F383145

General Info

Members Datasets Scaffolds Average Seq Length
279 225 271 185

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10360298|Ga0307513_103602982
Length 199
Sequence MLMRRLEFAALAAITLLCVTSAKAQGPYGIGRVATPAEIAGWNIDVGGDGSNLPSGIGSVSHGSEVFGQQCAACHGAKGEGGIGDRLVGGQGTLGTSKPVRTVGSYWPYAPTLFDYIRRAMPQNAPQSLGNDDVYAVSAYILSLNGLLPADATLDAKALTKIKMPNRNMFVGDPRPDVKNPECMTGCQGNNTNSGISKP

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
3 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
4 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
5 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
6 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
102 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
103 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
111 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
115 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
118 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
119 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
133 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
134 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
135 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
147 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
154 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
163 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
164 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
178 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
179 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
207 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
210 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
211 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
212 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
213 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
214 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
215 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
216 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
217 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
218 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
219 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
220 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
221 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
222 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
223 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
224 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
225 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.13
Metatranscriptomes 0
Isolates 2.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.17
Nodule 1.08
Rhizoplane 6.45
Rhizosphere 77.78
Stem 0
Stem Tuber 0
Unclassified 7.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10000396 3300003659 Bacteria 6017
2 JGI25404J52841_10002951 3300003659 Bacteria 3301
3 JGI25404J52841_10005232 3300003659 Bacteria 2677
4 JGI25404J52841_10015718 3300003659 Bacteria 1642
5 Ga0070658_10134236 3300005327 Bacteria 2064
6 Ga0070683_100022259 3300005329 Bacteria 5662
7 Ga0068869_100000485 3300005334 Bacteria 22024
8 Ga0070680_100002115 3300005336 Bacteria 14670
9 Ga0068868_100202137 3300005338 Bacteria 1657
10 Ga0070661_100604711 3300005344 Bacteria 887
11 Ga0070668_100075107 3300005347 Bacteria 2638
12 Ga0070669_100120415 3300005353 Bacteria 2001
13 Ga0070659_100172584 3300005366 Bacteria 1772
14 Ga0070667_100014512 3300005367 Bacteria 6510
15 Ga0070709_10018039 3300005434 Bacteria 4056
16 Ga0070709_10671707 3300005434 Bacteria 804
17 Ga0070714_100383101 3300005435 Bacteria 1326
18 Ga0070713_100003174 3300005436 Bacteria 10821
19 Ga0070711_100156197 3300005439 Bacteria 1725
20 Ga0070694_100175337 3300005444 Bacteria 1582
21 Ga0070708_100088909 3300005445 Bacteria 2810
22 Ga0070708_100874644 3300005445 Bacteria 844
23 Ga0070662_100007714 3300005457 Bacteria 6984
24 Ga0070707_101022458 3300005468 Bacteria 792
25 Ga0070698_100041564 3300005471 Bacteria 4719
26 Ga0070698_100242379 3300005471 Bacteria 1736
27 Ga0070699_100182294 3300005518 Bacteria 1864
28 Ga0070679_100304033 3300005530 Bacteria 1545
29 Ga0070684_100002850 3300005535 Bacteria 12851
30 Ga0070684_100009194 3300005535 Bacteria 7774
31 Ga0070697_100079382 3300005536 Bacteria 2702
32 Ga0070697_100514937 3300005536 Bacteria 1047
33 Ga0070697_100635291 3300005536 Bacteria 940
34 Ga0068853_100001194 3300005539 Bacteria 18523
35 Ga0068853_100085687 3300005539 Bacteria 2762
36 Ga0070695_100519946 3300005545 Bacteria 923
37 Ga0070696_100085736 3300005546 Bacteria 2236
38 Ga0068855_100055468 3300005563 Bacteria 4654
39 Ga0068855_100337007 3300005563 Bacteria 1664
40 Ga0068857_100052556 3300005577 Bacteria 3615
41 Ga0068852_100088751 3300005616 Bacteria 2762
42 Ga0068866_10247029 3300005718 Bacteria 1090
43 Ga0068861_100082894 3300005719 Bacteria 2514
44 Ga0068851_10000516 3300005834 Bacteria 16919
45 Ga0068858_100096837 3300005842 Bacteria 2750
46 Ga0068860_100001705 3300005843 Bacteria 23470
47 Ga0068860_100069796 3300005843 Bacteria 3340
48 Ga0068862_100114630 3300005844 Bacteria 2369
49 Ga0081540_1000976 3300005983 Bacteria 25808
50 Ga0081540_1001709 3300005983 Bacteria 18581
51 Ga0081540_1002909 3300005983 Bacteria 13805
52 Ga0081540_1003388 3300005983 Bacteria 12637
53 Ga0081540_1019795 3300005983 Bacteria 4075
54 Ga0070717_10066530 3300006028 Bacteria 2997
55 Ga0070717_10230357 3300006028 Bacteria 1631
56 Ga0070712_100027070 3300006175 Bacteria 3825
57 Ga0075366_10118740 3300006195 Bacteria 1593
58 Ga0075433_10718306 3300006852 Bacteria 875
59 Ga0099794_10076391 3300007265 Bacteria 1646
60 Ga0099794_10081418 3300007265 Bacteria 1597
61 Ga0099794_10144604 3300007265 Bacteria 1205
62 Ga0099795_10025782 3300007788 Bacteria 1975
63 Ga0099795_10045556 3300007788 Bacteria 1577
64 Ga0105250_10009427 3300009092 Bacteria 4111
65 Ga0105250_10189843 3300009092 Unclassified 864
66 Ga0105240_10004989 3300009093 Bacteria 19936
67 Ga0105240_10997177 3300009093 Bacteria 896
68 Ga0114129_10885604 3300009147 Bacteria 1132
69 Ga0105243_10029550 3300009148 Bacteria 4215
70 Ga0105237_10004248 3300009545 Bacteria 16672
71 Ga0105237_10874927 3300009545 Bacteria 905
72 Ga0105238_10005783 3300009551 Bacteria 12239
73 Ga0105249_10024773 3300009553 Bacteria 5395
74 Ga0099796_10031950 3300010159 Bacteria 1721
75 Ga0099796_10035727 3300010159 Bacteria 1650
76 Ga0099796_10082954 3300010159 Bacteria 1178
77 Ga0099796_10271507 3300010159 Bacteria 710
78 Ga0105239_10004627 3300010375 Bacteria 16355
79 Ga0105239_10027657 3300010375 Bacteria 6239
80 Ga0157370_10090102 3300013104 Bacteria 2880
81 Ga0157369_10003609 3300013105 Bacteria 18390
82 Ga0157369_10185274 3300013105 Bacteria 2189
83 Ga0163162_10356306 3300013306 Bacteria 1596
84 Ga0157372_10410616 3300013307 Bacteria 1578
85 Ga0163163_10030350 3300014325 Bacteria 5208
86 Ga0157380_10182466 3300014326 Bacteria 1845
87 Ga0163161_10600088 3300017792 Bacteria 908
88 Ga0213872_10047793 3300021361 Bacteria 1945
89 Ga0213875_10084633 3300021388 Bacteria 1479
90 Ga0207656_10001070 3300025321 Bacteria 8955
91 Ga0207642_10119974 3300025899 Bacteria 1355
92 Ga0207699_10165613 3300025906 Bacteria 1475
93 Ga0207699_10302965 3300025906 Bacteria 1116
94 Ga0207705_10058486 3300025909 Bacteria 2781
95 Ga0207684_10721400 3300025910 Bacteria 846
96 Ga0207707_10002412 3300025912 Bacteria 16809
97 Ga0207695_10179999 3300025913 Bacteria 2035
98 Ga0207671_10056465 3300025914 Bacteria 2909
99 Ga0207693_10021537 3300025915 Bacteria 5121
100 Ga0207693_10061811 3300025915 Bacteria 2934
101 Ga0207660_10001368 3300025917 Bacteria 16343
102 Ga0207649_10106145 3300025920 Bacteria 1868
103 Ga0207652_10019423 3300025921 Bacteria 5589
104 Ga0207652_10235343 3300025921 Bacteria 1651
105 Ga0207681_10018603 3300025923 Bacteria 4379
106 Ga0207694_10017191 3300025924 Bacteria 5465
107 Ga0207650_10962521 3300025925 Bacteria 726
108 Ga0207700_10004190 3300025928 Bacteria 8464
109 Ga0207706_10011510 3300025933 Bacteria 8058
110 Ga0207709_10043796 3300025935 Bacteria 2700
111 Ga0207689_10000572 3300025942 Bacteria 35176
112 Ga0207661_10000611 3300025944 Bacteria 22884
113 Ga0207661_10017797 3300025944 Bacteria 5266
114 Ga0207667_10044592 3300025949 Bacteria 4698
115 Ga0207667_10714613 3300025949 Bacteria 1004
116 Ga0207712_10011646 3300025961 Bacteria 5606
117 Ga0207668_10001282 3300025972 Bacteria 14975
118 Ga0207677_10085133 3300026023 Bacteria 2281
119 Ga0207703_10331140 3300026035 Bacteria 1397
120 Ga0207639_10003682 3300026041 Bacteria 10302
121 Ga0207708_10156220 3300026075 Bacteria 1799
122 Ga0207674_10018041 3300026116 Bacteria 7686
123 Ga0207675_100008342 3300026118 Bacteria 9760
124 Ga0207698_10057282 3300026142 Bacteria 3014
125 Ga0209588_1099973 3300027671 Bacteria 934
126 Ga0268265_10001129 3300028380 Bacteria 23587
127 Ga0268264_10000020 3300028381 Bacteria 483593
128 Ga0268264_10014546 3300028381 Bacteria 6465
129 Ga0265334_10044862 3300028573 Bacteria 1714
130 Ga0307517_10152224 3300028786 Bacteria 1583
131 Ga0265330_10008602 3300031235 Bacteria 4904
132 Ga0265330_10035500 3300031235 Bacteria 2224
133 Ga0265332_10010183 3300031238 Bacteria 4185
134 Ga0265325_10014082 3300031241 Bacteria 4532
135 Ga0265340_10022224 3300031247 Bacteria 3244
136 Ga0265339_10049920 3300031249 Bacteria 2289
137 Ga0265316_10068584 3300031344 Bacteria 2739
138 Ga0265316_10402158 3300031344 Bacteria 986
139 Ga0307513_10120897 3300031456 Bacteria 2587
140 Ga0307513_10360298 3300031456 Bacteria 1199
141 Ga0307509_10337971 3300031507 Bacteria 1234
142 Ga0265313_10040437 3300031595 Bacteria 2305
143 Ga0265314_10003656 3300031711 Bacteria 14771
144 Ga0265342_10006981 3300031712 Bacteria 8344
145 Ga0316215_1003232 3300033544 Bacteria 1548
146 Ga0373923_0006264 3300035111 Bacteria 4100
147 Ga0373936_0084986 3300035113 Bacteria 1321
148 Ga0373945_0171221 3300035116 Bacteria 890
149 Ga0373953_0002376 3300035117 Bacteria 5682
150 Ga0373954_0000361 3300035118 Bacteria 16793
151 Ga0373956_0000661 3300035119 Bacteria 14184
152 Ga0373957_0002092 3300035120 Bacteria 5601
153 Ga0373955_0000251 3300035172 Bacteria 22333
154 Ga0373927_0090626 3300035695 Bacteria 1986
155 Ga0373927_0143644 3300035695 Bacteria 1562
156 Ga0373927_0265863 3300035695 Bacteria 1128
157 Ga0373933_0000886 3300035724 Bacteria 18310
158 Ga0373947_0692296 3300035725 Bacteria 695
159 Ga0373937_0012818 3300036401 Bacteria 7382
160 Ga0395900_0500920 3300037418 Bacteria 1165
161 Ga0395898_0041422 3300037466 Bacteria 4549
162 Ga0436364_0530630 3300037853 Bacteria 1993
163 Ga0436364_0873230 3300037853 Bacteria 2035
164 Ga0436364_1430648 3300037853 Bacteria 950
165 Ga0395901_1322116 3300038443 Bacteria 682
166 Ga0436365_0547714 3300039437 Unclassified 600
167 Ga0436360_0311118 3300039438 Bacteria 804
168 Ga0436361_0142641 3300039447 Bacteria 2306
169 Ga0451789_0436801 3300041443 Bacteria 815
170 Ga0466969_0053388 3300044656 Bacteria 1983
171 Ga0466966_0001605 3300044684 Bacteria 14549
172 Ga0466966_0326030 3300044684 Bacteria 923
173 Ga0466961_0000016 3300044693 Bacteria 111421
174 Ga0466968_0125185 3300044735 Bacteria 1166
175 Ga0466970_0279335 3300044765 Bacteria 939
176 Ga0466959_0001842 3300045049 Bacteria 13313
177 Ga0466959_0053980 3300045049 Bacteria 2937
178 Ga0495592_0001115 3300046454 Bacteria 18689
179 Ga0495629_0000356 3300046459 Bacteria 38962
180 Ga0495638_0295176 3300046460 Bacteria 875
181 Ga0495651_0013671 3300046462 Bacteria 6272
182 Ga0495653_0001366 3300046463 Bacteria 18943
183 Ga0495584_0039456 3300046491 Bacteria 2385
184 Ga0495583_0242115 3300046506 Bacteria 725
185 Ga0495608_0003215 3300046511 Bacteria 11698
186 Ga0495618_0019725 3300046514 Bacteria 4149
187 Ga0495628_0025587 3300046516 Bacteria 4821
188 Ga0495631_0159053 3300046518 Bacteria 969
189 Ga0495643_0116866 3300046522 Bacteria 1351
190 Ga0495648_0000822 3300046524 Bacteria 32752
191 Ga0495648_0258389 3300046524 Bacteria 837
192 Ga0495663_0129939 3300046525 Bacteria 849
193 Ga0495652_0004066 3300046529 Bacteria 14134
194 Ga0495665_0090490 3300046531 Bacteria 1608
195 Ga0495640_0002055 3300046533 Bacteria 16055
196 Ga0495645_0041247 3300046543 Bacteria 3365
197 Ga0495667_0019143 3300046559 Bacteria 4619
198 Ga0495634_0018693 3300046642 Bacteria 4930
199 Ga0495635_0002282 3300046663 Bacteria 13039
200 Ga0495659_0026560 3300046664 Bacteria 1991
201 Ga0495661_0209803 3300046665 Bacteria 1015
202 Ga0495657_0007275 3300046675 Bacteria 8568
203 Ga0495599_0001267 3300046678 Bacteria 14348
204 Ga0495623_0007281 3300046679 Bacteria 7181
205 Ga0495646_0001051 3300046680 Bacteria 15983
206 Ga0495613_0032586 3300046689 Bacteria 3872
207 Ga0495670_0177358 3300046691 Bacteria 1124
208 Ga0495671_0109167 3300046692 Bacteria 1351
209 Ga0495600_0001804 3300046809 Bacteria 11977
210 Ga0495581_0028630 3300047315 Bacteria 3230
211 Ga0495581_0370911 3300047315 Bacteria 835
212 Ga0495604_0002555 3300047317 Bacteria 14548
213 Ga0495674_0013119 3300047319 Bacteria 7793
214 Ga0495680_0016083 3300047322 Bacteria 6432
215 Ga0495675_0007607 3300047444 Bacteria 6681
216 Ga0495677_0113503 3300047445 Bacteria 1031
217 Ga0495685_025800 3300047447 Bacteria 2023
218 Ga0495681_0156376 3300047470 Bacteria 953
219 Ga0495684_0001827 3300047471 Bacteria 17110
220 Ga0495593_0001339 3300047673 Bacteria 14402
221 Ga0495602_0041771 3300048088 Bacteria 4185
222 Ga0495602_0770594 3300048088 Bacteria 648
223 Ga0495615_0038234 3300048090 Bacteria 1186
224 Ga0496100_0064401 3300048903 Bacteria 2426
225 Ga0496101_0610648 3300048904 Bacteria 862
226 Ga0496102_0140305 3300048905 Bacteria 2266
227 Ga0496102_0392309 3300048905 Bacteria 1306
228 Ga0496104_0014904 3300048907 Bacteria 7028
229 Ga0496105_0023356 3300048908 Bacteria 5013
230 Ga0496106_0770962 3300048909 Bacteria 764
231 Ga0496108_0004452 3300048911 Bacteria 11279
232 Ga0496108_0637737 3300048911 Bacteria 927
233 Ga0496109_0027022 3300048912 Bacteria 5120
234 Ga0496110_0001209 3300048913 Bacteria 18367
235 Ga0496111_0011097 3300048914 Bacteria 6063
236 Ga0496112_0071075 3300048915 Bacteria 3439
237 Ga0496113_0002811 3300048916 Bacteria 10241
238 Ga0496114_0381133 3300048917 Bacteria 1248
239 Ga0496115_0069314 3300048918 Bacteria 2856
240 Ga0496115_0733725 3300048918 Bacteria 774
241 Ga0496118_0366443 3300048921 Bacteria 762
242 Ga0496121_0056481 3300048924 Bacteria 3261
243 Ga0496121_0096407 3300048924 Bacteria 2295
244 Ga0496121_0104404 3300048924 Bacteria 2178
245 Ga0496126_0017849 3300048929 Bacteria 7060
246 Ga0496126_0208937 3300048929 Bacteria 1644
247 Ga0495682_0088539 3300049460 Bacteria 1112
248 Ga0501047_0130511 3300049581 Bacteria 2393
249 nmdc:mga03683_341463_c1 3300050489 Bacteria 707
250 nmdc:mga0k408_53492_c1 3300050493 Bacteria 2340
251 nmdc:mga0a205_666358_c1 3300050515 Bacteria 891
252 Ga0495655_0033406 3300053083 Bacteria 1266
253 Ga0495595_0000753 3300053084 Bacteria 12271
254 Ga0495619_0001813 3300053085 Bacteria 14212
255 Ga0500647_0009609 3300053091 Bacteria 4249
256 Ga0500566_0000077 3300053094 Bacteria 48099
257 Ga0500640_001409 3300053095 Bacteria 7269
258 Ga0500572_000932 3300053111 Bacteria 8962
259 Ga0500614_001050 3300053123 Bacteria 6876
260 Ga0500658_0119671 3300053134 Bacteria 1166
261 Ga0500559_0009135 3300053136 Bacteria 4306
262 Ga0500559_0061012 3300053136 Bacteria 1681
263 Ga0500590_083256 3300053148 Bacteria 1568
264 Ga0500603_001163 3300053150 Bacteria 6130
265 Ga0500630_000158 3300053159 Bacteria 24806
266 Ga0500638_093864 3300053162 Bacteria 1409
267 Ga0500639_000171 3300053163 Bacteria 31550
268 Ga0500639_157457 3300053163 Bacteria 1038
269 Ga0500637_0041461 3300053178 Bacteria 2602
270 Ga0500596_000666 3300053735 Bacteria 6645
271 Ga0500601_005449 3300053737 Bacteria 1393

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053737 Ga0500601_005449 Ga0500601_005449_413_961 165
2 3300053136 Ga0500559_0061012 Ga0500559_0061012_588_1151 169
3 3300053148 Ga0500590_083256 Ga0500590_083256_112_675 169
4 3300053163 Ga0500639_157457 Ga0500639_157457_95_658 169
5 3300053178 Ga0500637_0041461 Ga0500637_0041461_733_1296 169
6 3300035113 Ga0373936_0084986 Ga0373936_0084986_178_741 170
7 3300035725 Ga0373947_0692296 Ga0373947_0692296_14_526 170
8 3300048088 Ga0495602_0770594 Ga0495602_0770594_47_592 170
9 3300053091 Ga0500647_0009609 Ga0500647_0009609_3557_4120 170
10 3300053094 Ga0500566_0000077 Ga0500566_0000077_39705_40268 170
11 3300053095 Ga0500640_001409 Ga0500640_001409_3096_3659 170
12 3300053111 Ga0500572_000932 Ga0500572_000932_3213_3776 170
13 3300053123 Ga0500614_001050 Ga0500614_001050_5654_6217 170
14 3300053136 Ga0500559_0009135 Ga0500559_0009135_1005_1568 170
15 3300053150 Ga0500603_001163 Ga0500603_001163_4980_5543 170
16 3300053159 Ga0500630_000158 Ga0500630_000158_9519_10082 170
17 3300053162 Ga0500638_093864 Ga0500638_093864_555_1118 170
18 3300053163 Ga0500639_000171 Ga0500639_000171_23029_23592 170
19 3300053735 Ga0500596_000666 Ga0500596_000666_113_676 170
20 iso_pu_bacteria 2824704595 2824705610 171
21 iso_pu_bacteria 2824753945 2824756339 171
22 iso_pu_bacteria 2824763712 2824764023 171
23 iso_pu_bacteria 2904711408 2904720393 171
24 3300009092 Ga0105250_10189843 Ga0105250_101898432 172
25 3300048924 Ga0496121_0096407 Ga0496121_0096407_1501_2046 172
26 3300050493 nmdc:mga0k408_53492_c1 nmdc:mga0k408_53492_c1_1040_1561 173
27 3300010159 Ga0099796_10082954 Ga0099796_100829542 175
28 3300009148 Ga0105243_10029550 Ga0105243_100295502 177
29 3300009545 Ga0105237_10874927 Ga0105237_108749272 177
30 3300014326 Ga0157380_10182466 Ga0157380_101824662 177
31 3300021388 Ga0213875_10084633 Ga0213875_100846332 177
32 3300037853 Ga0436364_0530630 Ga0436364_0530630_762_1313 177
33 3300037853 Ga0436364_0873230 Ga0436364_0873230_51_590 177
34 3300046522 Ga0495643_0116866 Ga0495643_0116866_557_1090 177
35 3300046525 Ga0495663_0129939 Ga0495663_0129939_52_585 177
36 3300046691 Ga0495670_0177358 Ga0495670_0177358_364_897 177
37 3300047445 Ga0495677_0113503 Ga0495677_0113503_146_679 177
38 3300047470 Ga0495681_0156376 Ga0495681_0156376_213_746 177
39 3300048090 Ga0495615_0038234 Ga0495615_0038234_230_763 177
40 3300048905 Ga0496102_0392309 Ga0496102_0392309_282_815 177
41 3300048921 Ga0496118_0366443 Ga0496118_0366443_73_606 177
42 3300048924 Ga0496121_0104404 Ga0496121_0104404_1355_1888 177
43 3300050489 nmdc:mga03683_341463_c1 nmdc:mga03683_341463_c1_86_619 177
44 3300053083 Ga0495655_0033406 Ga0495655_0033406_243_776 177
45 3300005843 Ga0068860_100001705 Ga0068860_10000170520 178
46 3300010159 Ga0099796_10271507 Ga0099796_102715072 178
47 3300028381 Ga0268264_10000020 Ga0268264_10000020177 178
48 3300048929 Ga0496126_0208937 Ga0496126_0208937_120_656 178
49 3300006852 Ga0075433_10718306 Ga0075433_107183062 179
50 3300009147 Ga0114129_10885604 Ga0114129_108856041 179
51 3300037853 Ga0436364_1430648 Ga0436364_1430648_248_802 179
52 3300039437 Ga0436365_0547714 Ga0436365_0547714_24_566 179
53 3300044656 Ga0466969_0053388 Ga0466969_0053388_374_913 179
54 3300044684 Ga0466966_0001605 Ga0466966_0001605_9425_9964 179
55 3300044693 Ga0466961_0000016 Ga0466961_0000016_6283_6822 179
56 3300045049 Ga0466959_0001842 Ga0466959_0001842_6254_6793 179
57 3300048909 Ga0496106_0770962 Ga0496106_0770962_57_596 179
58 3300050515 nmdc:mga0a205_666358_c1 nmdc:mga0a205_666358_c1_281_820 179
59 3300039438 Ga0436360_0311118 Ga0436360_0311118_216_758 180
60 3300033544 Ga0316215_1003232 Ga0316215_10032322 181
61 3300031711 Ga0265314_10003656 Ga0265314_100036567 182
62 iso_pu_bacteria 8006984368 8006993978 183
63 iso_pu_bacteria 8056681323 8056683619 183
64 3300044684 Ga0466966_0326030 Ga0466966_0326030_12_566 184
65 iso_pu_bacteria 2508501128 2509152113 184
66 iso_pu_bacteria 2513237141 2513888295 184
67 3300005445 Ga0070708_100874644 Ga0070708_1008746442 185
68 3300005471 Ga0070698_100242379 Ga0070698_1002423792 185
69 3300005536 Ga0070697_100514937 Ga0070697_1005149372 185
70 3300007265 Ga0099794_10144604 Ga0099794_101446041 185
71 3300009093 Ga0105240_10997177 Ga0105240_109971772 185
72 3300013105 Ga0157369_10185274 Ga0157369_101852742 185
73 3300025910 Ga0207684_10721400 Ga0207684_107214001 185
74 3300035111 Ga0373923_0006264 Ga0373923_0006264_2538_3119 185
75 3300035117 Ga0373953_0002376 Ga0373953_0002376_1674_2255 185
76 3300035118 Ga0373954_0000361 Ga0373954_0000361_8875_9456 185
77 3300035119 Ga0373956_0000661 Ga0373956_0000661_11937_12518 185
78 3300035120 Ga0373957_0002092 Ga0373957_0002092_810_1391 185
79 3300035172 Ga0373955_0000251 Ga0373955_0000251_19162_19743 185
80 3300035724 Ga0373933_0000886 Ga0373933_0000886_1910_2491 185
81 3300036401 Ga0373937_0012818 Ga0373937_0012818_2191_2772 185
82 3300037418 Ga0395900_0500920 Ga0395900_0500920_295_852 185
83 3300037466 Ga0395898_0041422 Ga0395898_0041422_2737_3294 185
84 3300038443 Ga0395901_1322116 Ga0395901_1322116_48_605 185
85 3300039447 Ga0436361_0142641 Ga0436361_0142641_1401_1958 185
86 3300044735 Ga0466968_0125185 Ga0466968_0125185_95_652 185
87 3300044765 Ga0466970_0279335 Ga0466970_0279335_242_799 185
88 3300045049 Ga0466959_0053980 Ga0466959_0053980_2163_2720 185
89 3300046454 Ga0495592_0001115 Ga0495592_0001115_6558_7139 185
90 3300046459 Ga0495629_0000356 Ga0495629_0000356_8650_9231 185
91 3300046462 Ga0495651_0013671 Ga0495651_0013671_4250_4831 185
92 3300046463 Ga0495653_0001366 Ga0495653_0001366_3457_4038 185
93 3300046511 Ga0495608_0003215 Ga0495608_0003215_2635_3216 185
94 3300046514 Ga0495618_0019725 Ga0495618_0019725_3037_3618 185
95 3300046516 Ga0495628_0025587 Ga0495628_0025587_690_1271 185
96 3300046529 Ga0495652_0004066 Ga0495652_0004066_1828_2409 185
97 3300046531 Ga0495665_0090490 Ga0495665_0090490_587_1144 185
98 3300046533 Ga0495640_0002055 Ga0495640_0002055_3363_3944 185
99 3300046543 Ga0495645_0041247 Ga0495645_0041247_147_728 185
100 3300046559 Ga0495667_0019143 Ga0495667_0019143_3302_3883 185
101 3300046642 Ga0495634_0018693 Ga0495634_0018693_1143_1724 185
102 3300046663 Ga0495635_0002282 Ga0495635_0002282_4020_4601 185
103 3300046675 Ga0495657_0007275 Ga0495657_0007275_4002_4583 185
104 3300046678 Ga0495599_0001267 Ga0495599_0001267_11199_11780 185
105 3300046679 Ga0495623_0007281 Ga0495623_0007281_4002_4583 185
106 3300046680 Ga0495646_0001051 Ga0495646_0001051_12812_13393 185
107 3300046689 Ga0495613_0032586 Ga0495613_0032586_1045_1626 185
108 3300046809 Ga0495600_0001804 Ga0495600_0001804_10532_11113 185
109 3300047315 Ga0495581_0028630 Ga0495581_0028630_1509_2066 185
110 3300047317 Ga0495604_0002555 Ga0495604_0002555_11369_11950 185
111 3300047319 Ga0495674_0013119 Ga0495674_0013119_5067_5648 185
112 3300047322 Ga0495680_0016083 Ga0495680_0016083_4410_4991 185
113 3300047444 Ga0495675_0007607 Ga0495675_0007607_4659_5240 185
114 3300047471 Ga0495684_0001827 Ga0495684_0001827_14255_14836 185
115 3300047673 Ga0495593_0001339 Ga0495593_0001339_8785_9366 185
116 3300048088 Ga0495602_0041771 Ga0495602_0041771_1958_2539 185
117 3300048918 Ga0496115_0733725 Ga0496115_0733725_187_744 185
118 3300048924 Ga0496121_0056481 Ga0496121_0056481_803_1360 185
119 3300048929 Ga0496126_0017849 Ga0496126_0017849_1649_2206 185
120 3300049581 Ga0501047_0130511 Ga0501047_0130511_232_789 185
121 3300053084 Ga0495595_0000753 Ga0495595_0000753_2728_3309 185
122 3300053085 Ga0495619_0001813 Ga0495619_0001813_10426_11007 185
123 3300035695 Ga0373927_0090626 Ga0373927_0090626_685_1245 186
124 3300003659 JGI25404J52841_10000396 JGI25404J52841_100003967 187
125 3300003659 JGI25404J52841_10002951 JGI25404J52841_100029513 187
126 3300003659 JGI25404J52841_10005232 JGI25404J52841_100052323 187
127 3300003659 JGI25404J52841_10015718 JGI25404J52841_100157182 187
128 3300005327 Ga0070658_10134236 Ga0070658_101342361 187
129 3300005329 Ga0070683_100022259 Ga0070683_1000222596 187
130 3300005334 Ga0068869_100000485 Ga0068869_1000004857 187
131 3300005336 Ga0070680_100002115 Ga0070680_1000021151 187
132 3300005338 Ga0068868_100202137 Ga0068868_1002021372 187
133 3300005344 Ga0070661_100604711 Ga0070661_1006047111 187
134 3300005347 Ga0070668_100075107 Ga0070668_1000751072 187
135 3300005353 Ga0070669_100120415 Ga0070669_1001204152 187
136 3300005366 Ga0070659_100172584 Ga0070659_1001725842 187
137 3300005367 Ga0070667_100014512 Ga0070667_1000145128 187
138 3300005434 Ga0070709_10018039 Ga0070709_100180392 187
139 3300005434 Ga0070709_10671707 Ga0070709_106717071 187
140 3300005435 Ga0070714_100383101 Ga0070714_1003831011 187
141 3300005436 Ga0070713_100003174 Ga0070713_10000317412 187
142 3300005439 Ga0070711_100156197 Ga0070711_1001561972 187
143 3300005444 Ga0070694_100175337 Ga0070694_1001753372 187
144 3300005445 Ga0070708_100088909 Ga0070708_1000889091 187
145 3300005457 Ga0070662_100007714 Ga0070662_1000077147 187
146 3300005468 Ga0070707_101022458 Ga0070707_1010224582 187
147 3300005471 Ga0070698_100041564 Ga0070698_1000415642 187
148 3300005518 Ga0070699_100182294 Ga0070699_1001822942 187
149 3300005530 Ga0070679_100304033 Ga0070679_1003040332 187
150 3300005535 Ga0070684_100002850 Ga0070684_1000028507 187
151 3300005535 Ga0070684_100009194 Ga0070684_1000091944 187
152 3300005536 Ga0070697_100079382 Ga0070697_1000793822 187
153 3300005536 Ga0070697_100635291 Ga0070697_1006352912 187
154 3300005539 Ga0068853_100001194 Ga0068853_1000011947 187
155 3300005539 Ga0068853_100085687 Ga0068853_1000856872 187
156 3300005545 Ga0070695_100519946 Ga0070695_1005199462 187
157 3300005546 Ga0070696_100085736 Ga0070696_1000857362 187
158 3300005563 Ga0068855_100055468 Ga0068855_1000554685 187
159 3300005563 Ga0068855_100337007 Ga0068855_1003370072 187
160 3300005577 Ga0068857_100052556 Ga0068857_1000525562 187
161 3300005616 Ga0068852_100088751 Ga0068852_1000887513 187
162 3300005718 Ga0068866_10247029 Ga0068866_102470292 187
163 3300005719 Ga0068861_100082894 Ga0068861_1000828942 187
164 3300005834 Ga0068851_10000516 Ga0068851_100005168 187
165 3300005842 Ga0068858_100096837 Ga0068858_1000968372 187
166 3300005843 Ga0068860_100069796 Ga0068860_1000697963 187
167 3300005844 Ga0068862_100114630 Ga0068862_1001146303 187
168 3300005983 Ga0081540_1000976 Ga0081540_100097618 187
169 3300005983 Ga0081540_1001709 Ga0081540_100170911 187
170 3300005983 Ga0081540_1002909 Ga0081540_10029092 187
171 3300005983 Ga0081540_1003388 Ga0081540_100338813 187
172 3300005983 Ga0081540_1019795 Ga0081540_10197955 187
173 3300006028 Ga0070717_10066530 Ga0070717_100665303 187
174 3300006028 Ga0070717_10230357 Ga0070717_102303572 187
175 3300006175 Ga0070712_100027070 Ga0070712_1000270704 187
176 3300006195 Ga0075366_10118740 Ga0075366_101187403 187
177 3300007265 Ga0099794_10076391 Ga0099794_100763913 187
178 3300007265 Ga0099794_10081418 Ga0099794_100814182 187
179 3300007788 Ga0099795_10025782 Ga0099795_100257824 187
180 3300007788 Ga0099795_10045556 Ga0099795_100455562 187
181 3300009092 Ga0105250_10009427 Ga0105250_100094273 187
182 3300009093 Ga0105240_10004989 Ga0105240_1000498912 187
183 3300009545 Ga0105237_10004248 Ga0105237_100042489 187
184 3300009551 Ga0105238_10005783 Ga0105238_100057835 187
185 3300009553 Ga0105249_10024773 Ga0105249_100247734 187
186 3300010159 Ga0099796_10031950 Ga0099796_100319502 187
187 3300010159 Ga0099796_10035727 Ga0099796_100357273 187
188 3300010375 Ga0105239_10004627 Ga0105239_100046278 187
189 3300010375 Ga0105239_10027657 Ga0105239_100276574 187
190 3300013104 Ga0157370_10090102 Ga0157370_100901022 187
191 3300013105 Ga0157369_10003609 Ga0157369_1000360913 187
192 3300013306 Ga0163162_10356306 Ga0163162_103563062 187
193 3300013307 Ga0157372_10410616 Ga0157372_104106162 187
194 3300014325 Ga0163163_10030350 Ga0163163_100303504 187
195 3300017792 Ga0163161_10600088 Ga0163161_106000882 187
196 3300021361 Ga0213872_10047793 Ga0213872_100477932 187
197 3300025321 Ga0207656_10001070 Ga0207656_100010705 187
198 3300025899 Ga0207642_10119974 Ga0207642_101199742 187
199 3300025906 Ga0207699_10165613 Ga0207699_101656132 187
200 3300025906 Ga0207699_10302965 Ga0207699_103029652 187
201 3300025909 Ga0207705_10058486 Ga0207705_100584862 187
202 3300025912 Ga0207707_10002412 Ga0207707_100024122 187
203 3300025913 Ga0207695_10179999 Ga0207695_101799992 187
204 3300025914 Ga0207671_10056465 Ga0207671_100564656 187
205 3300025915 Ga0207693_10021537 Ga0207693_100215374 187
206 3300025915 Ga0207693_10061811 Ga0207693_100618113 187
207 3300025917 Ga0207660_10001368 Ga0207660_100013686 187
208 3300025920 Ga0207649_10106145 Ga0207649_101061452 187
209 3300025921 Ga0207652_10019423 Ga0207652_100194234 187
210 3300025921 Ga0207652_10235343 Ga0207652_102353432 187
211 3300025923 Ga0207681_10018603 Ga0207681_100186034 187
212 3300025924 Ga0207694_10017191 Ga0207694_100171916 187
213 3300025925 Ga0207650_10962521 Ga0207650_109625212 187
214 3300025928 Ga0207700_10004190 Ga0207700_100041907 187
215 3300025933 Ga0207706_10011510 Ga0207706_100115103 187
216 3300025935 Ga0207709_10043796 Ga0207709_100437961 187
217 3300025942 Ga0207689_10000572 Ga0207689_1000057218 187
218 3300025944 Ga0207661_10000611 Ga0207661_1000061116 187
219 3300025944 Ga0207661_10017797 Ga0207661_100177976 187
220 3300025949 Ga0207667_10044592 Ga0207667_100445923 187
221 3300025949 Ga0207667_10714613 Ga0207667_107146131 187
222 3300025961 Ga0207712_10011646 Ga0207712_100116466 187
223 3300025972 Ga0207668_10001282 Ga0207668_1000128214 187
224 3300026023 Ga0207677_10085133 Ga0207677_100851331 187
225 3300026035 Ga0207703_10331140 Ga0207703_103311402 187
226 3300026041 Ga0207639_10003682 Ga0207639_100036825 187
227 3300026075 Ga0207708_10156220 Ga0207708_101562202 187
228 3300026116 Ga0207674_10018041 Ga0207674_100180415 187
229 3300026118 Ga0207675_100008342 Ga0207675_1000083424 187
230 3300026142 Ga0207698_10057282 Ga0207698_100572823 187
231 3300027671 Ga0209588_1099973 Ga0209588_10999731 187
232 3300028380 Ga0268265_10001129 Ga0268265_1000112910 187
233 3300028381 Ga0268264_10014546 Ga0268264_100145467 187
234 3300028573 Ga0265334_10044862 Ga0265334_100448621 187
235 3300028786 Ga0307517_10152224 Ga0307517_101522242 187
236 3300031235 Ga0265330_10008602 Ga0265330_100086022 187
237 3300031235 Ga0265330_10035500 Ga0265330_100355003 187
238 3300031238 Ga0265332_10010183 Ga0265332_100101833 187
239 3300031241 Ga0265325_10014082 Ga0265325_100140824 187
240 3300031247 Ga0265340_10022224 Ga0265340_100222243 187
241 3300031249 Ga0265339_10049920 Ga0265339_100499202 187
242 3300031344 Ga0265316_10068584 Ga0265316_100685842 187
243 3300031344 Ga0265316_10402158 Ga0265316_104021582 187
244 3300031456 Ga0307513_10120897 Ga0307513_101208973 187
245 3300031456 Ga0307513_10360298 Ga0307513_103602982 187
246 3300031507 Ga0307509_10337971 Ga0307509_103379712 187
247 3300031595 Ga0265313_10040437 Ga0265313_100404372 187
248 3300031712 Ga0265342_10006981 Ga0265342_100069813 187
249 3300035116 Ga0373945_0171221 Ga0373945_0171221_163_726 187
250 3300035695 Ga0373927_0143644 Ga0373927_0143644_367_942 187
251 3300035695 Ga0373927_0265863 Ga0373927_0265863_370_933 187
252 3300041443 Ga0451789_0436801 Ga0451789_0436801_233_796 187
253 3300046460 Ga0495638_0295176 Ga0495638_0295176_155_718 187
254 3300046491 Ga0495584_0039456 Ga0495584_0039456_1346_1909 187
255 3300046506 Ga0495583_0242115 Ga0495583_0242115_38_601 187
256 3300046518 Ga0495631_0159053 Ga0495631_0159053_180_743 187
257 3300046524 Ga0495648_0000822 Ga0495648_0000822_25484_26047 187
258 3300046524 Ga0495648_0258389 Ga0495648_0258389_51_614 187
259 3300046664 Ga0495659_0026560 Ga0495659_0026560_561_1124 187
260 3300046665 Ga0495661_0209803 Ga0495661_0209803_203_766 187
261 3300046692 Ga0495671_0109167 Ga0495671_0109167_532_1095 187
262 3300047315 Ga0495581_0370911 Ga0495581_0370911_139_705 187
263 3300047447 Ga0495685_025800 Ga0495685_025800_73_636 187
264 3300048903 Ga0496100_0064401 Ga0496100_0064401_35_601 187
265 3300048904 Ga0496101_0610648 Ga0496101_0610648_232_807 187
266 3300048905 Ga0496102_0140305 Ga0496102_0140305_1520_2086 187
267 3300048907 Ga0496104_0014904 Ga0496104_0014904_5514_6080 187
268 3300048908 Ga0496105_0023356 Ga0496105_0023356_610_1176 187
269 3300048911 Ga0496108_0004452 Ga0496108_0004452_601_1167 187
270 3300048911 Ga0496108_0637737 Ga0496108_0637737_293_868 187
271 3300048912 Ga0496109_0027022 Ga0496109_0027022_2252_2818 187
272 3300048913 Ga0496110_0001209 Ga0496110_0001209_8686_9252 187
273 3300048914 Ga0496111_0011097 Ga0496111_0011097_745_1311 187
274 3300048915 Ga0496112_0071075 Ga0496112_0071075_444_1010 187
275 3300048916 Ga0496113_0002811 Ga0496113_0002811_1508_2074 187
276 3300048917 Ga0496114_0381133 Ga0496114_0381133_547_1113 187
277 3300048918 Ga0496115_0069314 Ga0496115_0069314_1522_2088 187
278 3300049460 Ga0495682_0088539 Ga0495682_0088539_527_1090 187
279 3300053134 Ga0500658_0119671 Ga0500658_0119671_428_991 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

60

145

0.88

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

58

141

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xts-assembly1.cif.gz_B crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus 0.6137 29 187
2c8s-assembly1.cif.gz_A cytochrome cl from methylobacterium extorquens 0.6107 60 144
4wqd-assembly1.cif.gz_A thiosulfate dehydrogenase (tsda) from allochromatium vinosum - k208g mutant 0.599 59 143
4wq7-assembly1.cif.gz_A "thiosulfate dehydrogenase (tsda) from allochromatium vinosum - ""as isolated"" form" 0.5987 59 143
5lo9-assembly1.cif.gz_A "thiosulfate dehydrogenase (tsdba) from marichromatium purpuratum - ""as isolated"" form" 0.5964 59 141
ID Description Score Start End Superfamily
2xtsD01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6992 35 170 1.10.760.10
2xtsD01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6905 35 170 1.10.760.10
af_P9WP35_148_241_1.10.760.10 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6321 59 146 1.10.760.10
2c8sA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6107 60 144 1.10.760.10
1mg2H00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6094 60 144 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A6N8LVX5-F1-model_v4 C-type cytochrome 0.7162 47 172 GO:0009055
GO:0020037
GO:0046872
AF-A0A2E8E3H5-F1-model_v4 Cytochrome c domain-containing protein 0.7132 47 175 GO:0009055
GO:0020037
GO:0046872
AF-A0A2D7GEF4-F1-model_v4 Cytochrome C 0.7071 46 174 GO:0009055
GO:0020037
GO:0046872
AF-A0A382K3I9-F1-model_v4 Cytochrome c domain-containing protein 0.7029 53 172 GO:0009055
GO:0020037
GO:0046872
AF-A0A2E3ZVD0-F1-model_v4 Cytochrome C 0.6996 46 174 GO:0009055
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
63.24 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map