 |
| 11 | Ga0070668_100075107 | 3300005347 | Bacteria | 2638 |
| 12 | Ga0070669_100120415 | 3300005353 | Bacteria | 2001 |
| 13 | Ga0070659_100172584 | 3300005366 | Bacteria | 1772 |
| 14 | Ga0070667_100014512 | 3300005367 | Bacteria | 6510 |
| 15 | Ga0070709_10018039 | 3300005434 | Bacteria | 4056 |
| 16 | Ga0070709_10671707 | 3300005434 | Bacteria | 804 |
| 17 | Ga0070714_100383101 | 3300005435 | Bacteria | 1326 |
| 18 | Ga0070713_100003174 | 3300005436 | Bacteria | 10821 |
| 19 | Ga0070711_100156197 | 3300005439 | Bacteria | 1725 |
| 20 | Ga0070694_100175337 | 3300005444 | Bacteria | 1582 |
| 21 | Ga0070708_100088909 | 3300005445 | Bacteria | 2810 |
| 22 | Ga0070708_100874644 | 3300005445 | Bacteria | 844 |
| 23 | Ga0070662_100007714 | 3300005457 | Bacteria | 6984 |
| 24 | Ga0070707_101022458 | 3300005468 | Bacteria | 792 |
| 25 | Ga0070698_100041564 | 3300005471 | Bacteria | 4719 |
| 26 | Ga0070698_100242379 | 3300005471 | Bacteria | 1736 |
| 27 | Ga0070699_100182294 | 3300005518 | Bacteria | 1864 |
| 28 | Ga0070679_100304033 | 3300005530 | Bacteria | 1545 |
| 29 | Ga0070684_100002850 | 3300005535 | Bacteria | 12851 |
| 30 | Ga0070684_100009194 | 3300005535 | Bacteria | 7774 |
| 31 | Ga0070697_100079382 | 3300005536 | Bacteria | 2702 |
| 32 | Ga0070697_100514937 | 3300005536 | Bacteria | 1047 |
| 33 | Ga0070697_100635291 | 3300005536 | Bacteria | 940 |
| 34 | Ga0068853_100001194 | 3300005539 | Bacteria | 18523 |
| 35 | Ga0068853_100085687 | 3300005539 | Bacteria | 2762 |
| 36 | Ga0070695_100519946 | 3300005545 | Bacteria | 923 |
| 37 | Ga0070696_100085736 | 3300005546 | Bacteria | 2236 |
| 38 | Ga0068855_100055468 | 3300005563 | Bacteria | 4654 |
| 39 | Ga0068855_100337007 | 3300005563 | Bacteria | 1664 |
| 40 | Ga0068857_100052556 | 3300005577 | Bacteria | 3615 |
| 41 | Ga0068852_100088751 | 3300005616 | Bacteria | 2762 |
| 42 | Ga0068866_10247029 | 3300005718 | Bacteria | 1090 |
| 43 | Ga0068861_100082894 | 3300005719 | Bacteria | 2514 |
| 44 | Ga0068851_10000516 | 3300005834 | Bacteria | 16919 |
| 45 | Ga0068858_100096837 | 3300005842 | Bacteria | 2750 |
| 46 | Ga0068860_100001705 | 3300005843 | Bacteria | 23470 |
| 47 | Ga0068860_100069796 | 3300005843 | Bacteria | 3340 |
| 48 | Ga0068862_100114630 | 3300005844 | Bacteria | 2369 |
| 49 | Ga0081540_1000976 | 3300005983 | Bacteria | 25808 |
| 50 | Ga0081540_1001709 | 3300005983 | Bacteria | 18581 |
| 51 | Ga0081540_1002909 | 3300005983 | Bacteria | 13805 |
| 52 | Ga0081540_1003388 | 3300005983 | Bacteria | 12637 |
| 53 | Ga0081540_1019795 | 3300005983 | Bacteria | 4075 |
| 54 | Ga0070717_10066530 | 3300006028 | Bacteria | 2997 |
| 55 | Ga0070717_10230357 | 3300006028 | Bacteria | 1631 |
| 56 | Ga0070712_100027070 | 3300006175 | Bacteria | 3825 |
| 57 | Ga0075366_10118740 | 3300006195 | Bacteria | 1593 |
| 58 | Ga0075433_10718306 | 3300006852 | Bacteria | 875 |
| 59 | Ga0099794_10076391 | 3300007265 | Bacteria | 1646 |
| 60 | Ga0099794_10081418 | 3300007265 | Bacteria | 1597 |
| 61 | Ga0099794_10144604 | 3300007265 | Bacteria | 1205 |
| 62 | Ga0099795_10025782 | 3300007788 | Bacteria | 1975 |
| 63 | Ga0099795_10045556 | 3300007788 | Bacteria | 1577 |
| 64 | Ga0105250_10009427 | 3300009092 | Bacteria | 4111 |
| 65 | Ga0105250_10189843 | 3300009092 | Unclassified | 864 |
| 66 | Ga0105240_10004989 | 3300009093 | Bacteria | 19936 |
| 67 | Ga0105240_10997177 | 3300009093 | Bacteria | 896 |
| 68 | Ga0114129_10885604 | 3300009147 | Bacteria | 1132 |
| 69 | Ga0105243_10029550 | 3300009148 | Bacteria | 4215 |
| 70 | Ga0105237_10004248 | 3300009545 | Bacteria | 16672 |
| 71 | Ga0105237_10874927 | 3300009545 | Bacteria | 905 |
| 72 | Ga0105238_10005783 | 3300009551 | Bacteria | 12239 |
| 73 | Ga0105249_10024773 | 3300009553 | Bacteria | 5395 |
| 74 | Ga0099796_10031950 | 3300010159 | Bacteria | 1721 |
| 75 | Ga0099796_10035727 | 3300010159 | Bacteria | 1650 |
| 76 | Ga0099796_10082954 | 3300010159 | Bacteria | 1178 |
| 77 | Ga0099796_10271507 | 3300010159 | Bacteria | 710 |
| 78 | Ga0105239_10004627 | 3300010375 | Bacteria | 16355 |
| 79 | Ga0105239_10027657 | 3300010375 | Bacteria | 6239 |
| 80 | Ga0157370_10090102 | 3300013104 | Bacteria | 2880 |
| 81 | Ga0157369_10003609 | 3300013105 | Bacteria | 18390 |
| 82 | Ga0157369_10185274 | 3300013105 | Bacteria | 2189 |
| 83 | Ga0163162_10356306 | 3300013306 | Bacteria | 1596 |
| 84 | Ga0157372_10410616 | 3300013307 | Bacteria | 1578 |
| 85 | Ga0163163_10030350 | 3300014325 | Bacteria | 5208 |
| 86 | Ga0157380_10182466 | 3300014326 | Bacteria | 1845 |
| 87 | Ga0163161_10600088 | 3300017792 | Bacteria | 908 |
| 88 | Ga0213872_10047793 | 3300021361 | Bacteria | 1945 |
| 89 | Ga0213875_10084633 | 3300021388 | Bacteria | 1479 |
| 90 | Ga0207656_10001070 | 3300025321 | Bacteria | 8955 |
| 91 | Ga0207642_10119974 | 3300025899 | Bacteria | 1355 |
| 92 | Ga0207699_10165613 | 3300025906 | Bacteria | 1475 |
| 93 | Ga0207699_10302965 | 3300025906 | Bacteria | 1116 |
| 94 | Ga0207705_10058486 | 3300025909 | Bacteria | 2781 |
| 95 | Ga0207684_10721400 | 3300025910 | Bacteria | 846 |
| 96 | Ga0207707_10002412 | 3300025912 | Bacteria | 16809 |
| 97 | Ga0207695_10179999 | 3300025913 | Bacteria | 2035 |
| 98 | Ga0207671_10056465 | 3300025914 | Bacteria | 2909 |
| 99 | Ga0207693_10021537 | 3300025915 | Bacteria | 5121 |
| 100 | Ga0207693_10061811 | 3300025915 | Bacteria | 2934 |
| 101 | Ga0207660_10001368 | 3300025917 | Bacteria | 16343 |
| 102 | Ga0207649_10106145 | 3300025920 | Bacteria | 1868 |
| 103 | Ga0207652_10019423 | 3300025921 | Bacteria | 5589 |
| 104 | Ga0207652_10235343 | 3300025921 | Bacteria | 1651 |
| 105 | Ga0207681_10018603 | 3300025923 | Bacteria | 4379 |
| 106 | Ga0207694_10017191 | 3300025924 | Bacteria | 5465 |
| 107 | Ga0207650_10962521 | 3300025925 | Bacteria | 726 |
| 108 | Ga0207700_10004190 | 3300025928 | Bacteria | 8464 |
| 109 | Ga0207706_10011510 | 3300025933 | Bacteria | 8058 |
| 110 | Ga0207709_10043796 | 3300025935 | Bacteria | 2700 |
| 111 | Ga0207689_10000572 | 3300025942 | Bacteria | 35176 |
| 112 | Ga0207661_10000611 | 3300025944 | Bacteria | 22884 |
| 113 | Ga0207661_10017797 | 3300025944 | Bacteria | 5266 |
| 114 | Ga0207667_10044592 | 3300025949 | Bacteria | 4698 |
| 115 | Ga0207667_10714613 | 3300025949 | Bacteria | 1004 |
| 116 | Ga0207712_10011646 | 3300025961 | Bacteria | 5606 |
| 117 | Ga0207668_10001282 | 3300025972 | Bacteria | 14975 |
| 118 | Ga0207677_10085133 | 3300026023 | Bacteria | 2281 |
| 119 | Ga0207703_10331140 | 3300026035 | Bacteria | 1397 |
| 120 | Ga0207639_10003682 | 3300026041 | Bacteria | 10302 |
| 121 | Ga0207708_10156220 | 3300026075 | Bacteria | 1799 |
| 122 | Ga0207674_10018041 | 3300026116 | Bacteria | 7686 |
| 123 | Ga0207675_100008342 | 3300026118 | Bacteria | 9760 |
| 124 | Ga0207698_10057282 | 3300026142 | Bacteria | 3014 |
| 125 | Ga0209588_1099973 | 3300027671 | Bacteria | 934 |
| 126 | Ga0268265_10001129 | 3300028380 | Bacteria | 23587 |
| 127 | Ga0268264_10000020 | 3300028381 | Bacteria | 483593 |
| 128 | Ga0268264_10014546 | 3300028381 | Bacteria | 6465 |
| 129 | Ga0265334_10044862 | 3300028573 | Bacteria | 1714 |
| 130 | Ga0307517_10152224 | 3300028786 | Bacteria | 1583 |
| 131 | Ga0265330_10008602 | 3300031235 | Bacteria | 4904 |
| 132 | Ga0265330_10035500 | 3300031235 | Bacteria | 2224 |
| 133 | Ga0265332_10010183 | 3300031238 | Bacteria | 4185 |
| 134 | Ga0265325_10014082 | 3300031241 | Bacteria | 4532 |
| 135 | Ga0265340_10022224 | 3300031247 | Bacteria | 3244 |
| 136 | Ga0265339_10049920 | 3300031249 | Bacteria | 2289 |
| 137 | Ga0265316_10068584 | 3300031344 | Bacteria | 2739 |
| 138 | Ga0265316_10402158 | 3300031344 | Bacteria | 986 |
| 139 | Ga0307513_10120897 | 3300031456 | Bacteria | 2587 |
| 140 | Ga0307513_10360298 | 3300031456 | Bacteria | 1199 |
| 141 | Ga0307509_10337971 | 3300031507 | Bacteria | 1234 |
| 142 | Ga0265313_10040437 | 3300031595 | Bacteria | 2305 |
| 143 | Ga0265314_10003656 | 3300031711 | Bacteria | 14771 |
| 144 | Ga0265342_10006981 | 3300031712 | Bacteria | 8344 |
| 145 | Ga0316215_1003232 | 3300033544 | Bacteria | 1548 |
| 146 | Ga0373923_0006264 | 3300035111 | Bacteria | 4100 |
| 147 | Ga0373936_0084986 | 3300035113 | Bacteria | 1321 |
| 148 | Ga0373945_0171221 | 3300035116 | Bacteria | 890 |
| 149 | Ga0373953_0002376 | 3300035117 | Bacteria | 5682 |
| 150 | Ga0373954_0000361 | 3300035118 | Bacteria | 16793 |
| 151 | Ga0373956_0000661 | 3300035119 | Bacteria | 14184 |
| 152 | Ga0373957_0002092 | 3300035120 | Bacteria | 5601 |
| 153 | Ga0373955_0000251 | 3300035172 | Bacteria | 22333 |
| 154 | Ga0373927_0090626 | 3300035695 | Bacteria | 1986 |
| 155 | Ga0373927_0143644 | 3300035695 | Bacteria | 1562 |
| 156 | Ga0373927_0265863 | 3300035695 | Bacteria | 1128 |
| 157 | Ga0373933_0000886 | 3300035724 | Bacteria | 18310 |
| 158 | Ga0373947_0692296 | 3300035725 | Bacteria | 695 |
| 159 | Ga0373937_0012818 | 3300036401 | Bacteria | 7382 |
| 160 | Ga0395900_0500920 | 3300037418 | Bacteria | 1165 |
| 161 | Ga0395898_0041422 | 3300037466 | Bacteria | 4549 |
| 162 | Ga0436364_0530630 | 3300037853 | Bacteria | 1993 |
| 163 | Ga0436364_0873230 | 3300037853 | Bacteria | 2035 |
| 164 | Ga0436364_1430648 | 3300037853 | Bacteria | 950 |
| 165 | Ga0395901_1322116 | 3300038443 | Bacteria | 682 |
| 166 | Ga0436365_0547714 | 3300039437 | Unclassified | 600 |
| 167 | Ga0436360_0311118 | 3300039438 | Bacteria | 804 |
| 168 | Ga0436361_0142641 | 3300039447 | Bacteria | 2306 |
| 169 | Ga0451789_0436801 | 3300041443 | Bacteria | 815 |
| 170 | Ga0466969_0053388 | 3300044656 | Bacteria | 1983 |
| 171 | Ga0466966_0001605 | 3300044684 | Bacteria | 14549 |
| 172 | Ga0466966_0326030 | 3300044684 | Bacteria | 923 |
| 173 | Ga0466961_0000016 | 3300044693 | Bacteria | 111421 |
| 174 | Ga0466968_0125185 | 3300044735 | Bacteria | 1166 |
| 175 | Ga0466970_0279335 | 3300044765 | Bacteria | 939 |
| 176 | Ga0466959_0001842 | 3300045049 | Bacteria | 13313 |
| 177 | Ga0466959_0053980 | 3300045049 | Bacteria | 2937 |
| 178 | Ga0495592_0001115 | 3300046454 | Bacteria | 18689 |
| 179 | Ga0495629_0000356 | 3300046459 | Bacteria | 38962 |
| 180 | Ga0495638_0295176 | 3300046460 | Bacteria | 875 |
| 181 | Ga0495651_0013671 | 3300046462 | Bacteria | 6272 |
| 182 | Ga0495653_0001366 | 3300046463 | Bacteria | 18943 |
| 183 | Ga0495584_0039456 | 3300046491 | Bacteria | 2385 |
| 184 | Ga0495583_0242115 | 3300046506 | Bacteria | 725 |
| 185 | Ga0495608_0003215 | 3300046511 | Bacteria | 11698 |
| 186 | Ga0495618_0019725 | 3300046514 | Bacteria | 4149 |
| 187 | Ga0495628_0025587 | 3300046516 | Bacteria | 4821 |
| 188 | Ga0495631_0159053 | 3300046518 | Bacteria | 969 |
| 189 | Ga0495643_0116866 | 3300046522 | Bacteria | 1351 |
| 190 | Ga0495648_0000822 | 3300046524 | Bacteria | 32752 |
| 191 | Ga0495648_0258389 | 3300046524 | Bacteria | 837 |
| 192 | Ga0495663_0129939 | 3300046525 | Bacteria | 849 |
| 193 | Ga0495652_0004066 | 3300046529 | Bacteria | 14134 |
| 194 | Ga0495665_0090490 | 3300046531 | Bacteria | 1608 |
| 195 | Ga0495640_0002055 | 3300046533 | Bacteria | 16055 |
| 196 | Ga0495645_0041247 | 3300046543 | Bacteria | 3365 |
| 197 | Ga0495667_0019143 | 3300046559 | Bacteria | 4619 |
| 198 | Ga0495634_0018693 | 3300046642 | Bacteria | 4930 |
| 199 | Ga0495635_0002282 | 3300046663 | Bacteria | 13039 |
| 200 | Ga0495659_0026560 | 3300046664 | Bacteria | 1991 |
| 201 | Ga0495661_0209803 | 3300046665 | Bacteria | 1015 |
| 202 | Ga0495657_0007275 | 3300046675 | Bacteria | 8568 |
| 203 | Ga0495599_0001267 | 3300046678 | Bacteria | 14348 |
| 204 | Ga0495623_0007281 | 3300046679 | Bacteria | 7181 |
| 205 | Ga0495646_0001051 | 3300046680 | Bacteria | 15983 |
| 206 | Ga0495613_0032586 | 3300046689 | Bacteria | 3872 |
| 207 | Ga0495670_0177358 | 3300046691 | Bacteria | 1124 |
| 208 | Ga0495671_0109167 | 3300046692 | Bacteria | 1351 |
| 209 | Ga0495600_0001804 | 3300046809 | Bacteria | 11977 |
| 210 | Ga0495581_0028630 | 3300047315 | Bacteria | 3230 |
| 211 | Ga0495581_0370911 | 3300047315 | Bacteria | 835 |
| 212 | Ga0495604_0002555 | 3300047317 | Bacteria | 14548 |
| 213 | Ga0495674_0013119 | 3300047319 | Bacteria | 7793 |
| 214 | Ga0495680_0016083 | 3300047322 | Bacteria | 6432 |
| 215 | Ga0495675_0007607 | 3300047444 | Bacteria | 6681 |
| 216 | Ga0495677_0113503 | 3300047445 | Bacteria | 1031 |
| 217 | Ga0495685_025800 | 3300047447 | Bacteria | 2023 |
| 218 | Ga0495681_0156376 | 3300047470 | Bacteria | 953 |
| 219 | Ga0495684_0001827 | 3300047471 | Bacteria | 17110 |
| 220 | Ga0495593_0001339 | 3300047673 | Bacteria | 14402 |
| 221 | Ga0495602_0041771 | 3300048088 | Bacteria | 4185 |
| 222 | Ga0495602_0770594 | 3300048088 | Bacteria | 648 |
| 223 | Ga0495615_0038234 | 3300048090 | Bacteria | 1186 |
| 224 | Ga0496100_0064401 | 3300048903 | Bacteria | 2426 |
| 225 | Ga0496101_0610648 | 3300048904 | Bacteria | 862 |
| 226 | Ga0496102_0140305 | 3300048905 | Bacteria | 2266 |
| 227 | Ga0496102_0392309 | 3300048905 | Bacteria | 1306 |
| 228 | Ga0496104_0014904 | 3300048907 | Bacteria | 7028 |
| 229 | Ga0496105_0023356 | 3300048908 | Bacteria | 5013 |
| 230 | Ga0496106_0770962 | 3300048909 | Bacteria | 764 |
| 231 | Ga0496108_0004452 | 3300048911 | Bacteria | 11279 |
| 232 | Ga0496108_0637737 | 3300048911 | Bacteria | 927 |
| 233 | Ga0496109_0027022 | 3300048912 | Bacteria | 5120 |
| 234 | Ga0496110_0001209 | 3300048913 | Bacteria | 18367 |
| 235 | Ga0496111_0011097 | 3300048914 | Bacteria | 6063 |
| 236 | Ga0496112_0071075 | 3300048915 | Bacteria | 3439 |
| 237 | Ga0496113_0002811 | 3300048916 | Bacteria | 10241 |
| 238 | Ga0496114_0381133 | 3300048917 | Bacteria | 1248 |
| 239 | Ga0496115_0069314 | 3300048918 | Bacteria | 2856 |
| 240 | Ga0496115_0733725 | 3300048918 | Bacteria | 774 |
| 241 | Ga0496118_0366443 | 3300048921 | Bacteria | 762 |
| 242 | Ga0496121_0056481 | 3300048924 | Bacteria | 3261 |
| 243 | Ga0496121_0096407 | 3300048924 | Bacteria | 2295 |
| 244 | Ga0496121_0104404 | 3300048924 | Bacteria | 2178 |
| 245 | Ga0496126_0017849 | 3300048929 | Bacteria | 7060 |
| 246 | Ga0496126_0208937 | 3300048929 | Bacteria | 1644 |
| 247 | Ga0495682_0088539 | 3300049460 | Bacteria | 1112 |
| 248 | Ga0501047_0130511 | 3300049581 | Bacteria | 2393 |
| 249 | nmdc:mga03683_341463_c1 | 3300050489 | Bacteria | 707 |
| 250 | nmdc:mga0k408_53492_c1 | 3300050493 | Bacteria | 2340 |
| 251 | nmdc:mga0a205_666358_c1 | 3300050515 | Bacteria | 891 |
| 252 | Ga0495655_0033406 | 3300053083 | Bacteria | 1266 |
| 253 | Ga0495595_0000753 | 3300053084 | Bacteria | 12271 |
| 254 | Ga0495619_0001813 | 3300053085 | Bacteria | 14212 |
| 255 | Ga0500647_0009609 | 3300053091 | Bacteria | 4249 |
| 256 | Ga0500566_0000077 | 3300053094 | Bacteria | 48099 |
| 257 | Ga0500640_001409 | 3300053095 | Bacteria | 7269 |
| 258 | Ga0500572_000932 | 3300053111 | Bacteria | 8962 |
| 259 | Ga0500614_001050 | 3300053123 | Bacteria | 6876 |
| 260 | Ga0500658_0119671 | 3300053134 | Bacteria | 1166 |
| 261 | Ga0500559_0009135 | 3300053136 | Bacteria | 4306 |
| 262 | Ga0500559_0061012 | 3300053136 | Bacteria | 1681 |
| 263 | Ga0500590_083256 | 3300053148 | Bacteria | 1568 |
| 264 | Ga0500603_001163 | 3300053150 | Bacteria | 6130 |
| 265 | Ga0500630_000158 | 3300053159 | Bacteria | 24806 |
| 266 | Ga0500638_093864 | 3300053162 | Bacteria | 1409 |
| 267 | Ga0500639_000171 | 3300053163 | Bacteria | 31550 |
| 268 | Ga0500639_157457 | 3300053163 | Bacteria | 1038 |
| 269 | Ga0500637_0041461 | 3300053178 | Bacteria | 2602 |
| 270 | Ga0500596_000666 | 3300053735 | Bacteria | 6645 |
| 271 | Ga0500601_005449 | 3300053737 | Bacteria | 1393 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053737 | Ga0500601_005449 | Ga0500601_005449_413_961 | 165 |
| 2 | 3300053136 | Ga0500559_0061012 | Ga0500559_0061012_588_1151 | 169 |
| 3 | 3300053148 | Ga0500590_083256 | Ga0500590_083256_112_675 | 169 |
| 4 | 3300053163 | Ga0500639_157457 | Ga0500639_157457_95_658 | 169 |
| 5 | 3300053178 | Ga0500637_0041461 | Ga0500637_0041461_733_1296 | 169 |
| 6 | 3300035113 | Ga0373936_0084986 | Ga0373936_0084986_178_741 | 170 |
| 7 | 3300035725 | Ga0373947_0692296 | Ga0373947_0692296_14_526 | 170 |
| 8 | 3300048088 | Ga0495602_0770594 | Ga0495602_0770594_47_592 | 170 |
| 9 | 3300053091 | Ga0500647_0009609 | Ga0500647_0009609_3557_4120 | 170 |
| 10 | 3300053094 | Ga0500566_0000077 | Ga0500566_0000077_39705_40268 | 170 |
| 11 | 3300053095 | Ga0500640_001409 | Ga0500640_001409_3096_3659 | 170 |
| 12 | 3300053111 | Ga0500572_000932 | Ga0500572_000932_3213_3776 | 170 |
| 13 | 3300053123 | Ga0500614_001050 | Ga0500614_001050_5654_6217 | 170 |
| 14 | 3300053136 | Ga0500559_0009135 | Ga0500559_0009135_1005_1568 | 170 |
| 15 | 3300053150 | Ga0500603_001163 | Ga0500603_001163_4980_5543 | 170 |
| 16 | 3300053159 | Ga0500630_000158 | Ga0500630_000158_9519_10082 | 170 |
| 17 | 3300053162 | Ga0500638_093864 | Ga0500638_093864_555_1118 | 170 |
| 18 | 3300053163 | Ga0500639_000171 | Ga0500639_000171_23029_23592 | 170 |
| 19 | 3300053735 | Ga0500596_000666 | Ga0500596_000666_113_676 | 170 |
| 20 | iso_pu_bacteria | 2824704595 | 2824705610 | 171 |
| 21 | iso_pu_bacteria | 2824753945 | 2824756339 | 171 |
| 22 | iso_pu_bacteria | 2824763712 | 2824764023 | 171 |
| 23 | iso_pu_bacteria | 2904711408 | 2904720393 | 171 |
| 24 | 3300009092 | Ga0105250_10189843 | Ga0105250_101898432 | 172 |
| 25 | 3300048924 | Ga0496121_0096407 | Ga0496121_0096407_1501_2046 | 172 |
| 26 | 3300050493 | nmdc:mga0k408_53492_c1 | nmdc:mga0k408_53492_c1_1040_1561 | 173 |
| 27 | 3300010159 | Ga0099796_10082954 | Ga0099796_100829542 | 175 |
| 28 | 3300009148 | Ga0105243_10029550 | Ga0105243_100295502 | 177 |
| 29 | 3300009545 | Ga0105237_10874927 | Ga0105237_108749272 | 177 |
| 30 | 3300014326 | Ga0157380_10182466 | Ga0157380_101824662 | 177 |
| 31 | 3300021388 | Ga0213875_10084633 | Ga0213875_100846332 | 177 |
| 32 | 3300037853 | Ga0436364_0530630 | Ga0436364_0530630_762_1313 | 177 |
| 33 | 3300037853 | Ga0436364_0873230 | Ga0436364_0873230_51_590 | 177 |
| 34 | 3300046522 | Ga0495643_0116866 | Ga0495643_0116866_557_1090 | 177 |
| 35 | 3300046525 | Ga0495663_0129939 | Ga0495663_0129939_52_585 | 177 |
| 36 | 3300046691 | Ga0495670_0177358 | Ga0495670_0177358_364_897 | 177 |
| 37 | 3300047445 | Ga0495677_0113503 | Ga0495677_0113503_146_679 | 177 |
| 38 | 3300047470 | Ga0495681_0156376 | Ga0495681_0156376_213_746 | 177 |
| 39 | 3300048090 | Ga0495615_0038234 | Ga0495615_0038234_230_763 | 177 |
| 40 | 3300048905 | Ga0496102_0392309 | Ga0496102_0392309_282_815 | 177 |
| 41 | 3300048921 | Ga0496118_0366443 | Ga0496118_0366443_73_606 | 177 |
| 42 | 3300048924 | Ga0496121_0104404 | Ga0496121_0104404_1355_1888 | 177 |
| 43 | 3300050489 | nmdc:mga03683_341463_c1 | nmdc:mga03683_341463_c1_86_619 | 177 |
| 44 | 3300053083 | Ga0495655_0033406 | Ga0495655_0033406_243_776 | 177 |
| 45 | 3300005843 | Ga0068860_100001705 | Ga0068860_10000170520 | 178 |
| 46 | 3300010159 | Ga0099796_10271507 | Ga0099796_102715072 | 178 |
| 47 | 3300028381 | Ga0268264_10000020 | Ga0268264_10000020177 | 178 |
| 48 | 3300048929 | Ga0496126_0208937 | Ga0496126_0208937_120_656 | 178 |
| 49 | 3300006852 | Ga0075433_10718306 | Ga0075433_107183062 | 179 |
| 50 | 3300009147 | Ga0114129_10885604 | Ga0114129_108856041 | 179 |
| 51 | 3300037853 | Ga0436364_1430648 | Ga0436364_1430648_248_802 | 179 |
| 52 | 3300039437 | Ga0436365_0547714 | Ga0436365_0547714_24_566 | 179 |
| 53 | 3300044656 | Ga0466969_0053388 | Ga0466969_0053388_374_913 | 179 |
| 54 | 3300044684 | Ga0466966_0001605 | Ga0466966_0001605_9425_9964 | 179 |
| 55 | 3300044693 | Ga0466961_0000016 | Ga0466961_0000016_6283_6822 | 179 |
| 56 | 3300045049 | Ga0466959_0001842 | Ga0466959_0001842_6254_6793 | 179 |
| 57 | 3300048909 | Ga0496106_0770962 | Ga0496106_0770962_57_596 | 179 |
| 58 | 3300050515 | nmdc:mga0a205_666358_c1 | nmdc:mga0a205_666358_c1_281_820 | 179 |
| 59 | 3300039438 | Ga0436360_0311118 | Ga0436360_0311118_216_758 | 180 |
| 60 | 3300033544 | Ga0316215_1003232 | Ga0316215_10032322 | 181 |
| 61 | 3300031711 | Ga0265314_10003656 | Ga0265314_100036567 | 182 |
| 62 | iso_pu_bacteria | 8006984368 | 8006993978 | 183 |
| 63 | iso_pu_bacteria | 8056681323 | 8056683619 | 183 |
| 64 | 3300044684 | Ga0466966_0326030 | Ga0466966_0326030_12_566 | 184 |
| 65 | iso_pu_bacteria | 2508501128 | 2509152113 | 184 |
| 66 | iso_pu_bacteria | 2513237141 | 2513888295 | 184 |
| 67 | 3300005445 | Ga0070708_100874644 | Ga0070708_1008746442 | 185 |
| 68 | 3300005471 | Ga0070698_100242379 | Ga0070698_1002423792 | 185 |
| 69 | 3300005536 | Ga0070697_100514937 | Ga0070697_1005149372 | 185 |
| 70 | 3300007265 | Ga0099794_10144604 | Ga0099794_101446041 | 185 |
| 71 | 3300009093 | Ga0105240_10997177 | Ga0105240_109971772 | 185 |
| 72 | 3300013105 | Ga0157369_10185274 | Ga0157369_101852742 | 185 |
| 73 | 3300025910 | Ga0207684_10721400 | Ga0207684_107214001 | 185 |
| 74 | 3300035111 | Ga0373923_0006264 | Ga0373923_0006264_2538_3119 | 185 |
| 75 | 3300035117 | Ga0373953_0002376 | Ga0373953_0002376_1674_2255 | 185 |
| 76 | 3300035118 | Ga0373954_0000361 | Ga0373954_0000361_8875_9456 | 185 |
| 77 | 3300035119 | Ga0373956_0000661 | Ga0373956_0000661_11937_12518 | 185 |
| 78 | 3300035120 | Ga0373957_0002092 | Ga0373957_0002092_810_1391 | 185 |
| 79 | 3300035172 | Ga0373955_0000251 | Ga0373955_0000251_19162_19743 | 185 |
| 80 | 3300035724 | Ga0373933_0000886 | Ga0373933_0000886_1910_2491 | 185 |
| 81 | 3300036401 | Ga0373937_0012818 | Ga0373937_0012818_2191_2772 | 185 |
| 82 | 3300037418 | Ga0395900_0500920 | Ga0395900_0500920_295_852 | 185 |
| 83 | 3300037466 | Ga0395898_0041422 | Ga0395898_0041422_2737_3294 | 185 |
| 84 | 3300038443 | Ga0395901_1322116 | Ga0395901_1322116_48_605 | 185 |
| 85 | 3300039447 | Ga0436361_0142641 | Ga0436361_0142641_1401_1958 | 185 |
| 86 | 3300044735 | Ga0466968_0125185 | Ga0466968_0125185_95_652 | 185 |
| 87 | 3300044765 | Ga0466970_0279335 | Ga0466970_0279335_242_799 | 185 |
| 88 | 3300045049 | Ga0466959_0053980 | Ga0466959_0053980_2163_2720 | 185 |
| 89 | 3300046454 | Ga0495592_0001115 | Ga0495592_0001115_6558_7139 | 185 |
| 90 | 3300046459 | Ga0495629_0000356 | Ga0495629_0000356_8650_9231 | 185 |
| 91 | 3300046462 | Ga0495651_0013671 | Ga0495651_0013671_4250_4831 | 185 |
| 92 | 3300046463 | Ga0495653_0001366 | Ga0495653_0001366_3457_4038 | 185 |
| 93 | 3300046511 | Ga0495608_0003215 | Ga0495608_0003215_2635_3216 | 185 |
| 94 | 3300046514 | Ga0495618_0019725 | Ga0495618_0019725_3037_3618 | 185 |
| 95 | 3300046516 | Ga0495628_0025587 | Ga0495628_0025587_690_1271 | 185 |
| 96 | 3300046529 | Ga0495652_0004066 | Ga0495652_0004066_1828_2409 | 185 |
| 97 | 3300046531 | Ga0495665_0090490 | Ga0495665_0090490_587_1144 | 185 |
| 98 | 3300046533 | Ga0495640_0002055 | Ga0495640_0002055_3363_3944 | 185 |
| 99 | 3300046543 | Ga0495645_0041247 | Ga0495645_0041247_147_728 | 185 |
| 100 | 3300046559 | Ga0495667_0019143 | Ga0495667_0019143_3302_3883 | 185 |
| 101 | 3300046642 | Ga0495634_0018693 | Ga0495634_0018693_1143_1724 | 185 |
| 102 | 3300046663 | Ga0495635_0002282 | Ga0495635_0002282_4020_4601 | 185 |
| 103 | 3300046675 | Ga0495657_0007275 | Ga0495657_0007275_4002_4583 | 185 |
| 104 | 3300046678 | Ga0495599_0001267 | Ga0495599_0001267_11199_11780 | 185 |
| 105 | 3300046679 | Ga0495623_0007281 | Ga0495623_0007281_4002_4583 | 185 |
| 106 | 3300046680 | Ga0495646_0001051 | Ga0495646_0001051_12812_13393 | 185 |
| 107 | 3300046689 | Ga0495613_0032586 | Ga0495613_0032586_1045_1626 | 185 |
| 108 | 3300046809 | Ga0495600_0001804 | Ga0495600_0001804_10532_11113 | 185 |
| 109 | 3300047315 | Ga0495581_0028630 | Ga0495581_0028630_1509_2066 | 185 |
| 110 | 3300047317 | Ga0495604_0002555 | Ga0495604_0002555_11369_11950 | 185 |
| 111 | 3300047319 | Ga0495674_0013119 | Ga0495674_0013119_5067_5648 | 185 |
| 112 | 3300047322 | Ga0495680_0016083 | Ga0495680_0016083_4410_4991 | 185 |
| 113 | 3300047444 | Ga0495675_0007607 | Ga0495675_0007607_4659_5240 | 185 |
| 114 | 3300047471 | Ga0495684_0001827 | Ga0495684_0001827_14255_14836 | 185 |
| 115 | 3300047673 | Ga0495593_0001339 | Ga0495593_0001339_8785_9366 | 185 |
| 116 | 3300048088 | Ga0495602_0041771 | Ga0495602_0041771_1958_2539 | 185 |
| 117 | 3300048918 | Ga0496115_0733725 | Ga0496115_0733725_187_744 | 185 |
| 118 | 3300048924 | Ga0496121_0056481 | Ga0496121_0056481_803_1360 | 185 |
| 119 | 3300048929 | Ga0496126_0017849 | Ga0496126_0017849_1649_2206 | 185 |
| 120 | 3300049581 | Ga0501047_0130511 | Ga0501047_0130511_232_789 | 185 |
| 121 | 3300053084 | Ga0495595_0000753 | Ga0495595_0000753_2728_3309 | 185 |
| 122 | 3300053085 | Ga0495619_0001813 | Ga0495619_0001813_10426_11007 | 185 |
| 123 | 3300035695 | Ga0373927_0090626 | Ga0373927_0090626_685_1245 | 186 |
| 124 | 3300003659 | JGI25404J52841_10000396 | JGI25404J52841_100003967 | 187 |
| 125 | 3300003659 | JGI25404J52841_10002951 | JGI25404J52841_100029513 | 187 |
| 126 | 3300003659 | JGI25404J52841_10005232 | JGI25404J52841_100052323 | 187 |
| 127 | 3300003659 | JGI25404J52841_10015718 | JGI25404J52841_100157182 | 187 |
| 128 | 3300005327 | Ga0070658_10134236 | Ga0070658_101342361 | 187 |
| 129 | 3300005329 | Ga0070683_100022259 | Ga0070683_1000222596 | 187 |
| 130 | 3300005334 | Ga0068869_100000485 | Ga0068869_1000004857 | 187 |
| 131 | 3300005336 | Ga0070680_100002115 | Ga0070680_1000021151 | 187 |
| 132 | 3300005338 | Ga0068868_100202137 | Ga0068868_1002021372 | 187 |
| 133 | 3300005344 | Ga0070661_100604711 | Ga0070661_1006047111 | 187 |
| 134 | 3300005347 | Ga0070668_100075107 | Ga0070668_1000751072 | 187 |
| 135 | 3300005353 | Ga0070669_100120415 | Ga0070669_1001204152 | 187 |
| 136 | 3300005366 | Ga0070659_100172584 | Ga0070659_1001725842 | 187 |
| 137 | 3300005367 | Ga0070667_100014512 | Ga0070667_1000145128 | 187 |
| 138 | 3300005434 | Ga0070709_10018039 | Ga0070709_100180392 | 187 |
| 139 | 3300005434 | Ga0070709_10671707 | Ga0070709_106717071 | 187 |
| 140 | 3300005435 | Ga0070714_100383101 | Ga0070714_1003831011 | 187 |
| 141 | 3300005436 | Ga0070713_100003174 | Ga0070713_10000317412 | 187 |
| 142 | 3300005439 | Ga0070711_100156197 | Ga0070711_1001561972 | 187 |
| 143 | 3300005444 | Ga0070694_100175337 | Ga0070694_1001753372 | 187 |
| 144 | 3300005445 | Ga0070708_100088909 | Ga0070708_1000889091 | 187 |
| 145 | 3300005457 | Ga0070662_100007714 | Ga0070662_1000077147 | 187 |
| 146 | 3300005468 | Ga0070707_101022458 | Ga0070707_1010224582 | 187 |
| 147 | 3300005471 | Ga0070698_100041564 | Ga0070698_1000415642 | 187 |
| 148 | 3300005518 | Ga0070699_100182294 | Ga0070699_1001822942 | 187 |
| 149 | 3300005530 | Ga0070679_100304033 | Ga0070679_1003040332 | 187 |
| 150 | 3300005535 | Ga0070684_100002850 | Ga0070684_1000028507 | 187 |
| 151 | 3300005535 | Ga0070684_100009194 | Ga0070684_1000091944 | 187 |
| 152 | 3300005536 | Ga0070697_100079382 | Ga0070697_1000793822 | 187 |
| 153 | 3300005536 | Ga0070697_100635291 | Ga0070697_1006352912 | 187 |
| 154 | 3300005539 | Ga0068853_100001194 | Ga0068853_1000011947 | 187 |
| 155 | 3300005539 | Ga0068853_100085687 | Ga0068853_1000856872 | 187 |
| 156 | 3300005545 | Ga0070695_100519946 | Ga0070695_1005199462 | 187 |
| 157 | 3300005546 | Ga0070696_100085736 | Ga0070696_1000857362 | 187 |
| 158 | 3300005563 | Ga0068855_100055468 | Ga0068855_1000554685 | 187 |
| 159 | 3300005563 | Ga0068855_100337007 | Ga0068855_1003370072 | 187 |
| 160 | 3300005577 | Ga0068857_100052556 | Ga0068857_1000525562 | 187 |
| 161 | 3300005616 | Ga0068852_100088751 | Ga0068852_1000887513 | 187 |
| 162 | 3300005718 | Ga0068866_10247029 | Ga0068866_102470292 | 187 |
| 163 | 3300005719 | Ga0068861_100082894 | Ga0068861_1000828942 | 187 |
| 164 | 3300005834 | Ga0068851_10000516 | Ga0068851_100005168 | 187 |
| 165 | 3300005842 | Ga0068858_100096837 | Ga0068858_1000968372 | 187 |
| 166 | 3300005843 | Ga0068860_100069796 | Ga0068860_1000697963 | 187 |
| 167 | 3300005844 | Ga0068862_100114630 | Ga0068862_1001146303 | 187 |
| 168 | 3300005983 | Ga0081540_1000976 | Ga0081540_100097618 | 187 |
| 169 | 3300005983 | Ga0081540_1001709 | Ga0081540_100170911 | 187 |
| 170 | 3300005983 | Ga0081540_1002909 | Ga0081540_10029092 | 187 |
| 171 | 3300005983 | Ga0081540_1003388 | Ga0081540_100338813 | 187 |
| 172 | 3300005983 | Ga0081540_1019795 | Ga0081540_10197955 | 187 |
| 173 | 3300006028 | Ga0070717_10066530 | Ga0070717_100665303 | 187 |
| 174 | 3300006028 | Ga0070717_10230357 | Ga0070717_102303572 | 187 |
| 175 | 3300006175 | Ga0070712_100027070 | Ga0070712_1000270704 | 187 |
| 176 | 3300006195 | Ga0075366_10118740 | Ga0075366_101187403 | 187 |
| 177 | 3300007265 | Ga0099794_10076391 | Ga0099794_100763913 | 187 |
| 178 | 3300007265 | Ga0099794_10081418 | Ga0099794_100814182 | 187 |
| 179 | 3300007788 | Ga0099795_10025782 | Ga0099795_100257824 | 187 |
| 180 | 3300007788 | Ga0099795_10045556 | Ga0099795_100455562 | 187 |
| 181 | 3300009092 | Ga0105250_10009427 | Ga0105250_100094273 | 187 |
| 182 | 3300009093 | Ga0105240_10004989 | Ga0105240_1000498912 | 187 |
| 183 | 3300009545 | Ga0105237_10004248 | Ga0105237_100042489 | 187 |
| 184 | 3300009551 | Ga0105238_10005783 | Ga0105238_100057835 | 187 |
| 185 | 3300009553 | Ga0105249_10024773 | Ga0105249_100247734 | 187 |
| 186 | 3300010159 | Ga0099796_10031950 | Ga0099796_100319502 | 187 |
| 187 | 3300010159 | Ga0099796_10035727 | Ga0099796_100357273 | 187 |
| 188 | 3300010375 | Ga0105239_10004627 | Ga0105239_100046278 | 187 |
| 189 | 3300010375 | Ga0105239_10027657 | Ga0105239_100276574 | 187 |
| 190 | 3300013104 | Ga0157370_10090102 | Ga0157370_100901022 | 187 |
| 191 | 3300013105 | Ga0157369_10003609 | Ga0157369_1000360913 | 187 |
| 192 | 3300013306 | Ga0163162_10356306 | Ga0163162_103563062 | 187 |
| 193 | 3300013307 | Ga0157372_10410616 | Ga0157372_104106162 | 187 |
| 194 | 3300014325 | Ga0163163_10030350 | Ga0163163_100303504 | 187 |
| 195 | 3300017792 | Ga0163161_10600088 | Ga0163161_106000882 | 187 |
| 196 | 3300021361 | Ga0213872_10047793 | Ga0213872_100477932 | 187 |
| 197 | 3300025321 | Ga0207656_10001070 | Ga0207656_100010705 | 187 |
| 198 | 3300025899 | Ga0207642_10119974 | Ga0207642_101199742 | 187 |
| 199 | 3300025906 | Ga0207699_10165613 | Ga0207699_101656132 | 187 |
| 200 | 3300025906 | Ga0207699_10302965 | Ga0207699_103029652 | 187 |
| 201 | 3300025909 | Ga0207705_10058486 | Ga0207705_100584862 | 187 |
| 202 | 3300025912 | Ga0207707_10002412 | Ga0207707_100024122 | 187 |
| 203 | 3300025913 | Ga0207695_10179999 | Ga0207695_101799992 | 187 |
| 204 | 3300025914 | Ga0207671_10056465 | Ga0207671_100564656 | 187 |
| 205 | 3300025915 | Ga0207693_10021537 | Ga0207693_100215374 | 187 |
| 206 | 3300025915 | Ga0207693_10061811 | Ga0207693_100618113 | 187 |
| 207 | 3300025917 | Ga0207660_10001368 | Ga0207660_100013686 | 187 |
| 208 | 3300025920 | Ga0207649_10106145 | Ga0207649_101061452 | 187 |
| 209 | 3300025921 | Ga0207652_10019423 | Ga0207652_100194234 | 187 |
| 210 | 3300025921 | Ga0207652_10235343 | Ga0207652_102353432 | 187 |
| 211 | 3300025923 | Ga0207681_10018603 | Ga0207681_100186034 | 187 |
| 212 | 3300025924 | Ga0207694_10017191 | Ga0207694_100171916 | 187 |
| 213 | 3300025925 | Ga0207650_10962521 | Ga0207650_109625212 | 187 |
| 214 | 3300025928 | Ga0207700_10004190 | Ga0207700_100041907 | 187 |
| 215 | 3300025933 | Ga0207706_10011510 | Ga0207706_100115103 | 187 |
| 216 | 3300025935 | Ga0207709_10043796 | Ga0207709_100437961 | 187 |
| 217 | 3300025942 | Ga0207689_10000572 | Ga0207689_1000057218 | 187 |
| 218 | 3300025944 | Ga0207661_10000611 | Ga0207661_1000061116 | 187 |
| 219 | 3300025944 | Ga0207661_10017797 | Ga0207661_100177976 | 187 |
| 220 | 3300025949 | Ga0207667_10044592 | Ga0207667_100445923 | 187 |
| 221 | 3300025949 | Ga0207667_10714613 | Ga0207667_107146131 | 187 |
| 222 | 3300025961 | Ga0207712_10011646 | Ga0207712_100116466 | 187 |
| 223 | 3300025972 | Ga0207668_10001282 | Ga0207668_1000128214 | 187 |
| 224 | 3300026023 | Ga0207677_10085133 | Ga0207677_100851331 | 187 |
| 225 | 3300026035 | Ga0207703_10331140 | Ga0207703_103311402 | 187 |
| 226 | 3300026041 | Ga0207639_10003682 | Ga0207639_100036825 | 187 |
| 227 | 3300026075 | Ga0207708_10156220 | Ga0207708_101562202 | 187 |
| 228 | 3300026116 | Ga0207674_10018041 | Ga0207674_100180415 | 187 |
| 229 | 3300026118 | Ga0207675_100008342 | Ga0207675_1000083424 | 187 |
| 230 | 3300026142 | Ga0207698_10057282 | Ga0207698_100572823 | 187 |
| 231 | 3300027671 | Ga0209588_1099973 | Ga0209588_10999731 | 187 |
| 232 | 3300028380 | Ga0268265_10001129 | Ga0268265_1000112910 | 187 |
| 233 | 3300028381 | Ga0268264_10014546 | Ga0268264_100145467 | 187 |
| 234 | 3300028573 | Ga0265334_10044862 | Ga0265334_100448621 | 187 |
| 235 | 3300028786 | Ga0307517_10152224 | Ga0307517_101522242 | 187 |
| 236 | 3300031235 | Ga0265330_10008602 | Ga0265330_100086022 | 187 |
| 237 | 3300031235 | Ga0265330_10035500 | Ga0265330_100355003 | 187 |
| 238 | 3300031238 | Ga0265332_10010183 | Ga0265332_100101833 | 187 |
| 239 | 3300031241 | Ga0265325_10014082 | Ga0265325_100140824 | 187 |
| 240 | 3300031247 | Ga0265340_10022224 | Ga0265340_100222243 | 187 |
| 241 | 3300031249 | Ga0265339_10049920 | Ga0265339_100499202 | 187 |
| 242 | 3300031344 | Ga0265316_10068584 | Ga0265316_100685842 | 187 |
| 243 | 3300031344 | Ga0265316_10402158 | Ga0265316_104021582 | 187 |
| 244 | 3300031456 | Ga0307513_10120897 | Ga0307513_101208973 | 187 |
| 245 | 3300031456 | Ga0307513_10360298 | Ga0307513_103602982 | 187 |
| 246 | 3300031507 | Ga0307509_10337971 | Ga0307509_103379712 | 187 |
| 247 | 3300031595 | Ga0265313_10040437 | Ga0265313_100404372 | 187 |
| 248 | 3300031712 | Ga0265342_10006981 | Ga0265342_100069813 | 187 |
| 249 | 3300035116 | Ga0373945_0171221 | Ga0373945_0171221_163_726 | 187 |
| 250 | 3300035695 | Ga0373927_0143644 | Ga0373927_0143644_367_942 | 187 |
| 251 | 3300035695 | Ga0373927_0265863 | Ga0373927_0265863_370_933 | 187 |
| 252 | 3300041443 | Ga0451789_0436801 | Ga0451789_0436801_233_796 | 187 |
| 253 | 3300046460 | Ga0495638_0295176 | Ga0495638_0295176_155_718 | 187 |
| 254 | 3300046491 | Ga0495584_0039456 | Ga0495584_0039456_1346_1909 | 187 |
| 255 | 3300046506 | Ga0495583_0242115 | Ga0495583_0242115_38_601 | 187 |
| 256 | 3300046518 | Ga0495631_0159053 | Ga0495631_0159053_180_743 | 187 |
| 257 | 3300046524 | Ga0495648_0000822 | Ga0495648_0000822_25484_26047 | 187 |
| 258 | 3300046524 | Ga0495648_0258389 | Ga0495648_0258389_51_614 | 187 |
| 259 | 3300046664 | Ga0495659_0026560 | Ga0495659_0026560_561_1124 | 187 |
| 260 | 3300046665 | Ga0495661_0209803 | Ga0495661_0209803_203_766 | 187 |
| 261 | 3300046692 | Ga0495671_0109167 | Ga0495671_0109167_532_1095 | 187 |
| 262 | 3300047315 | Ga0495581_0370911 | Ga0495581_0370911_139_705 | 187 |
| 263 | 3300047447 | Ga0495685_025800 | Ga0495685_025800_73_636 | 187 |
| 264 | 3300048903 | Ga0496100_0064401 | Ga0496100_0064401_35_601 | 187 |
| 265 | 3300048904 | Ga0496101_0610648 | Ga0496101_0610648_232_807 | 187 |
| 266 | 3300048905 | Ga0496102_0140305 | Ga0496102_0140305_1520_2086 | 187 |
| 267 | 3300048907 | Ga0496104_0014904 | Ga0496104_0014904_5514_6080 | 187 |
| 268 | 3300048908 | Ga0496105_0023356 | Ga0496105_0023356_610_1176 | 187 |
| 269 | 3300048911 | Ga0496108_0004452 | Ga0496108_0004452_601_1167 | 187 |
| 270 | 3300048911 | Ga0496108_0637737 | Ga0496108_0637737_293_868 | 187 |
| 271 | 3300048912 | Ga0496109_0027022 | Ga0496109_0027022_2252_2818 | 187 |
| 272 | 3300048913 | Ga0496110_0001209 | Ga0496110_0001209_8686_9252 | 187 |
| 273 | 3300048914 | Ga0496111_0011097 | Ga0496111_0011097_745_1311 | 187 |
| 274 | 3300048915 | Ga0496112_0071075 | Ga0496112_0071075_444_1010 | 187 |
| 275 | 3300048916 | Ga0496113_0002811 | Ga0496113_0002811_1508_2074 | 187 |
| 276 | 3300048917 | Ga0496114_0381133 | Ga0496114_0381133_547_1113 | 187 |
| 277 | 3300048918 | Ga0496115_0069314 | Ga0496115_0069314_1522_2088 | 187 |
| 278 | 3300049460 | Ga0495682_0088539 | Ga0495682_0088539_527_1090 | 187 |
| 279 | 3300053134 | Ga0500658_0119671 | Ga0500658_0119671_428_991 | 187 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2xts-assembly1.cif.gz_B | crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus | 0.6137 | 29 | 187 |
| 2c8s-assembly1.cif.gz_A | cytochrome cl from methylobacterium extorquens | 0.6107 | 60 | 144 |
| 4wqd-assembly1.cif.gz_A | thiosulfate dehydrogenase (tsda) from allochromatium vinosum - k208g mutant | 0.599 | 59 | 143 |
| 4wq7-assembly1.cif.gz_A | "thiosulfate dehydrogenase (tsda) from allochromatium vinosum - ""as isolated"" form" | 0.5987 | 59 | 143 |
| 5lo9-assembly1.cif.gz_A | "thiosulfate dehydrogenase (tsdba) from marichromatium purpuratum - ""as isolated"" form" | 0.5964 | 59 | 141 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2xtsD01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6992 | 35 | 170 | 1.10.760.10 |
| 2xtsD01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6905 | 35 | 170 | 1.10.760.10 |
| af_P9WP35_148_241_1.10.760.10 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6321 | 59 | 146 | 1.10.760.10 |
| 2c8sA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6107 | 60 | 144 | 1.10.760.10 |
| 1mg2H00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6094 | 60 | 144 | 1.10.760.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N8LVX5-F1-model_v4 | C-type cytochrome | 0.7162 | 47 | 172 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A2E8E3H5-F1-model_v4 | Cytochrome c domain-containing protein | 0.7132 | 47 | 175 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A2D7GEF4-F1-model_v4 | Cytochrome C | 0.7071 | 46 | 174 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A382K3I9-F1-model_v4 | Cytochrome c domain-containing protein | 0.7029 | 53 | 172 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A2E3ZVD0-F1-model_v4 | Cytochrome C | 0.6996 | 46 | 174 |
GO:0009055
GO:0020037 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar