F383181

General Info

Members Datasets Scaffolds Average Seq Length
279 185 274 410

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0048521|Ga0373937_0048521_1978_3354
Length 458
Sequence LRVAKPNGTLAPLEAPTASSRSQHARRSLAAGIGRRQGRTRGHDTVTQLLFRNARVFDGVSDECRDGMFVRVADGLIQEISAKPISAPDAQAIDVGGRTLMPGMIDAHLHAYASDVSVQKVEAVGDAYRTAHAVRMLGHALDCGFTSVRDIGGGDYSLAKAITDGLVRAPRFFYAGKMLSMTGGHGDFRQIEERPHHHTLCSCGNVNAFCTIADGVDACIRATREELRQGAHCIKIMGSGGVASPTDPIWMNQYREDEIRAIVNECSERRTYVAAHCHPASAVRRCVEYGVRSIEHGTLIDDETSRFVAARGAYIVPTMAVIFALVEIGRKLGFPPQSQEKAEYAFTQAVSGMDSMRRAGVKVGFGTDLLGSTYVRQCREFTLRSEVFAPLEILRQATSVSAELMMMQGKLGCIAPGAFADLLVVDGDPTRDISLLAADGGNLRAIVRAGELVKNELR

Samples

Sample ID Description Type Environment
1 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
2 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
3 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
4 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
125 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
126 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
141 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
180 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
181 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
182 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
183 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
184 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
185 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 0
Isolates 1.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.66
Nodule 0
Rhizoplane 2.51
Rhizosphere 79.57
Stem 0
Stem Tuber 0
Unclassified 13.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001543 3300003203 Bacteria 10884
2 Ga0055536_1002256 3300003781 Bacteria 10974
3 Ga0065714_10090881 3300005288 Bacteria 1929
4 Ga0070676_10012223 3300005328 Bacteria 4683
5 Ga0070690_100028167 3300005330 Bacteria 3478
6 Ga0070670_100017303 3300005331 Bacteria 6183
7 Ga0070677_10026269 3300005333 Bacteria 2182
8 Ga0070668_100122611 3300005347 Bacteria 2079
9 Ga0070668_100128610 3300005347 Bacteria 2031
10 Ga0070669_100015586 3300005353 Bacteria 5420
11 Ga0070669_100201644 3300005353 Bacteria 1566
12 Ga0070675_100001886 3300005354 Bacteria 15476
13 Ga0070675_100072837 3300005354 Bacteria 2852
14 Ga0070671_100001351 3300005355 Bacteria 18370
15 Ga0070667_100000068 3300005367 Bacteria 127663
16 Ga0070667_100000165 3300005367 Bacteria 82440
17 Ga0070667_100010474 3300005367 Bacteria 7656
18 Ga0070667_100030485 3300005367 Bacteria 4498
19 Ga0070708_100013061 3300005445 Bacteria 6789
20 Ga0070708_100113437 3300005445 Bacteria 2493
21 Ga0070662_100006991 3300005457 Bacteria 7301
22 Ga0070681_10019763 3300005458 Bacteria 6746
23 Ga0070681_10355594 3300005458 Bacteria 1375
24 Ga0068867_100000460 3300005459 Bacteria 27029
25 Ga0068867_100007244 3300005459 Bacteria 7843
26 Ga0070685_10014391 3300005466 Bacteria 4191
27 Ga0070706_100019662 3300005467 Bacteria 6228
28 Ga0070706_100129024 3300005467 Bacteria 2359
29 Ga0070707_100008188 3300005468 Bacteria 9700
30 Ga0070707_100281838 3300005468 Bacteria 1615
31 Ga0070698_100011980 3300005471 Bacteria 9199
32 Ga0070699_100006087 3300005518 Bacteria 10556
33 Ga0070699_100050930 3300005518 Bacteria 3585
34 Ga0070679_100103884 3300005530 Unclassified 2828
35 Ga0070697_100003628 3300005536 Bacteria 11856
36 Ga0070697_100009923 3300005536 Bacteria 7427
37 Ga0068853_100018167 3300005539 Bacteria 5817
38 Ga0068853_100077577 3300005539 Bacteria 2902
39 Ga0070672_100021537 3300005543 Bacteria 4720
40 Ga0070696_100016640 3300005546 Bacteria 4957
41 Ga0070693_100004471 3300005547 Bacteria 6617
42 Ga0070665_100006655 3300005548 Bacteria 11750
43 Ga0070665_100134879 3300005548 Bacteria 2471
44 Ga0070664_100014935 3300005564 Bacteria 6336
45 Ga0068856_100100919 3300005614 Bacteria 2879
46 Ga0068859_100000476 3300005617 Bacteria 39536
47 Ga0068863_100002855 3300005841 Bacteria 17116
48 Ga0068858_100000819 3300005842 Bacteria 32468
49 Ga0068858_100023436 3300005842 Bacteria 5750
50 Ga0068858_100120750 3300005842 Bacteria 2450
51 Ga0068860_100000315 3300005843 Bacteria 66160
52 Ga0068860_100005511 3300005843 Bacteria 12812
53 Ga0081539_10000248 3300005985 Bacteria 125908
54 Ga0068871_100052341 3300006358 Bacteria 3306
55 Ga0075428_100166340 3300006844 Bacteria 2392
56 Ga0075428_100222245 3300006844 Bacteria 2039
57 Ga0075430_100007875 3300006846 Bacteria 9006
58 Ga0075433_10032087 3300006852 Bacteria 4496
59 Ga0075434_100015412 3300006871 Bacteria 7327
60 Ga0075429_100022103 3300006880 Bacteria 5516
61 Ga0068865_100249157 3300006881 Bacteria 1401
62 Ga0075436_100000068 3300006914 Bacteria 62600
63 Ga0075436_100008559 3300006914 Bacteria 6992
64 Ga0075436_100118402 3300006914 Bacteria 1852
65 Ga0097620_100000476 3300006931 Bacteria 39536
66 Ga0075435_100000647 3300007076 Bacteria 21451
67 Ga0105240_10016398 3300009093 Bacteria 10031
68 Ga0105240_10019338 3300009093 Bacteria 9102
69 Ga0105240_10022393 3300009093 Bacteria 8376
70 Ga0105240_10030302 3300009093 Bacteria 7031
71 Ga0105240_10047315 3300009093 Bacteria 5444
72 Ga0105240_10056063 3300009093 Bacteria 4932
73 Ga0105240_10074366 3300009093 Bacteria 4194
74 Ga0111539_10001985 3300009094 Bacteria 27299
75 Ga0111539_10016302 3300009094 Bacteria 9214
76 Ga0105247_10000962 3300009101 Bacteria 21737
77 Ga0105247_10004772 3300009101 Bacteria 8634
78 Ga0114129_10002704 3300009147 Bacteria 24696
79 Ga0105241_10029723 3300009174 Bacteria 4079
80 Ga0105241_10187850 3300009174 Bacteria 1718
81 Ga0105242_10089895 3300009176 Bacteria 2582
82 Ga0105242_10151926 3300009176 Bacteria 2020
83 Ga0105237_10019714 3300009545 Bacteria 6963
84 Ga0105237_10069700 3300009545 Bacteria 3512
85 Ga0105237_10172029 3300009545 Bacteria 2166
86 Ga0105238_10007748 3300009551 Bacteria 10739
87 Ga0105239_10003836 3300010375 Bacteria 18255
88 Ga0157374_10335444 3300013296 Bacteria 1500
89 Ga0157378_10046927 3300013297 Bacteria 3840
90 Ga0163162_10005886 3300013306 Bacteria 11864
91 Ga0163162_10467457 3300013306 Bacteria 1393
92 Ga0157375_10140956 3300013308 Bacteria 2538
93 Ga0157375_10440057 3300013308 Bacteria 1469
94 Ga0163163_10028259 3300014325 Bacteria 5383
95 Ga0157380_10002248 3300014326 Bacteria 12988
96 Ga0157380_10016519 3300014326 Bacteria 5444
97 Ga0157377_10129937 3300014745 Bacteria 1537
98 Ga0157379_10003751 3300014968 Bacteria 12927
99 Ga0157379_10063447 3300014968 Bacteria 3303
100 Ga0157379_10154134 3300014968 Bacteria 2072
101 Ga0157376_10016326 3300014969 Bacteria 5634
102 Ga0209677_100462 3300025253 Bacteria 23426
103 Ga0209676_1000298 3300025292 Bacteria 100554
104 Ga0207682_10027957 3300025893 Bacteria 2248
105 Ga0207710_10001428 3300025900 Bacteria 11947
106 Ga0207680_10057213 3300025903 Unclassified 2359
107 Ga0207680_10068902 3300025903 Bacteria 2184
108 Ga0207647_10099583 3300025904 Bacteria 1726
109 Ga0207645_10013569 3300025907 Bacteria 5487
110 Ga0207684_10009918 3300025910 Bacteria 8396
111 Ga0207707_10028366 3300025912 Unclassified 4893
112 Ga0207695_10067682 3300025913 Unclassified 3662
113 Ga0207695_10072708 3300025913 Bacteria 3507
114 Ga0207695_10090027 3300025913 Bacteria 3084
115 Ga0207695_10127520 3300025913 Bacteria 2505
116 Ga0207695_10320660 3300025913 Bacteria 1439
117 Ga0207671_10015209 3300025914 Bacteria 6041
118 Ga0207660_10049406 3300025917 Unclassified 2982
119 Ga0207662_10096153 3300025918 Bacteria 1829
120 Ga0207646_10008553 3300025922 Bacteria 10238
121 Ga0207646_10011043 3300025922 Bacteria 8769
122 Ga0207681_10090758 3300025923 Bacteria 2181
123 Ga0207694_10016117 3300025924 Bacteria 5639
124 Ga0207650_10010119 3300025925 Bacteria 6462
125 Ga0207650_10072186 3300025925 Bacteria 2598
126 Ga0207687_10019782 3300025927 Bacteria 4464
127 Ga0207644_10003296 3300025931 Bacteria 10435
128 Ga0207706_10003115 3300025933 Bacteria 15956
129 Ga0207670_10103877 3300025936 Bacteria 2034
130 Ga0207689_10196635 3300025942 Bacteria 1664
131 Ga0207679_10086217 3300025945 Bacteria 2414
132 Ga0207651_10138516 3300025960 Bacteria 1876
133 Ga0207640_10140644 3300025981 Bacteria 1759
134 Ga0207658_10000715 3300025986 Bacteria 28718
135 Ga0207703_10000220 3300026035 Bacteria 66005
136 Ga0207703_10001255 3300026035 Bacteria 23763
137 Ga0207703_10063232 3300026035 Bacteria 3034
138 Ga0207703_10101943 3300026035 Bacteria 2435
139 Ga0207703_10170084 3300026035 Bacteria 1916
140 Ga0207639_10056012 3300026041 Bacteria 3020
141 Ga0207639_10058647 3300026041 Bacteria 2962
142 Ga0207702_10037942 3300026078 Bacteria 4035
143 Ga0207641_10000435 3300026088 Bacteria 47932
144 Ga0207648_10000978 3300026089 Bacteria 32225
145 Ga0207648_10002258 3300026089 Bacteria 20845
146 Ga0207648_10070544 3300026089 Bacteria 3046
147 Ga0207676_10064136 3300026095 Bacteria 2920
148 Ga0207675_100015784 3300026118 Bacteria 7042
149 Ga0209966_1004298 3300027695 Bacteria 2413
150 Ga0207428_10033007 3300027907 Bacteria 4254
151 Ga0268264_10000025 3300028381 Bacteria 468619
152 Ga0268264_10000081 3300028381 Bacteria 248362
153 Ga0268264_10000316 3300028381 Bacteria 77190
154 Ga0307515_10089612 3300028794 Bacteria 3870
155 Ga0265338_10083859 3300028800 Bacteria 2664
156 Ga0307511_10000541 3300030521 Bacteria 40505
157 Ga0265316_10143223 3300031344 Bacteria 1794
158 Ga0307408_100108363 3300031548 Bacteria 2129
159 Ga0265314_10005083 3300031711 Bacteria 11986
160 Ga0307516_10000928 3300031730 Bacteria 40334
161 Ga0307410_10024577 3300031852 Bacteria 3766
162 Ga0307412_10001870 3300031911 Bacteria 11644
163 Ga0307412_10008011 3300031911 Bacteria 6026
164 Ga0307412_10008937 3300031911 Bacteria 5738
165 Ga0307409_100009041 3300031995 Bacteria 6095
166 Ga0307409_100009248 3300031995 Bacteria 6042
167 Ga0307416_100054496 3300032002 Bacteria 3215
168 Ga0307414_10001781 3300032004 Bacteria 11157
169 Ga0373924_0036178 3300035410 Bacteria 2005
170 Ga0373927_0010151 3300035695 Bacteria 6296
171 Ga0373937_0007839 3300036401 Bacteria 9255
172 Ga0373937_0048521 3300036401 Bacteria 3887
173 Ga0373925_0127154 3300037068 Bacteria 1984
174 Ga0395900_0011246 3300037418 Bacteria 9152
175 Ga0395900_0031108 3300037418 Bacteria 5483
176 Ga0395900_0050313 3300037418 Bacteria 4292
177 Ga0395898_0017795 3300037466 Bacteria 7251
178 Ga0395905_0000895 3300037471 Bacteria 38905
179 Ga0395905_0155957 3300037471 Bacteria 2147
180 Ga0395905_0181430 3300037471 Bacteria 1976
181 Ga0395901_0034433 3300038443 Bacteria 5231
182 Ga0237819_00210 3300038705 Bacteria 21348
183 Ga0237819_01166 3300038705 Bacteria 7470
184 Ga0436360_1221613 3300039438 Bacteria 4722
185 Ga0439441_003105 3300042001 Bacteria 2413
186 Ga0451577_0069554 3300042876 Bacteria 3139
187 Ga0466971_0015821 3300044719 Bacteria 3323
188 Ga0451576_0301337 3300045051 Bacteria 1676
189 Ga0495592_0025550 3300046454 Bacteria 4483
190 Ga0495653_0088943 3300046463 Bacteria 2264
191 Ga0495583_0000405 3300046506 Bacteria 65435
192 Ga0495608_0036639 3300046511 Bacteria 3302
193 Ga0495628_0016291 3300046516 Bacteria 6202
194 Ga0495632_0073955 3300046519 Bacteria 1633
195 Ga0495587_0023853 3300046536 Bacteria 3756
196 Ga0495667_0196047 3300046559 Bacteria 1293
197 Ga0495625_0000060 3300046660 Bacteria 179425
198 Ga0495635_0062602 3300046663 Bacteria 2555
199 Ga0495599_0019249 3300046678 Bacteria 4256
200 Ga0495670_0014302 3300046691 Bacteria 3903
201 Ga0495600_0000241 3300046809 Bacteria 30022
202 Ga0495672_0019305 3300047320 Bacteria 4500
203 Ga0495677_0020656 3300047445 Bacteria 2387
204 Ga0495684_0160973 3300047471 Bacteria 1674
205 Ga0496102_0003227 3300048905 Bacteria 13833
206 Ga0496102_0023155 3300048905 Bacteria 5513
207 Ga0496103_0009195 3300048906 Bacteria 5853
208 Ga0496104_0016703 3300048907 Bacteria 6671
209 Ga0496105_0016292 3300048908 Bacteria 5932
210 Ga0496114_0026397 3300048917 Bacteria 4755
211 Ga0496115_0128468 3300048918 Bacteria 2088
212 Ga0496116_0003439 3300048919 Bacteria 15649
213 Ga0496116_0024899 3300048919 Bacteria 4413
214 Ga0496116_0045216 3300048919 Bacteria 2983
215 Ga0496117_0000012 3300048920 Bacteria 608530
216 Ga0496117_0000054 3300048920 Bacteria 278013
217 Ga0496117_0000195 3300048920 Bacteria 123331
218 Ga0496118_0000016 3300048921 Bacteria 549586
219 Ga0496118_0000045 3300048921 Bacteria 275165
220 Ga0496118_0000051 3300048921 Bacteria 241198
221 Ga0496119_0000944 3300048922 Bacteria 37444
222 Ga0496119_0001762 3300048922 Bacteria 25219
223 Ga0496119_0016203 3300048922 Bacteria 5692
224 Ga0496120_0000762 3300048923 Bacteria 46568
225 Ga0496120_0062096 3300048923 Bacteria 2082
226 Ga0496121_0002810 3300048924 Bacteria 25743
227 Ga0496121_0039375 3300048924 Bacteria 4167
228 Ga0496121_0046870 3300048924 Bacteria 3694
229 Ga0496121_0103000 3300048924 Bacteria 2197
230 Ga0496124_0012182 3300048927 Bacteria 8511
231 Ga0496124_0043038 3300048927 Bacteria 3883
232 Ga0496125_0000820 3300048928 Bacteria 50458
233 Ga0496125_0005713 3300048928 Bacteria 13710
234 Ga0496125_0098823 3300048928 Bacteria 2158
235 Ga0496126_0029170 3300048929 Bacteria 5243
236 Ga0496126_0048956 3300048929 Bacteria 3859
237 Ga0496126_0064940 3300048929 Unclassified 3268
238 Ga0496126_0130652 3300048929 Bacteria 2170
239 Ga0496126_0247013 3300048929 Bacteria 1488
240 Ga0501032_0020461 3300049569 Bacteria 4608
241 Ga0501034_0203861 3300049571 Bacteria 1935
242 Ga0501043_0003150 3300049579 Bacteria 13653
243 Ga0501043_0031064 3300049579 Bacteria 4200
244 Ga0501046_0067470 3300049580 Bacteria 2786
245 Ga0501047_0000484 3300049581 Bacteria 43262
246 Ga0501047_0056952 3300049581 Bacteria 3780
247 Ga0501069_0011619 3300049585 Bacteria 4667
248 Ga0501070_0088926 3300049586 Bacteria 2556
249 Ga0501080_0057433 3300049742 Bacteria 3623
250 Ga0501080_0375880 3300049742 Bacteria 1281
251 Ga0501035_0120131 3300049822 Bacteria 2298
252 Ga0501044_0088046 3300049823 Bacteria 3135
253 nmdc:mga05p37_135665_c1 3300050507 Bacteria 3018
254 nmdc:mga09592_54070_c1 3300050508 Bacteria 3392
255 nmdc:mga08y16_2513_c1 3300050511 Bacteria 18845
256 nmdc:mga08y16_93178_c1 3300050511 Bacteria 3139
257 nmdc:mga0n895_13659_c1 3300050512 Bacteria 7341
258 nmdc:mga0n895_176070_c1 3300050512 Bacteria 2170
259 nmdc:mga0rr50_44879_c1 3300050513 Bacteria 3245
260 nmdc:mga08x19_1172_c1 3300050514 Bacteria 16431
261 nmdc:mga08x19_3713_c1 3300050514 Bacteria 9093
262 nmdc:mga0a205_17861_c1 3300050515 Bacteria 6657
263 nmdc:mga0a205_34803_c2 3300050515 Bacteria 1460
264 Ga0495601_0021945 3300053077 Bacteria 3916
265 Ga0500643_007234 3300053087 Bacteria 4517
266 Ga0500643_018637 3300053087 Bacteria 2299
267 Ga0500643_023113 3300053087 Bacteria 1990
268 Ga0500583_0066905 3300053092 Unclassified 1711
269 Ga0500641_0118660 3300053096 Unclassified 1140
270 Ga0500556_0002293 3300053104 Bacteria 6306
271 Ga0500556_0002412 3300053104 Bacteria 6020
272 Ga0500595_001456 3300053119 Bacteria 12617
273 Ga0500622_0002109 3300053156 Bacteria 14815
274 Ga0500622_0012878 3300053156 Bacteria 4519

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053096 Ga0500641_0118660 Ga0500641_0118660_19_1047 339
2 3300046678 Ga0495599_0019249 Ga0495599_0019249_19_1068 346
3 3300048929 Ga0496126_0247013 Ga0496126_0247013_350_1426 355
4 3300031995 Ga0307409_100009248 Ga0307409_1000092482 367
5 3300032002 Ga0307416_100054496 Ga0307416_1000544962 367
6 3300035410 Ga0373924_0036178 Ga0373924_0036178_355_1596 372
7 3300031911 Ga0307412_10008011 Ga0307412_100080111 376
8 3300014326 Ga0157380_10016519 Ga0157380_100165194 383
9 3300049571 Ga0501034_0203861 Ga0501034_0203861_752_1915 384
10 3300053087 Ga0500643_007234 Ga0500643_007234_3210_4445 384
11 3300046559 Ga0495667_0196047 Ga0495667_0196047_41_1213 387
12 3300009101 Ga0105247_10000962 Ga0105247_100009625 388
13 3300047445 Ga0495677_0020656 Ga0495677_0020656_191_1429 392
14 3300013308 Ga0157375_10440057 Ga0157375_104400571 394
15 3300026095 Ga0207676_10064136 Ga0207676_100641362 394
16 3300005355 Ga0070671_100001351 Ga0070671_1000013515 395
17 3300009093 Ga0105240_10056063 Ga0105240_100560632 395
18 3300014968 Ga0157379_10154134 Ga0157379_101541342 395
19 3300025931 Ga0207644_10003296 Ga0207644_100032963 395
20 3300053087 Ga0500643_023113 Ga0500643_023113_599_1849 396
21 3300025253 Ga0209677_100462 Ga0209677_1004628 399
22 3300025922 Ga0207646_10011043 Ga0207646_100110434 399
23 3300038705 Ga0237819_00210 Ga0237819_00210_19536_20765 400
24 3300003781 Ga0055536_1002256 Ga0055536_10022562 402
25 3300009176 Ga0105242_10151926 Ga0105242_101519262 402
26 3300025292 Ga0209676_1000298 Ga0209676_10002983 402
27 3300039438 Ga0436360_1221613 Ga0436360_1221613_1712_2923 402
28 3300044719 Ga0466971_0015821 Ga0466971_0015821_365_1633 402
29 3300046660 Ga0495625_0000060 Ga0495625_0000060_35802_37043 402
30 3300053087 Ga0500643_018637 Ga0500643_018637_73_1365 402
31 iso_pu_bacteria 2643221541 2643731167 403
32 iso_pu_bacteria 2643221606 2644045327 403
33 iso_pu_bacteria 2643221671 2644391896 403
34 3300005331 Ga0070670_100017303 Ga0070670_1000173035 404
35 3300005564 Ga0070664_100014935 Ga0070664_1000149354 404
36 3300009093 Ga0105240_10019338 Ga0105240_100193382 404
37 3300025925 Ga0207650_10010119 Ga0207650_100101195 404
38 3300025945 Ga0207679_10086217 Ga0207679_100862173 404
39 3300005367 Ga0070667_100000068 Ga0070667_10000006823 405
40 3300005459 Ga0068867_100000460 Ga0068867_10000046011 405
41 3300005467 Ga0070706_100129024 Ga0070706_1001290242 405
42 3300025903 Ga0207680_10057213 Ga0207680_100572132 405
43 3300025986 Ga0207658_10000715 Ga0207658_100007155 405
44 3300026089 Ga0207648_10002258 Ga0207648_1000225810 405
45 iso_pu_bacteria 8057101203 8057104093 405
46 3300005354 Ga0070675_100072837 Ga0070675_1000728372 406
47 3300005445 Ga0070708_100013061 Ga0070708_1000130613 406
48 3300005467 Ga0070706_100019662 Ga0070706_1000196624 406
49 3300005468 Ga0070707_100008188 Ga0070707_1000081887 406
50 3300005471 Ga0070698_100011980 Ga0070698_1000119805 406
51 3300005518 Ga0070699_100006087 Ga0070699_1000060876 406
52 3300005536 Ga0070697_100003628 Ga0070697_1000036286 406
53 3300006852 Ga0075433_10032087 Ga0075433_100320873 406
54 3300006871 Ga0075434_100015412 Ga0075434_1000154125 406
55 3300006914 Ga0075436_100000068 Ga0075436_10000006851 406
56 3300007076 Ga0075435_100000647 Ga0075435_1000006472 406
57 3300009147 Ga0114129_10002704 Ga0114129_100027047 406
58 3300013297 Ga0157378_10046927 Ga0157378_100469272 406
59 3300025910 Ga0207684_10009918 Ga0207684_100099184 406
60 3300025922 Ga0207646_10008553 Ga0207646_100085537 406
61 3300027695 Ga0209966_1004298 Ga0209966_10042982 406
62 3300050507 nmdc:mga05p37_135665_c1 nmdc:mga05p37_135665_c1_1005_2225 406
63 3300050512 nmdc:mga0n895_13659_c1 nmdc:mga0n895_13659_c1_1148_2368 406
64 3300050513 nmdc:mga0rr50_44879_c1 nmdc:mga0rr50_44879_c1_878_2098 406
65 3300050514 nmdc:mga08x19_1172_c1 nmdc:mga08x19_1172_c1_13420_14640 406
66 3300050515 nmdc:mga0a205_17861_c1 nmdc:mga0a205_17861_c1_464_1684 406
67 iso_pu_bacteria 2751185897 2753767700 406
68 3300005328 Ga0070676_10012223 Ga0070676_100122233 407
69 3300005333 Ga0070677_10026269 Ga0070677_100262692 407
70 3300005347 Ga0070668_100122611 Ga0070668_1001226112 407
71 3300005353 Ga0070669_100015586 Ga0070669_1000155862 407
72 3300005445 Ga0070708_100113437 Ga0070708_1001134373 407
73 3300005457 Ga0070662_100006991 Ga0070662_1000069915 407
74 3300005459 Ga0068867_100007244 Ga0068867_1000072444 407
75 3300005543 Ga0070672_100021537 Ga0070672_1000215374 407
76 3300006844 Ga0075428_100166340 Ga0075428_1001663404 407
77 3300006846 Ga0075430_100007875 Ga0075430_1000078757 407
78 3300006880 Ga0075429_100022103 Ga0075429_1000221034 407
79 3300006881 Ga0068865_100249157 Ga0068865_1002491572 407
80 3300009094 Ga0111539_10001985 Ga0111539_1000198513 407
81 3300009094 Ga0111539_10016302 Ga0111539_100163024 407
82 3300014326 Ga0157380_10002248 Ga0157380_100022487 407
83 3300025893 Ga0207682_10027957 Ga0207682_100279572 407
84 3300025907 Ga0207645_10013569 Ga0207645_100135694 407
85 3300025923 Ga0207681_10090758 Ga0207681_100907582 407
86 3300025933 Ga0207706_10003115 Ga0207706_100031153 407
87 3300026089 Ga0207648_10000978 Ga0207648_1000097821 407
88 3300026118 Ga0207675_100015784 Ga0207675_1000157847 407
89 3300027907 Ga0207428_10033007 Ga0207428_100330074 407
90 3300031548 Ga0307408_100108363 Ga0307408_1001083632 407
91 3300032004 Ga0307414_10001781 Ga0307414_100017817 407
92 3300038705 Ga0237819_01166 Ga0237819_01166_402_1628 407
93 3300042001 Ga0439441_003105 Ga0439441_003105_588_1850 407
94 3300046506 Ga0495583_0000405 Ga0495583_0000405_21362_22594 407
95 3300046809 Ga0495600_0000241 Ga0495600_0000241_8433_9665 407
96 3300048907 Ga0496104_0016703 Ga0496104_0016703_116_1348 407
97 3300048908 Ga0496105_0016292 Ga0496105_0016292_2090_3322 407
98 3300048917 Ga0496114_0026397 Ga0496114_0026397_1432_2664 407
99 3300048918 Ga0496115_0128468 Ga0496115_0128468_124_1356 407
100 3300050508 nmdc:mga09592_54070_c1 nmdc:mga09592_54070_c1_363_1613 407
101 3300050511 nmdc:mga08y16_2513_c1 nmdc:mga08y16_2513_c1_14031_15263 407
102 3300050511 nmdc:mga08y16_93178_c1 nmdc:mga08y16_93178_c1_120_1358 407
103 3300053119 Ga0500595_001456 Ga0500595_001456_7098_8330 407
104 3300005288 Ga0065714_10090881 Ga0065714_100908811 408
105 3300026035 Ga0207703_10063232 Ga0207703_100632321 408
106 3300046691 Ga0495670_0014302 Ga0495670_0014302_1009_2247 408
107 3300053092 Ga0500583_0066905 Ga0500583_0066905_272_1507 408
108 3300005330 Ga0070690_100028167 Ga0070690_1000281672 409
109 3300005353 Ga0070669_100201644 Ga0070669_1002016441 409
110 3300005354 Ga0070675_100001886 Ga0070675_1000018864 409
111 3300005367 Ga0070667_100010474 Ga0070667_1000104745 409
112 3300005466 Ga0070685_10014391 Ga0070685_100143914 409
113 3300005468 Ga0070707_100281838 Ga0070707_1002818381 409
114 3300005539 Ga0068853_100077577 Ga0068853_1000775772 409
115 3300005546 Ga0070696_100016640 Ga0070696_1000166402 409
116 3300005547 Ga0070693_100004471 Ga0070693_1000044718 409
117 3300005548 Ga0070665_100134879 Ga0070665_1001348792 409
118 3300005614 Ga0068856_100100919 Ga0068856_1001009192 409
119 3300005841 Ga0068863_100002855 Ga0068863_10000285511 409
120 3300005842 Ga0068858_100120750 Ga0068858_1001207502 409
121 3300005843 Ga0068860_100005511 Ga0068860_1000055112 409
122 3300006358 Ga0068871_100052341 Ga0068871_1000523411 409
123 3300006844 Ga0075428_100222245 Ga0075428_1002222452 409
124 3300006914 Ga0075436_100008559 Ga0075436_1000085593 409
125 3300009093 Ga0105240_10016398 Ga0105240_100163986 409
126 3300009093 Ga0105240_10074366 Ga0105240_100743662 409
127 3300009174 Ga0105241_10029723 Ga0105241_100297233 409
128 3300009174 Ga0105241_10187850 Ga0105241_101878501 409
129 3300009176 Ga0105242_10089895 Ga0105242_100898951 409
130 3300009545 Ga0105237_10019714 Ga0105237_100197143 409
131 3300009551 Ga0105238_10007748 Ga0105238_100077485 409
132 3300010375 Ga0105239_10003836 Ga0105239_100038366 409
133 3300013296 Ga0157374_10335444 Ga0157374_103354441 409
134 3300013306 Ga0163162_10005886 Ga0163162_100058869 409
135 3300013306 Ga0163162_10467457 Ga0163162_104674571 409
136 3300013308 Ga0157375_10140956 Ga0157375_101409562 409
137 3300014745 Ga0157377_10129937 Ga0157377_101299372 409
138 3300014968 Ga0157379_10003751 Ga0157379_100037514 409
139 3300014969 Ga0157376_10016326 Ga0157376_100163261 409
140 3300025904 Ga0207647_10099583 Ga0207647_100995832 409
141 3300025913 Ga0207695_10072708 Ga0207695_100727081 409
142 3300025914 Ga0207671_10015209 Ga0207671_100152092 409
143 3300025918 Ga0207662_10096153 Ga0207662_100961532 409
144 3300025924 Ga0207694_10016117 Ga0207694_100161175 409
145 3300025927 Ga0207687_10019782 Ga0207687_100197824 409
146 3300025936 Ga0207670_10103877 Ga0207670_101038773 409
147 3300025942 Ga0207689_10196635 Ga0207689_101966352 409
148 3300025960 Ga0207651_10138516 Ga0207651_101385162 409
149 3300025981 Ga0207640_10140644 Ga0207640_101406441 409
150 3300026035 Ga0207703_10001255 Ga0207703_100012552 409
151 3300026035 Ga0207703_10101943 Ga0207703_101019433 409
152 3300026041 Ga0207639_10056012 Ga0207639_100560122 409
153 3300026078 Ga0207702_10037942 Ga0207702_100379422 409
154 3300026088 Ga0207641_10000435 Ga0207641_1000043518 409
155 3300028381 Ga0268264_10000025 Ga0268264_10000025118 409
156 3300028381 Ga0268264_10000081 Ga0268264_10000081165 409
157 3300031852 Ga0307410_10024577 Ga0307410_100245772 409
158 3300031995 Ga0307409_100009041 Ga0307409_1000090415 409
159 3300036401 Ga0373937_0007839 Ga0373937_0007839_4051_5289 409
160 3300037471 Ga0395905_0000895 Ga0395905_0000895_9812_11068 409
161 3300042876 Ga0451577_0069554 Ga0451577_0069554_1567_2808 409
162 3300045051 Ga0451576_0301337 Ga0451576_0301337_32_1273 409
163 3300046454 Ga0495592_0025550 Ga0495592_0025550_538_1776 409
164 3300046463 Ga0495653_0088943 Ga0495653_0088943_105_1343 409
165 3300046511 Ga0495608_0036639 Ga0495608_0036639_1152_2390 409
166 3300046516 Ga0495628_0016291 Ga0495628_0016291_3885_5123 409
167 3300046519 Ga0495632_0073955 Ga0495632_0073955_131_1369 409
168 3300046536 Ga0495587_0023853 Ga0495587_0023853_1719_2957 409
169 3300046663 Ga0495635_0062602 Ga0495635_0062602_34_1272 409
170 3300047320 Ga0495672_0019305 Ga0495672_0019305_548_1789 409
171 3300047471 Ga0495684_0160973 Ga0495684_0160973_285_1523 409
172 3300048905 Ga0496102_0023155 Ga0496102_0023155_1717_2955 409
173 3300048906 Ga0496103_0009195 Ga0496103_0009195_1982_3220 409
174 3300048919 Ga0496116_0003439 Ga0496116_0003439_12140_13378 409
175 3300048920 Ga0496117_0000195 Ga0496117_0000195_83476_84714 409
176 3300048921 Ga0496118_0000016 Ga0496118_0000016_325763_327001 409
177 3300048922 Ga0496119_0016203 Ga0496119_0016203_2875_4113 409
178 3300048924 Ga0496121_0046870 Ga0496121_0046870_311_1549 409
179 3300048924 Ga0496121_0103000 Ga0496121_0103000_604_1842 409
180 3300048928 Ga0496125_0005713 Ga0496125_0005713_830_2068 409
181 3300048929 Ga0496126_0130652 Ga0496126_0130652_316_1554 409
182 3300049585 Ga0501069_0011619 Ga0501069_0011619_2608_3846 409
183 3300049586 Ga0501070_0088926 Ga0501070_0088926_246_1484 409
184 3300049742 Ga0501080_0375880 Ga0501080_0375880_17_1255 409
185 3300050512 nmdc:mga0n895_176070_c1 nmdc:mga0n895_176070_c1_75_1316 409
186 3300050514 nmdc:mga08x19_3713_c1 nmdc:mga08x19_3713_c1_4675_5916 409
187 3300053077 Ga0495601_0021945 Ga0495601_0021945_2659_3897 409
188 3300053156 Ga0500622_0012878 Ga0500622_0012878_3043_4284 409
189 3300005367 Ga0070667_100000165 Ga0070667_10000016521 410
190 3300005367 Ga0070667_100030485 Ga0070667_1000304853 410
191 3300005458 Ga0070681_10019763 Ga0070681_100197634 410
192 3300005458 Ga0070681_10355594 Ga0070681_103555941 410
193 3300005518 Ga0070699_100050930 Ga0070699_1000509304 410
194 3300005530 Ga0070679_100103884 Ga0070679_1001038842 410
195 3300005536 Ga0070697_100009923 Ga0070697_1000099232 410
196 3300005539 Ga0068853_100018167 Ga0068853_1000181673 410
197 3300005548 Ga0070665_100006655 Ga0070665_1000066558 410
198 3300005617 Ga0068859_100000476 Ga0068859_10000047622 410
199 3300005842 Ga0068858_100000819 Ga0068858_10000081911 410
200 3300005842 Ga0068858_100023436 Ga0068858_1000234362 410
201 3300005843 Ga0068860_100000315 Ga0068860_10000031537 410
202 3300006914 Ga0075436_100118402 Ga0075436_1001184022 410
203 3300006931 Ga0097620_100000476 Ga0097620_10000047622 410
204 3300009093 Ga0105240_10022393 Ga0105240_100223932 410
205 3300009093 Ga0105240_10030302 Ga0105240_100303021 410
206 3300009093 Ga0105240_10047315 Ga0105240_100473153 410
207 3300009101 Ga0105247_10004772 Ga0105247_100047724 410
208 3300009545 Ga0105237_10069700 Ga0105237_100697004 410
209 3300009545 Ga0105237_10172029 Ga0105237_101720292 410
210 3300014325 Ga0163163_10028259 Ga0163163_100282593 410
211 3300014968 Ga0157379_10063447 Ga0157379_100634472 410
212 3300025900 Ga0207710_10001428 Ga0207710_1000142812 410
213 3300025903 Ga0207680_10068902 Ga0207680_100689022 410
214 3300025912 Ga0207707_10028366 Ga0207707_100283662 410
215 3300025913 Ga0207695_10067682 Ga0207695_100676824 410
216 3300025913 Ga0207695_10090027 Ga0207695_100900272 410
217 3300025913 Ga0207695_10127520 Ga0207695_101275203 410
218 3300025913 Ga0207695_10320660 Ga0207695_103206601 410
219 3300025917 Ga0207660_10049406 Ga0207660_100494063 410
220 3300025925 Ga0207650_10072186 Ga0207650_100721861 410
221 3300026035 Ga0207703_10000220 Ga0207703_1000022021 410
222 3300026035 Ga0207703_10170084 Ga0207703_101700842 410
223 3300026041 Ga0207639_10058647 Ga0207639_100586472 410
224 3300026089 Ga0207648_10070544 Ga0207648_100705442 410
225 3300028381 Ga0268264_10000316 Ga0268264_100003166 410
226 3300028794 Ga0307515_10089612 Ga0307515_100896123 410
227 3300028800 Ga0265338_10083859 Ga0265338_100838592 410
228 3300030521 Ga0307511_10000541 Ga0307511_1000054115 410
229 3300031730 Ga0307516_10000928 Ga0307516_1000092814 410
230 3300031911 Ga0307412_10001870 Ga0307412_100018705 410
231 3300031911 Ga0307412_10008937 Ga0307412_100089373 410
232 3300035695 Ga0373927_0010151 Ga0373927_0010151_1657_2940 410
233 3300036401 Ga0373937_0048521 Ga0373937_0048521_1978_3354 410
234 3300037068 Ga0373925_0127154 Ga0373925_0127154_720_1961 410
235 3300037418 Ga0395900_0011246 Ga0395900_0011246_6135_7379 410
236 3300037418 Ga0395900_0031108 Ga0395900_0031108_1077_2318 410
237 3300038443 Ga0395901_0034433 Ga0395901_0034433_18_1259 410
238 3300048905 Ga0496102_0003227 Ga0496102_0003227_50_1294 410
239 3300048919 Ga0496116_0024899 Ga0496116_0024899_2024_3280 410
240 3300048919 Ga0496116_0045216 Ga0496116_0045216_1028_2272 410
241 3300048920 Ga0496117_0000012 Ga0496117_0000012_446529_447773 410
242 3300048920 Ga0496117_0000054 Ga0496117_0000054_9432_10688 410
243 3300048921 Ga0496118_0000045 Ga0496118_0000045_5190_6446 410
244 3300048921 Ga0496118_0000051 Ga0496118_0000051_77645_78889 410
245 3300048922 Ga0496119_0000944 Ga0496119_0000944_31472_32716 410
246 3300048922 Ga0496119_0001762 Ga0496119_0001762_280_1521 410
247 3300048923 Ga0496120_0000762 Ga0496120_0000762_9077_10321 410
248 3300048923 Ga0496120_0062096 Ga0496120_0062096_672_1928 410
249 3300048924 Ga0496121_0002810 Ga0496121_0002810_6085_7326 410
250 3300048924 Ga0496121_0039375 Ga0496121_0039375_1072_2316 410
251 3300048927 Ga0496124_0012182 Ga0496124_0012182_1996_3252 410
252 3300048927 Ga0496124_0043038 Ga0496124_0043038_56_1300 410
253 3300048928 Ga0496125_0000820 Ga0496125_0000820_16833_18074 410
254 3300048928 Ga0496125_0098823 Ga0496125_0098823_523_1779 410
255 3300048929 Ga0496126_0029170 Ga0496126_0029170_214_1458 410
256 3300048929 Ga0496126_0048956 Ga0496126_0048956_2317_3573 410
257 3300048929 Ga0496126_0064940 Ga0496126_0064940_342_1652 410
258 3300049569 Ga0501032_0020461 Ga0501032_0020461_189_1430 410
259 3300049579 Ga0501043_0003150 Ga0501043_0003150_108_1349 410
260 3300049580 Ga0501046_0067470 Ga0501046_0067470_1145_2392 410
261 3300049581 Ga0501047_0000484 Ga0501047_0000484_29714_30955 410
262 3300050515 nmdc:mga0a205_34803_c2 nmdc:mga0a205_34803_c2_204_1445 410
263 3300053104 Ga0500556_0002293 Ga0500556_0002293_2563_3804 410
264 3300053104 Ga0500556_0002412 Ga0500556_0002412_2399_3643 410
265 3300053156 Ga0500622_0002109 Ga0500622_0002109_8996_10237 410
266 3300003203 JGI25406J46586_10001543 JGI25406J46586_100015438 411
267 3300005347 Ga0070668_100128610 Ga0070668_1001286102 411
268 3300005985 Ga0081539_10000248 Ga0081539_1000024838 411
269 3300031344 Ga0265316_10143223 Ga0265316_101432232 411
270 3300031711 Ga0265314_10005083 Ga0265314_100050839 411
271 3300037418 Ga0395900_0050313 Ga0395900_0050313_1813_3060 411
272 3300037466 Ga0395898_0017795 Ga0395898_0017795_991_2238 411
273 3300037471 Ga0395905_0155957 Ga0395905_0155957_63_1310 411
274 3300037471 Ga0395905_0181430 Ga0395905_0181430_61_1308 411
275 3300049579 Ga0501043_0031064 Ga0501043_0031064_260_1507 411
276 3300049581 Ga0501047_0056952 Ga0501047_0056952_1181_2428 411
277 3300049742 Ga0501080_0057433 Ga0501080_0057433_1138_2385 411
278 3300049822 Ga0501035_0120131 Ga0501035_0120131_652_1899 411
279 3300049823 Ga0501044_0088046 Ga0501044_0088046_1242_2489 411

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01979

Amidohydro_1

Amidohydrolase family

99

453

0.85

PF07969

Amidohydro_3

Amidohydrolase family

192

451

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3feq-assembly2.cif.gz_O crystal structure of uncharacterized protein eah89906 0.9829 2 408
3feq-assembly2.cif.gz_L crystal structure of uncharacterized protein eah89906 0.9808 2 408
3feq-assembly2.cif.gz_M crystal structure of uncharacterized protein eah89906 0.9799 2 408
3feq-assembly2.cif.gz_P crystal structure of uncharacterized protein eah89906 0.9797 2 408
3feq-assembly2.cif.gz_O crystal structure of uncharacterized protein eah89906 0.9781 2 408
ID Description Score Start End Superfamily
2r8cG02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9702 59 361 3.20.20.140
2r8cA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9686 2 57 2.30.40.10
2r8cG02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9577 59 361 3.20.20.140
af_P40896_13_285_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9564 91 358 3.20.20.140
af_P40896_13_285_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9358 91 358 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A537SC82-F1-model_v4 Amidohydrolase family protein 0.9936 206 408 GO:0016810
AF-A0A4Q4VY74-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9873 163 268 GO:0016787
AF-A0A8A5XBX0-F1-model_v4 deleted 0.9826 4 408
AF-A0A7S1LVV2-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9822 164 254 GO:0016787
AF-A0A536YY16-F1-model_v4 Amidohydrolase family protein 0.9808 1 139 GO:0016810

Feature Viewer

pLDDT pTM Quality
93.62 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map