F383233
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 279 | 147 | 279 | 290 |
Family's Representative Sequence
| Representative Sequence | 3300045049|Ga0466959_0244826|Ga0466959_0244826_115_1074 |
| Length | 319 |
| Sequence | MRPLITENRLDATWLPVFFSADEAIPRLVSAESPVQCVADVHAVLGEGPVWVARETALYWLDIQGRKIFRLDSQGQRAEWPTPRRIGSLAPRRSGGFIGGTENGIAAIDPQAGRFDILFNPEEDKPGNRFNDGKLDRQGRFWAGTMDDAEKATTGTLYRIDADLSCRAIDSGYKVTNGPAFSPDGKLMYHNDSARSVTYVYDLNADGTATNRRVFLQFKDGEGHPDGMTVDADGCLWVCLWDGWAVRRYSPQGEWLETIKMPVQRPTSCTFGGRDLDRLYISSASKDLDDEARKMQPNAGALFMITPGVRGLADVPFAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 99 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 100 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 101 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 102 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 103 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 104 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 105 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 106 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 107 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 108 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 109 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 110 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 111 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 112 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 113 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 114 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 115 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 116 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 117 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 118 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 119 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 120 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 121 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 122 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 123 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 130 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 131 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 132 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 134 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 135 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 136 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 137 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 138 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 139 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 140 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 141 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 142 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 143 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 144 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 145 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 146 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.36 |
| Nodule | 0 |
| Rhizoplane | 4.3 |
| Rhizosphere | 95.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10047117 | 3300001979 | Bacteria | 1261 |
| 2 | JGI24751J29686_10019480 | 3300002459 | Bacteria | 1405 |
| 3 | Ga0070658_10019049 | 3300005327 | Bacteria | 5497 |
| 4 | Ga0070658_10120871 | 3300005327 | Bacteria | 2176 |
| 5 | Ga0070676_10061747 | 3300005328 | Bacteria | 2228 |
| 6 | Ga0070676_10135427 | 3300005328 | Bacteria | 1562 |
| 7 | Ga0070683_100495432 | 3300005329 | Bacteria | 1167 |
| 8 | Ga0068868_100022300 | 3300005338 | Bacteria | 4776 |
| 9 | Ga0068868_100107438 | 3300005338 | Bacteria | 2265 |
| 10 | Ga0070660_100004510 | 3300005339 | Bacteria | 9625 |
| 11 | Ga0070660_100116599 | 3300005339 | Bacteria | 2129 |
| 12 | Ga0070660_100226620 | 3300005339 | Bacteria | 1520 |
| 13 | Ga0070660_100284873 | 3300005339 | Bacteria | 1352 |
| 14 | Ga0070661_100035368 | 3300005344 | Bacteria | 3627 |
| 15 | Ga0070661_100050609 | 3300005344 | Bacteria | 3040 |
| 16 | Ga0070668_100007660 | 3300005347 | Bacteria | 8014 |
| 17 | Ga0070669_100040262 | 3300005353 | Bacteria | 3397 |
| 18 | Ga0070669_100100661 | 3300005353 | Bacteria | 2179 |
| 19 | Ga0070669_100403815 | 3300005353 | Bacteria | 1118 |
| 20 | Ga0070675_100190130 | 3300005354 | Bacteria | 1778 |
| 21 | Ga0070671_100003781 | 3300005355 | Bacteria | 11876 |
| 22 | Ga0070671_100031062 | 3300005355 | Bacteria | 4411 |
| 23 | Ga0070671_100088453 | 3300005355 | Bacteria | 2592 |
| 24 | Ga0070671_100131190 | 3300005355 | Bacteria | 2111 |
| 25 | Ga0070674_100164823 | 3300005356 | Bacteria | 1685 |
| 26 | Ga0070673_100017746 | 3300005364 | Bacteria | 5070 |
| 27 | Ga0070673_100078291 | 3300005364 | Bacteria | 2674 |
| 28 | Ga0070659_100060457 | 3300005366 | Bacteria | 2992 |
| 29 | Ga0070659_100108797 | 3300005366 | Bacteria | 2237 |
| 30 | Ga0070659_100298476 | 3300005366 | Bacteria | 1343 |
| 31 | Ga0070659_100344302 | 3300005366 | Bacteria | 1250 |
| 32 | Ga0070667_100003528 | 3300005367 | Bacteria | 13330 |
| 33 | Ga0070667_100036328 | 3300005367 | Bacteria | 4130 |
| 34 | Ga0070667_100182895 | 3300005367 | Bacteria | 1854 |
| 35 | Ga0070694_100018841 | 3300005444 | Bacteria | 4385 |
| 36 | Ga0070663_100006862 | 3300005455 | Bacteria | 6890 |
| 37 | Ga0070663_100020110 | 3300005455 | Bacteria | 4415 |
| 38 | Ga0070663_100100191 | 3300005455 | Bacteria | 2161 |
| 39 | Ga0070663_100303471 | 3300005455 | Bacteria | 1279 |
| 40 | Ga0070662_100087724 | 3300005457 | Bacteria | 2330 |
| 41 | Ga0070662_100099830 | 3300005457 | Bacteria | 2195 |
| 42 | Ga0070662_100141587 | 3300005457 | Bacteria | 1864 |
| 43 | Ga0068867_100028424 | 3300005459 | Bacteria | 4026 |
| 44 | Ga0070679_100254026 | 3300005530 | Bacteria | 1713 |
| 45 | Ga0070679_100361954 | 3300005530 | Bacteria | 1398 |
| 46 | Ga0070679_100575180 | 3300005530 | Bacteria | 1070 |
| 47 | Ga0068853_100092743 | 3300005539 | Bacteria | 2657 |
| 48 | Ga0068853_100110128 | 3300005539 | Bacteria | 2445 |
| 49 | Ga0068853_100311237 | 3300005539 | Bacteria | 1458 |
| 50 | Ga0070672_100038689 | 3300005543 | Bacteria | 3647 |
| 51 | Ga0070672_100489831 | 3300005543 | Bacteria | 1062 |
| 52 | Ga0070695_100008351 | 3300005545 | Bacteria | 6143 |
| 53 | Ga0070696_100003105 | 3300005546 | Bacteria | 11047 |
| 54 | Ga0070693_100119749 | 3300005547 | Bacteria | 1631 |
| 55 | Ga0068855_100534231 | 3300005563 | Bacteria | 1271 |
| 56 | Ga0068855_100586295 | 3300005563 | Bacteria | 1204 |
| 57 | Ga0070664_100009377 | 3300005564 | Bacteria | 7936 |
| 58 | Ga0070664_100052331 | 3300005564 | Bacteria | 3458 |
| 59 | Ga0070664_100333724 | 3300005564 | Bacteria | 1376 |
| 60 | Ga0068854_100016808 | 3300005578 | Bacteria | 4883 |
| 61 | Ga0068852_100141018 | 3300005616 | Bacteria | 2230 |
| 62 | Ga0068852_100608527 | 3300005616 | Bacteria | 1097 |
| 63 | Ga0068859_100022894 | 3300005617 | Bacteria | 6264 |
| 64 | Ga0068859_100116252 | 3300005617 | Bacteria | 2739 |
| 65 | Ga0068859_100625068 | 3300005617 | Bacteria | 1170 |
| 66 | Ga0068864_100000291 | 3300005618 | Bacteria | 44522 |
| 67 | Ga0068864_100001458 | 3300005618 | Bacteria | 19498 |
| 68 | Ga0068861_100412131 | 3300005719 | Bacteria | 1202 |
| 69 | Ga0068851_10003637 | 3300005834 | Bacteria | 6881 |
| 70 | Ga0068851_10073600 | 3300005834 | Bacteria | 1772 |
| 71 | Ga0068863_100000816 | 3300005841 | Bacteria | 31200 |
| 72 | Ga0068863_100114124 | 3300005841 | Bacteria | 2574 |
| 73 | Ga0068858_100002150 | 3300005842 | Bacteria | 19979 |
| 74 | Ga0068860_100001926 | 3300005843 | Bacteria | 21977 |
| 75 | Ga0068860_100017319 | 3300005843 | Bacteria | 7020 |
| 76 | Ga0068860_100232816 | 3300005843 | Bacteria | 1790 |
| 77 | Ga0068862_100016468 | 3300005844 | Bacteria | 6153 |
| 78 | Ga0068862_100059667 | 3300005844 | Bacteria | 3276 |
| 79 | Ga0097621_100107561 | 3300006237 | Bacteria | 2353 |
| 80 | Ga0097621_100505714 | 3300006237 | Bacteria | 1095 |
| 81 | Ga0068871_100140425 | 3300006358 | Bacteria | 2054 |
| 82 | Ga0068871_100366704 | 3300006358 | Bacteria | 1277 |
| 83 | Ga0068865_100005327 | 3300006881 | Bacteria | 7788 |
| 84 | Ga0068865_100016371 | 3300006881 | Bacteria | 4744 |
| 85 | Ga0097620_100022895 | 3300006931 | Bacteria | 6264 |
| 86 | Ga0097620_100116267 | 3300006931 | Bacteria | 2739 |
| 87 | Ga0097620_100625080 | 3300006931 | Bacteria | 1170 |
| 88 | Ga0105251_10018248 | 3300009011 | Bacteria | 3735 |
| 89 | Ga0105250_10020677 | 3300009092 | Bacteria | 2659 |
| 90 | Ga0111539_10089126 | 3300009094 | Bacteria | 3625 |
| 91 | Ga0105243_10114036 | 3300009148 | Bacteria | 2267 |
| 92 | Ga0105241_10073410 | 3300009174 | Bacteria | 2661 |
| 93 | Ga0105248_10000123 | 3300009177 | Bacteria | 89301 |
| 94 | Ga0105248_10001489 | 3300009177 | Bacteria | 26067 |
| 95 | Ga0105249_10081940 | 3300009553 | Bacteria | 3001 |
| 96 | Ga0157373_10051806 | 3300013100 | Bacteria | 2922 |
| 97 | Ga0157373_10065134 | 3300013100 | Bacteria | 2579 |
| 98 | Ga0157373_10099593 | 3300013100 | Bacteria | 2045 |
| 99 | Ga0157371_10029402 | 3300013102 | Bacteria | 3974 |
| 100 | Ga0157370_10027228 | 3300013104 | Bacteria | 5637 |
| 101 | Ga0157370_10358918 | 3300013104 | Bacteria | 1343 |
| 102 | Ga0157374_10179125 | 3300013296 | Bacteria | 2070 |
| 103 | Ga0157374_10183091 | 3300013296 | Bacteria | 2047 |
| 104 | Ga0157378_10383703 | 3300013297 | Bacteria | 1380 |
| 105 | Ga0163162_10226300 | 3300013306 | Bacteria | 2000 |
| 106 | Ga0157375_10102029 | 3300013308 | Bacteria | 2953 |
| 107 | Ga0157375_10114472 | 3300013308 | Bacteria | 2799 |
| 108 | Ga0157375_10290682 | 3300013308 | Bacteria | 1797 |
| 109 | Ga0163163_10002107 | 3300014325 | Bacteria | 16792 |
| 110 | Ga0157379_10002249 | 3300014968 | Bacteria | 16076 |
| 111 | Ga0207696_1024031 | 3300025711 | Bacteria | 1914 |
| 112 | Ga0207680_10037306 | 3300025903 | Bacteria | 2805 |
| 113 | Ga0207645_10016623 | 3300025907 | Bacteria | 4867 |
| 114 | Ga0207645_10063393 | 3300025907 | Bacteria | 2362 |
| 115 | Ga0207705_10006422 | 3300025909 | Bacteria | 8707 |
| 116 | Ga0207705_10011481 | 3300025909 | Bacteria | 6406 |
| 117 | Ga0207705_10019940 | 3300025909 | Bacteria | 4796 |
| 118 | Ga0207705_10099943 | 3300025909 | Bacteria | 2133 |
| 119 | Ga0207660_10479375 | 3300025917 | Bacteria | 1008 |
| 120 | Ga0207657_10000267 | 3300025919 | Bacteria | 55426 |
| 121 | Ga0207657_10009316 | 3300025919 | Bacteria | 9888 |
| 122 | Ga0207657_10042503 | 3300025919 | Bacteria | 4009 |
| 123 | Ga0207657_10072964 | 3300025919 | Bacteria | 2902 |
| 124 | Ga0207657_10132061 | 3300025919 | Bacteria | 2046 |
| 125 | Ga0207657_10138042 | 3300025919 | Bacteria | 1994 |
| 126 | Ga0207657_10200931 | 3300025919 | Bacteria | 1603 |
| 127 | Ga0207657_10251387 | 3300025919 | Bacteria | 1409 |
| 128 | Ga0207652_10133361 | 3300025921 | Bacteria | 2216 |
| 129 | Ga0207652_10373178 | 3300025921 | Bacteria | 1288 |
| 130 | Ga0207681_10097271 | 3300025923 | Bacteria | 2115 |
| 131 | Ga0207681_10290527 | 3300025923 | Bacteria | 1290 |
| 132 | Ga0207694_10492308 | 3300025924 | Bacteria | 1026 |
| 133 | Ga0207659_10042746 | 3300025926 | Bacteria | 3179 |
| 134 | Ga0207644_10000954 | 3300025931 | Bacteria | 18456 |
| 135 | Ga0207644_10020085 | 3300025931 | Bacteria | 4538 |
| 136 | Ga0207644_10102729 | 3300025931 | Bacteria | 2150 |
| 137 | Ga0207644_10229293 | 3300025931 | Bacteria | 1475 |
| 138 | Ga0207690_10030566 | 3300025932 | Bacteria | 3437 |
| 139 | Ga0207690_10164927 | 3300025932 | Bacteria | 1655 |
| 140 | Ga0207690_10176131 | 3300025932 | Bacteria | 1606 |
| 141 | Ga0207690_10214678 | 3300025932 | Bacteria | 1469 |
| 142 | Ga0207706_10010395 | 3300025933 | Bacteria | 8502 |
| 143 | Ga0207706_10062451 | 3300025933 | Bacteria | 3280 |
| 144 | Ga0207706_10260468 | 3300025933 | Bacteria | 1514 |
| 145 | Ga0207706_10321814 | 3300025933 | Bacteria | 1346 |
| 146 | Ga0207669_10081980 | 3300025937 | Bacteria | 2069 |
| 147 | Ga0207669_10217508 | 3300025937 | Bacteria | 1399 |
| 148 | Ga0207691_10153581 | 3300025940 | Bacteria | 2023 |
| 149 | Ga0207691_10228885 | 3300025940 | Bacteria | 1610 |
| 150 | Ga0207691_10236040 | 3300025940 | Bacteria | 1582 |
| 151 | Ga0207711_10000100 | 3300025941 | Bacteria | 91024 |
| 152 | Ga0207711_10005132 | 3300025941 | Bacteria | 11104 |
| 153 | Ga0207711_10096526 | 3300025941 | Bacteria | 2609 |
| 154 | Ga0207711_10097343 | 3300025941 | Bacteria | 2598 |
| 155 | Ga0207711_10247626 | 3300025941 | Bacteria | 1635 |
| 156 | Ga0207689_10181318 | 3300025942 | Bacteria | 1736 |
| 157 | Ga0207661_10343166 | 3300025944 | Bacteria | 1346 |
| 158 | Ga0207679_10007146 | 3300025945 | Bacteria | 7071 |
| 159 | Ga0207667_10190369 | 3300025949 | Bacteria | 2105 |
| 160 | Ga0207651_10073858 | 3300025960 | Bacteria | 2426 |
| 161 | Ga0207651_10522921 | 3300025960 | Bacteria | 1028 |
| 162 | Ga0207712_10321757 | 3300025961 | Bacteria | 1276 |
| 163 | Ga0207668_10000080 | 3300025972 | Bacteria | 72198 |
| 164 | Ga0207668_10011413 | 3300025972 | Bacteria | 5397 |
| 165 | Ga0207668_10242048 | 3300025972 | Bacteria | 1460 |
| 166 | Ga0207640_10287913 | 3300025981 | Bacteria | 1294 |
| 167 | Ga0207658_10003101 | 3300025986 | Bacteria | 11895 |
| 168 | Ga0207658_10005467 | 3300025986 | Bacteria | 8714 |
| 169 | Ga0207658_10098828 | 3300025986 | Bacteria | 2281 |
| 170 | Ga0207658_10368894 | 3300025986 | Bacteria | 1254 |
| 171 | Ga0207677_10216676 | 3300026023 | Bacteria | 1532 |
| 172 | Ga0207703_10019609 | 3300026035 | Bacteria | 5285 |
| 173 | Ga0207639_10064641 | 3300026041 | Bacteria | 2837 |
| 174 | Ga0207639_10065283 | 3300026041 | Bacteria | 2825 |
| 175 | Ga0207639_10520452 | 3300026041 | Bacteria | 1089 |
| 176 | Ga0207678_10015898 | 3300026067 | Bacteria | 6611 |
| 177 | Ga0207678_10020554 | 3300026067 | Bacteria | 5788 |
| 178 | Ga0207678_10036410 | 3300026067 | Bacteria | 4283 |
| 179 | Ga0207641_10000221 | 3300026088 | Bacteria | 74390 |
| 180 | Ga0207648_10008887 | 3300026089 | Bacteria | 9672 |
| 181 | Ga0207648_10110602 | 3300026089 | Bacteria | 2412 |
| 182 | Ga0207676_10003162 | 3300026095 | Bacteria | 11751 |
| 183 | Ga0207676_10023058 | 3300026095 | Bacteria | 4585 |
| 184 | Ga0207674_10062411 | 3300026116 | Bacteria | 3764 |
| 185 | Ga0207675_100116048 | 3300026118 | Bacteria | 2530 |
| 186 | Ga0207675_100429333 | 3300026118 | Bacteria | 1306 |
| 187 | Ga0207683_10064992 | 3300026121 | Bacteria | 3216 |
| 188 | Ga0207698_10100364 | 3300026142 | Bacteria | 2397 |
| 189 | Ga0207698_10316446 | 3300026142 | Bacteria | 1460 |
| 190 | Ga0268266_10160959 | 3300028379 | Bacteria | 2031 |
| 191 | Ga0268265_10002770 | 3300028380 | Bacteria | 12931 |
| 192 | Ga0268265_10220436 | 3300028380 | Bacteria | 1659 |
| 193 | Ga0268264_10001272 | 3300028381 | Bacteria | 23913 |
| 194 | Ga0268264_10003351 | 3300028381 | Bacteria | 13846 |
| 195 | Ga0268264_10049208 | 3300028381 | Bacteria | 3506 |
| 196 | Ga0307408_100119598 | 3300031548 | Bacteria | 2039 |
| 197 | Ga0307413_10058348 | 3300031824 | Bacteria | 2365 |
| 198 | Ga0307413_10065356 | 3300031824 | Bacteria | 2265 |
| 199 | Ga0307413_10106963 | 3300031824 | Bacteria | 1863 |
| 200 | Ga0307410_10094739 | 3300031852 | Bacteria | 2127 |
| 201 | Ga0307410_10154045 | 3300031852 | Bacteria | 1714 |
| 202 | Ga0307410_10251760 | 3300031852 | Bacteria | 1373 |
| 203 | Ga0307410_10252280 | 3300031852 | Bacteria | 1372 |
| 204 | Ga0307406_10053713 | 3300031901 | Bacteria | 2567 |
| 205 | Ga0307406_10122632 | 3300031901 | Bacteria | 1810 |
| 206 | Ga0307406_10134605 | 3300031901 | Bacteria | 1740 |
| 207 | Ga0307407_10203087 | 3300031903 | Bacteria | 1329 |
| 208 | Ga0307409_100006386 | 3300031995 | Bacteria | 6921 |
| 209 | Ga0307409_100135046 | 3300031995 | Bacteria | 2115 |
| 210 | Ga0307409_100139133 | 3300031995 | Bacteria | 2088 |
| 211 | Ga0307409_100196791 | 3300031995 | Bacteria | 1799 |
| 212 | Ga0307409_100611494 | 3300031995 | Bacteria | 1078 |
| 213 | Ga0307416_100001051 | 3300032002 | Bacteria | 14704 |
| 214 | Ga0307414_10056260 | 3300032004 | Bacteria | 2758 |
| 215 | Ga0307414_10102893 | 3300032004 | Bacteria | 2153 |
| 216 | Ga0307414_10291195 | 3300032004 | Bacteria | 1376 |
| 217 | Ga0307411_10030684 | 3300032005 | Bacteria | 3298 |
| 218 | Ga0307411_10038930 | 3300032005 | Bacteria | 3004 |
| 219 | Ga0307411_10091737 | 3300032005 | Bacteria | 2122 |
| 220 | Ga0307411_10173851 | 3300032005 | Bacteria | 1627 |
| 221 | Ga0307411_10245888 | 3300032005 | Bacteria | 1403 |
| 222 | Ga0307415_100385332 | 3300032126 | Bacteria | 1192 |
| 223 | Ga0395899_0005357 | 3300037312 | Bacteria | 9967 |
| 224 | Ga0395900_0000447 | 3300037418 | Bacteria | 59069 |
| 225 | Ga0395898_0005900 | 3300037466 | Bacteria | 13169 |
| 226 | Ga0395898_0008790 | 3300037466 | Bacteria | 10643 |
| 227 | Ga0395898_0165010 | 3300037466 | Bacteria | 2118 |
| 228 | Ga0395905_0000974 | 3300037471 | Bacteria | 36725 |
| 229 | Ga0395905_0028956 | 3300037471 | Bacteria | 5220 |
| 230 | Ga0395905_0081425 | 3300037471 | Bacteria | 3034 |
| 231 | Ga0395905_0150459 | 3300037471 | Bacteria | 2190 |
| 232 | Ga0395905_0173985 | 3300037471 | Bacteria | 2022 |
| 233 | Ga0395901_0000324 | 3300038443 | Bacteria | 59134 |
| 234 | Ga0395901_0099105 | 3300038443 | Bacteria | 3055 |
| 235 | Ga0395901_0251129 | 3300038443 | Bacteria | 1842 |
| 236 | Ga0439432_018925 | 3300042006 | Bacteria | 2298 |
| 237 | Ga0450917_000833 | 3300042120 | Bacteria | 2269 |
| 238 | Ga0450890_007322 | 3300042127 | Bacteria | 1409 |
| 239 | Ga0450905_002764 | 3300042142 | Bacteria | 2274 |
| 240 | Ga0450889_000635 | 3300042144 | Bacteria | 3884 |
| 241 | Ga0466963_0062116 | 3300044694 | Bacteria | 2499 |
| 242 | Ga0466970_0039058 | 3300044765 | Bacteria | 2519 |
| 243 | Ga0466959_0244826 | 3300045049 | Bacteria | 1237 |
| 244 | Ga0466958_0113642 | 3300045836 | Bacteria | 1691 |
| 245 | Ga0466967_0047831 | 3300045976 | Bacteria | 3731 |
| 246 | Ga0466967_0079237 | 3300045976 | Bacteria | 2961 |
| 247 | Ga0466967_0091727 | 3300045976 | Bacteria | 2761 |
| 248 | Ga0466967_0245065 | 3300045976 | Bacteria | 1710 |
| 249 | Ga0495663_0011388 | 3300046525 | Bacteria | 2475 |
| 250 | Ga0495642_0082917 | 3300046528 | Bacteria | 1352 |
| 251 | Ga0495621_0038545 | 3300046539 | Bacteria | 1668 |
| 252 | Ga0495669_0029822 | 3300046684 | Bacteria | 2393 |
| 253 | Ga0495669_0032910 | 3300046684 | Bacteria | 2280 |
| 254 | Ga0495669_0169556 | 3300046684 | Bacteria | 1038 |
| 255 | Ga0495670_0130965 | 3300046691 | Bacteria | 1307 |
| 256 | Ga0495677_0011983 | 3300047445 | Bacteria | 3164 |
| 257 | Ga0496105_0106791 | 3300048908 | Bacteria | 2311 |
| 258 | Ga0496107_0067643 | 3300048910 | Bacteria | 2592 |
| 259 | Ga0496108_0021480 | 3300048911 | Bacteria | 5305 |
| 260 | Ga0496108_0022113 | 3300048911 | Bacteria | 5228 |
| 261 | Ga0496109_0003841 | 3300048912 | Bacteria | 12548 |
| 262 | Ga0496109_0762982 | 3300048912 | Bacteria | 905 |
| 263 | Ga0496110_0112124 | 3300048913 | Bacteria | 2452 |
| 264 | Ga0496110_0120687 | 3300048913 | Bacteria | 2361 |
| 265 | Ga0496112_0018585 | 3300048915 | Bacteria | 6549 |
| 266 | Ga0496112_0116106 | 3300048915 | Bacteria | 2647 |
| 267 | Ga0496113_0018129 | 3300048916 | Bacteria | 4899 |
| 268 | Ga0496115_0000691 | 3300048918 | Bacteria | 25050 |
| 269 | Ga0501250_002121 | 3300049680 | Bacteria | 1757 |
| 270 | Ga0501257_029744 | 3300049686 | Bacteria | 1313 |
| 271 | Ga0501221_004678 | 3300049704 | Bacteria | 2271 |
| 272 | Ga0501225_0019653 | 3300049705 | Bacteria | 1869 |
| 273 | Ga0501229_006556 | 3300049706 | Bacteria | 1440 |
| 274 | Ga0501263_012921 | 3300049760 | Bacteria | 1052 |
| 275 | Ga0501268_000563 | 3300049765 | Bacteria | 4104 |
| 276 | Ga0501270_001285 | 3300049767 | Bacteria | 2368 |
| 277 | Ga0501273_002790 | 3300049770 | Bacteria | 1807 |
| 278 | nmdc:mga08y16_103313_c1 | 3300050511 | Bacteria | 2967 |
| 279 | Ga0500658_0000173 | 3300053134 | Bacteria | 30720 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013296 | Ga0157374_10183091 | Ga0157374_101830911 | 252 |
| 2 | 3300042120 | Ga0450917_000833 | Ga0450917_000833_1313_2128 | 263 |
| 3 | 3300049705 | Ga0501225_0019653 | Ga0501225_0019653_942_1835 | 263 |
| 4 | 3300037471 | Ga0395905_0150459 | Ga0395905_0150459_951_1805 | 265 |
| 5 | 3300048908 | Ga0496105_0106791 | Ga0496105_0106791_563_1417 | 265 |
| 6 | 3300046684 | Ga0495669_0169556 | Ga0495669_0169556_17_820 | 267 |
| 7 | 3300048912 | Ga0496109_0762982 | Ga0496109_0762982_85_888 | 267 |
| 8 | 3300005355 | Ga0070671_100003781 | Ga0070671_1000037819 | 271 |
| 9 | 3300048911 | Ga0496108_0022113 | Ga0496108_0022113_1567_2439 | 271 |
| 10 | 3300002459 | JGI24751J29686_10019480 | JGI24751J29686_100194802 | 275 |
| 11 | 3300046525 | Ga0495663_0011388 | Ga0495663_0011388_890_1765 | 279 |
| 12 | 3300046528 | Ga0495642_0082917 | Ga0495642_0082917_173_1048 | 279 |
| 13 | 3300046539 | Ga0495621_0038545 | Ga0495621_0038545_102_977 | 279 |
| 14 | 3300046684 | Ga0495669_0029822 | Ga0495669_0029822_467_1342 | 279 |
| 15 | 3300047445 | Ga0495677_0011983 | Ga0495677_0011983_1712_2587 | 279 |
| 16 | 3300038443 | Ga0395901_0251129 | Ga0395901_0251129_19_867 | 282 |
| 17 | 3300045976 | Ga0466967_0091727 | Ga0466967_0091727_152_1006 | 284 |
| 18 | 3300025903 | Ga0207680_10037306 | Ga0207680_100373062 | 287 |
| 19 | 3300025972 | Ga0207668_10242048 | Ga0207668_102420482 | 287 |
| 20 | 3300025986 | Ga0207658_10098828 | Ga0207658_100988282 | 287 |
| 21 | 3300005328 | Ga0070676_10061747 | Ga0070676_100617472 | 288 |
| 22 | 3300005338 | Ga0068868_100107438 | Ga0068868_1001074382 | 288 |
| 23 | 3300005347 | Ga0070668_100007660 | Ga0070668_1000076607 | 288 |
| 24 | 3300005353 | Ga0070669_100100661 | Ga0070669_1001006613 | 288 |
| 25 | 3300005353 | Ga0070669_100403815 | Ga0070669_1004038151 | 288 |
| 26 | 3300005367 | Ga0070667_100182895 | Ga0070667_1001828951 | 288 |
| 27 | 3300005455 | Ga0070663_100100191 | Ga0070663_1001001912 | 288 |
| 28 | 3300005459 | Ga0068867_100028424 | Ga0068867_1000284244 | 288 |
| 29 | 3300005543 | Ga0070672_100489831 | Ga0070672_1004898311 | 288 |
| 30 | 3300005563 | Ga0068855_100534231 | Ga0068855_1005342311 | 288 |
| 31 | 3300005564 | Ga0070664_100052331 | Ga0070664_1000523312 | 288 |
| 32 | 3300005617 | Ga0068859_100625068 | Ga0068859_1006250681 | 288 |
| 33 | 3300005834 | Ga0068851_10003637 | Ga0068851_100036378 | 288 |
| 34 | 3300005843 | Ga0068860_100017319 | Ga0068860_1000173196 | 288 |
| 35 | 3300005844 | Ga0068862_100059667 | Ga0068862_1000596672 | 288 |
| 36 | 3300006881 | Ga0068865_100016371 | Ga0068865_1000163712 | 288 |
| 37 | 3300006931 | Ga0097620_100625080 | Ga0097620_1006250802 | 288 |
| 38 | 3300025907 | Ga0207645_10016623 | Ga0207645_100166236 | 288 |
| 39 | 3300025909 | Ga0207705_10011481 | Ga0207705_100114813 | 288 |
| 40 | 3300025919 | Ga0207657_10009316 | Ga0207657_100093162 | 288 |
| 41 | 3300025937 | Ga0207669_10217508 | Ga0207669_102175082 | 288 |
| 42 | 3300025940 | Ga0207691_10236040 | Ga0207691_102360402 | 288 |
| 43 | 3300025941 | Ga0207711_10097343 | Ga0207711_100973432 | 288 |
| 44 | 3300025944 | Ga0207661_10343166 | Ga0207661_103431662 | 288 |
| 45 | 3300025960 | Ga0207651_10073858 | Ga0207651_100738583 | 288 |
| 46 | 3300025960 | Ga0207651_10522921 | Ga0207651_105229211 | 288 |
| 47 | 3300025972 | Ga0207668_10000080 | Ga0207668_1000008032 | 288 |
| 48 | 3300025986 | Ga0207658_10368894 | Ga0207658_103688942 | 288 |
| 49 | 3300026041 | Ga0207639_10064641 | Ga0207639_100646412 | 288 |
| 50 | 3300026067 | Ga0207678_10015898 | Ga0207678_100158987 | 288 |
| 51 | 3300026089 | Ga0207648_10008887 | Ga0207648_100088876 | 288 |
| 52 | 3300026118 | Ga0207675_100116048 | Ga0207675_1001160482 | 288 |
| 53 | 3300026121 | Ga0207683_10064992 | Ga0207683_100649922 | 288 |
| 54 | 3300026142 | Ga0207698_10100364 | Ga0207698_101003643 | 288 |
| 55 | 3300028380 | Ga0268265_10002770 | Ga0268265_100027702 | 288 |
| 56 | 3300028381 | Ga0268264_10003351 | Ga0268264_100033512 | 288 |
| 57 | 3300005367 | Ga0070667_100036328 | Ga0070667_1000363284 | 289 |
| 58 | 3300031852 | Ga0307410_10252280 | Ga0307410_102522802 | 289 |
| 59 | 3300031901 | Ga0307406_10122632 | Ga0307406_101226322 | 289 |
| 60 | 3300031903 | Ga0307407_10203087 | Ga0307407_102030872 | 289 |
| 61 | 3300032005 | Ga0307411_10173851 | Ga0307411_101738512 | 289 |
| 62 | 3300005327 | Ga0070658_10019049 | Ga0070658_100190494 | 290 |
| 63 | 3300005327 | Ga0070658_10120871 | Ga0070658_101208712 | 290 |
| 64 | 3300005329 | Ga0070683_100495432 | Ga0070683_1004954321 | 290 |
| 65 | 3300005339 | Ga0070660_100004510 | Ga0070660_10000451011 | 290 |
| 66 | 3300005344 | Ga0070661_100035368 | Ga0070661_1000353684 | 290 |
| 67 | 3300005366 | Ga0070659_100344302 | Ga0070659_1003443021 | 290 |
| 68 | 3300005455 | Ga0070663_100006862 | Ga0070663_1000068623 | 290 |
| 69 | 3300005457 | Ga0070662_100099830 | Ga0070662_1000998302 | 290 |
| 70 | 3300005530 | Ga0070679_100361954 | Ga0070679_1003619542 | 290 |
| 71 | 3300005539 | Ga0068853_100092743 | Ga0068853_1000927432 | 290 |
| 72 | 3300005539 | Ga0068853_100311237 | Ga0068853_1003112372 | 290 |
| 73 | 3300005616 | Ga0068852_100141018 | Ga0068852_1001410183 | 290 |
| 74 | 3300013104 | Ga0157370_10027228 | Ga0157370_100272286 | 290 |
| 75 | 3300013296 | Ga0157374_10179125 | Ga0157374_101791252 | 290 |
| 76 | 3300013297 | Ga0157378_10383703 | Ga0157378_103837031 | 290 |
| 77 | 3300025909 | Ga0207705_10006422 | Ga0207705_100064227 | 290 |
| 78 | 3300025917 | Ga0207660_10479375 | Ga0207660_104793751 | 290 |
| 79 | 3300025919 | Ga0207657_10132061 | Ga0207657_101320612 | 290 |
| 80 | 3300025932 | Ga0207690_10176131 | Ga0207690_101761312 | 290 |
| 81 | 3300026142 | Ga0207698_10316446 | Ga0207698_103164462 | 290 |
| 82 | 3300028379 | Ga0268266_10160959 | Ga0268266_101609592 | 290 |
| 83 | 3300031824 | Ga0307413_10065356 | Ga0307413_100653562 | 290 |
| 84 | 3300031824 | Ga0307413_10106963 | Ga0307413_101069632 | 290 |
| 85 | 3300031852 | Ga0307410_10154045 | Ga0307410_101540452 | 290 |
| 86 | 3300031995 | Ga0307409_100196791 | Ga0307409_1001967912 | 290 |
| 87 | 3300032004 | Ga0307414_10056260 | Ga0307414_100562602 | 290 |
| 88 | 3300032005 | Ga0307411_10038930 | Ga0307411_100389302 | 290 |
| 89 | 3300044765 | Ga0466970_0039058 | Ga0466970_0039058_1382_2323 | 290 |
| 90 | 3300045976 | Ga0466967_0079237 | Ga0466967_0079237_381_1283 | 290 |
| 91 | 3300048915 | Ga0496112_0116106 | Ga0496112_0116106_1026_1898 | 290 |
| 92 | 3300048918 | Ga0496115_0000691 | Ga0496115_0000691_4508_5380 | 290 |
| 93 | 3300001979 | JGI24740J21852_10047117 | JGI24740J21852_100471172 | 291 |
| 94 | 3300005328 | Ga0070676_10135427 | Ga0070676_101354272 | 291 |
| 95 | 3300005338 | Ga0068868_100022300 | Ga0068868_1000223002 | 291 |
| 96 | 3300005339 | Ga0070660_100116599 | Ga0070660_1001165992 | 291 |
| 97 | 3300005339 | Ga0070660_100226620 | Ga0070660_1002266202 | 291 |
| 98 | 3300005339 | Ga0070660_100284873 | Ga0070660_1002848731 | 291 |
| 99 | 3300005344 | Ga0070661_100050609 | Ga0070661_1000506092 | 291 |
| 100 | 3300005353 | Ga0070669_100040262 | Ga0070669_1000402624 | 291 |
| 101 | 3300005354 | Ga0070675_100190130 | Ga0070675_1001901302 | 291 |
| 102 | 3300005355 | Ga0070671_100031062 | Ga0070671_1000310625 | 291 |
| 103 | 3300005355 | Ga0070671_100088453 | Ga0070671_1000884532 | 291 |
| 104 | 3300005355 | Ga0070671_100131190 | Ga0070671_1001311902 | 291 |
| 105 | 3300005356 | Ga0070674_100164823 | Ga0070674_1001648232 | 291 |
| 106 | 3300005364 | Ga0070673_100017746 | Ga0070673_1000177466 | 291 |
| 107 | 3300005364 | Ga0070673_100078291 | Ga0070673_1000782912 | 291 |
| 108 | 3300005366 | Ga0070659_100060457 | Ga0070659_1000604572 | 291 |
| 109 | 3300005366 | Ga0070659_100108797 | Ga0070659_1001087973 | 291 |
| 110 | 3300005366 | Ga0070659_100298476 | Ga0070659_1002984761 | 291 |
| 111 | 3300005367 | Ga0070667_100003528 | Ga0070667_1000035286 | 291 |
| 112 | 3300005444 | Ga0070694_100018841 | Ga0070694_1000188415 | 291 |
| 113 | 3300005455 | Ga0070663_100020110 | Ga0070663_1000201102 | 291 |
| 114 | 3300005455 | Ga0070663_100303471 | Ga0070663_1003034712 | 291 |
| 115 | 3300005457 | Ga0070662_100087724 | Ga0070662_1000877241 | 291 |
| 116 | 3300005457 | Ga0070662_100141587 | Ga0070662_1001415872 | 291 |
| 117 | 3300005530 | Ga0070679_100254026 | Ga0070679_1002540262 | 291 |
| 118 | 3300005530 | Ga0070679_100575180 | Ga0070679_1005751801 | 291 |
| 119 | 3300005539 | Ga0068853_100110128 | Ga0068853_1001101282 | 291 |
| 120 | 3300005543 | Ga0070672_100038689 | Ga0070672_1000386892 | 291 |
| 121 | 3300005545 | Ga0070695_100008351 | Ga0070695_1000083512 | 291 |
| 122 | 3300005546 | Ga0070696_100003105 | Ga0070696_10000310511 | 291 |
| 123 | 3300005547 | Ga0070693_100119749 | Ga0070693_1001197492 | 291 |
| 124 | 3300005563 | Ga0068855_100586295 | Ga0068855_1005862952 | 291 |
| 125 | 3300005564 | Ga0070664_100009377 | Ga0070664_1000093777 | 291 |
| 126 | 3300005564 | Ga0070664_100333724 | Ga0070664_1003337241 | 291 |
| 127 | 3300005578 | Ga0068854_100016808 | Ga0068854_1000168083 | 291 |
| 128 | 3300005616 | Ga0068852_100608527 | Ga0068852_1006085272 | 291 |
| 129 | 3300005617 | Ga0068859_100022894 | Ga0068859_1000228947 | 291 |
| 130 | 3300005617 | Ga0068859_100116252 | Ga0068859_1001162522 | 291 |
| 131 | 3300005618 | Ga0068864_100000291 | Ga0068864_10000029144 | 291 |
| 132 | 3300005618 | Ga0068864_100001458 | Ga0068864_1000014583 | 291 |
| 133 | 3300005719 | Ga0068861_100412131 | Ga0068861_1004121312 | 291 |
| 134 | 3300005834 | Ga0068851_10073600 | Ga0068851_100736002 | 291 |
| 135 | 3300005841 | Ga0068863_100000816 | Ga0068863_10000081624 | 291 |
| 136 | 3300005841 | Ga0068863_100114124 | Ga0068863_1001141242 | 291 |
| 137 | 3300005842 | Ga0068858_100002150 | Ga0068858_1000021502 | 291 |
| 138 | 3300005843 | Ga0068860_100001926 | Ga0068860_10000192611 | 291 |
| 139 | 3300005843 | Ga0068860_100232816 | Ga0068860_1002328162 | 291 |
| 140 | 3300005844 | Ga0068862_100016468 | Ga0068862_1000164686 | 291 |
| 141 | 3300006237 | Ga0097621_100107561 | Ga0097621_1001075611 | 291 |
| 142 | 3300006237 | Ga0097621_100505714 | Ga0097621_1005057141 | 291 |
| 143 | 3300006358 | Ga0068871_100140425 | Ga0068871_1001404251 | 291 |
| 144 | 3300006358 | Ga0068871_100366704 | Ga0068871_1003667042 | 291 |
| 145 | 3300006881 | Ga0068865_100005327 | Ga0068865_1000053271 | 291 |
| 146 | 3300006931 | Ga0097620_100022895 | Ga0097620_1000228957 | 291 |
| 147 | 3300006931 | Ga0097620_100116267 | Ga0097620_1001162672 | 291 |
| 148 | 3300009011 | Ga0105251_10018248 | Ga0105251_100182483 | 291 |
| 149 | 3300009092 | Ga0105250_10020677 | Ga0105250_100206773 | 291 |
| 150 | 3300009094 | Ga0111539_10089126 | Ga0111539_100891261 | 291 |
| 151 | 3300009148 | Ga0105243_10114036 | Ga0105243_101140363 | 291 |
| 152 | 3300009174 | Ga0105241_10073410 | Ga0105241_100734102 | 291 |
| 153 | 3300009177 | Ga0105248_10000123 | Ga0105248_1000012326 | 291 |
| 154 | 3300009177 | Ga0105248_10001489 | Ga0105248_1000148919 | 291 |
| 155 | 3300009553 | Ga0105249_10081940 | Ga0105249_100819402 | 291 |
| 156 | 3300013100 | Ga0157373_10051806 | Ga0157373_100518063 | 291 |
| 157 | 3300013100 | Ga0157373_10065134 | Ga0157373_100651343 | 291 |
| 158 | 3300013100 | Ga0157373_10099593 | Ga0157373_100995932 | 291 |
| 159 | 3300013102 | Ga0157371_10029402 | Ga0157371_100294025 | 291 |
| 160 | 3300013104 | Ga0157370_10358918 | Ga0157370_103589182 | 291 |
| 161 | 3300013306 | Ga0163162_10226300 | Ga0163162_102263002 | 291 |
| 162 | 3300013308 | Ga0157375_10102029 | Ga0157375_101020291 | 291 |
| 163 | 3300013308 | Ga0157375_10114472 | Ga0157375_101144722 | 291 |
| 164 | 3300013308 | Ga0157375_10290682 | Ga0157375_102906822 | 291 |
| 165 | 3300014325 | Ga0163163_10002107 | Ga0163163_1000210717 | 291 |
| 166 | 3300014968 | Ga0157379_10002249 | Ga0157379_100022492 | 291 |
| 167 | 3300025711 | Ga0207696_1024031 | Ga0207696_10240312 | 291 |
| 168 | 3300025907 | Ga0207645_10063393 | Ga0207645_100633932 | 291 |
| 169 | 3300025909 | Ga0207705_10019940 | Ga0207705_100199403 | 291 |
| 170 | 3300025909 | Ga0207705_10099943 | Ga0207705_100999432 | 291 |
| 171 | 3300025919 | Ga0207657_10000267 | Ga0207657_100002678 | 291 |
| 172 | 3300025919 | Ga0207657_10042503 | Ga0207657_100425035 | 291 |
| 173 | 3300025919 | Ga0207657_10072964 | Ga0207657_100729643 | 291 |
| 174 | 3300025919 | Ga0207657_10138042 | Ga0207657_101380422 | 291 |
| 175 | 3300025919 | Ga0207657_10200931 | Ga0207657_102009312 | 291 |
| 176 | 3300025919 | Ga0207657_10251387 | Ga0207657_102513872 | 291 |
| 177 | 3300025921 | Ga0207652_10133361 | Ga0207652_101333612 | 291 |
| 178 | 3300025921 | Ga0207652_10373178 | Ga0207652_103731782 | 291 |
| 179 | 3300025923 | Ga0207681_10097271 | Ga0207681_100972712 | 291 |
| 180 | 3300025923 | Ga0207681_10290527 | Ga0207681_102905272 | 291 |
| 181 | 3300025924 | Ga0207694_10492308 | Ga0207694_104923082 | 291 |
| 182 | 3300025926 | Ga0207659_10042746 | Ga0207659_100427463 | 291 |
| 183 | 3300025931 | Ga0207644_10000954 | Ga0207644_1000095412 | 291 |
| 184 | 3300025931 | Ga0207644_10020085 | Ga0207644_100200852 | 291 |
| 185 | 3300025931 | Ga0207644_10102729 | Ga0207644_101027292 | 291 |
| 186 | 3300025931 | Ga0207644_10229293 | Ga0207644_102292932 | 291 |
| 187 | 3300025932 | Ga0207690_10030566 | Ga0207690_100305661 | 291 |
| 188 | 3300025932 | Ga0207690_10164927 | Ga0207690_101649272 | 291 |
| 189 | 3300025932 | Ga0207690_10214678 | Ga0207690_102146782 | 291 |
| 190 | 3300025933 | Ga0207706_10010395 | Ga0207706_100103956 | 291 |
| 191 | 3300025933 | Ga0207706_10062451 | Ga0207706_100624514 | 291 |
| 192 | 3300025933 | Ga0207706_10260468 | Ga0207706_102604682 | 291 |
| 193 | 3300025933 | Ga0207706_10321814 | Ga0207706_103218142 | 291 |
| 194 | 3300025937 | Ga0207669_10081980 | Ga0207669_100819802 | 291 |
| 195 | 3300025940 | Ga0207691_10153581 | Ga0207691_101535812 | 291 |
| 196 | 3300025940 | Ga0207691_10228885 | Ga0207691_102288852 | 291 |
| 197 | 3300025941 | Ga0207711_10000100 | Ga0207711_1000010028 | 291 |
| 198 | 3300025941 | Ga0207711_10005132 | Ga0207711_1000513212 | 291 |
| 199 | 3300025941 | Ga0207711_10096526 | Ga0207711_100965262 | 291 |
| 200 | 3300025941 | Ga0207711_10247626 | Ga0207711_102476262 | 291 |
| 201 | 3300025942 | Ga0207689_10181318 | Ga0207689_101813182 | 291 |
| 202 | 3300025945 | Ga0207679_10007146 | Ga0207679_100071468 | 291 |
| 203 | 3300025949 | Ga0207667_10190369 | Ga0207667_101903693 | 291 |
| 204 | 3300025961 | Ga0207712_10321757 | Ga0207712_103217572 | 291 |
| 205 | 3300025972 | Ga0207668_10011413 | Ga0207668_100114137 | 291 |
| 206 | 3300025981 | Ga0207640_10287913 | Ga0207640_102879132 | 291 |
| 207 | 3300025986 | Ga0207658_10003101 | Ga0207658_100031012 | 291 |
| 208 | 3300025986 | Ga0207658_10005467 | Ga0207658_100054672 | 291 |
| 209 | 3300026023 | Ga0207677_10216676 | Ga0207677_102166762 | 291 |
| 210 | 3300026035 | Ga0207703_10019609 | Ga0207703_100196096 | 291 |
| 211 | 3300026041 | Ga0207639_10065283 | Ga0207639_100652833 | 291 |
| 212 | 3300026041 | Ga0207639_10520452 | Ga0207639_105204522 | 291 |
| 213 | 3300026067 | Ga0207678_10020554 | Ga0207678_100205547 | 291 |
| 214 | 3300026067 | Ga0207678_10036410 | Ga0207678_100364104 | 291 |
| 215 | 3300026088 | Ga0207641_10000221 | Ga0207641_1000022127 | 291 |
| 216 | 3300026089 | Ga0207648_10110602 | Ga0207648_101106022 | 291 |
| 217 | 3300026095 | Ga0207676_10003162 | Ga0207676_100031628 | 291 |
| 218 | 3300026095 | Ga0207676_10023058 | Ga0207676_100230582 | 291 |
| 219 | 3300026116 | Ga0207674_10062411 | Ga0207674_100624115 | 291 |
| 220 | 3300026118 | Ga0207675_100429333 | Ga0207675_1004293332 | 291 |
| 221 | 3300028380 | Ga0268265_10220436 | Ga0268265_102204361 | 291 |
| 222 | 3300028381 | Ga0268264_10001272 | Ga0268264_100012723 | 291 |
| 223 | 3300028381 | Ga0268264_10049208 | Ga0268264_100492083 | 291 |
| 224 | 3300031548 | Ga0307408_100119598 | Ga0307408_1001195982 | 291 |
| 225 | 3300031824 | Ga0307413_10058348 | Ga0307413_100583482 | 291 |
| 226 | 3300031852 | Ga0307410_10094739 | Ga0307410_100947392 | 291 |
| 227 | 3300031852 | Ga0307410_10251760 | Ga0307410_102517602 | 291 |
| 228 | 3300031901 | Ga0307406_10053713 | Ga0307406_100537133 | 291 |
| 229 | 3300031901 | Ga0307406_10134605 | Ga0307406_101346052 | 291 |
| 230 | 3300031995 | Ga0307409_100006386 | Ga0307409_1000063863 | 291 |
| 231 | 3300031995 | Ga0307409_100135046 | Ga0307409_1001350462 | 291 |
| 232 | 3300031995 | Ga0307409_100139133 | Ga0307409_1001391331 | 291 |
| 233 | 3300031995 | Ga0307409_100611494 | Ga0307409_1006114942 | 291 |
| 234 | 3300032002 | Ga0307416_100001051 | Ga0307416_1000010512 | 291 |
| 235 | 3300032004 | Ga0307414_10102893 | Ga0307414_101028932 | 291 |
| 236 | 3300032004 | Ga0307414_10291195 | Ga0307414_102911952 | 291 |
| 237 | 3300032005 | Ga0307411_10030684 | Ga0307411_100306842 | 291 |
| 238 | 3300032005 | Ga0307411_10091737 | Ga0307411_100917372 | 291 |
| 239 | 3300032005 | Ga0307411_10245888 | Ga0307411_102458882 | 291 |
| 240 | 3300032126 | Ga0307415_100385332 | Ga0307415_1003853322 | 291 |
| 241 | 3300037312 | Ga0395899_0005357 | Ga0395899_0005357_3379_4266 | 291 |
| 242 | 3300037418 | Ga0395900_0000447 | Ga0395900_0000447_53146_54033 | 291 |
| 243 | 3300037466 | Ga0395898_0005900 | Ga0395898_0005900_6653_7540 | 291 |
| 244 | 3300037466 | Ga0395898_0008790 | Ga0395898_0008790_826_1701 | 291 |
| 245 | 3300037466 | Ga0395898_0165010 | Ga0395898_0165010_46_921 | 291 |
| 246 | 3300037471 | Ga0395905_0000974 | Ga0395905_0000974_31548_32423 | 291 |
| 247 | 3300037471 | Ga0395905_0028956 | Ga0395905_0028956_1340_2215 | 291 |
| 248 | 3300037471 | Ga0395905_0081425 | Ga0395905_0081425_1801_2760 | 291 |
| 249 | 3300037471 | Ga0395905_0173985 | Ga0395905_0173985_185_1072 | 291 |
| 250 | 3300038443 | Ga0395901_0000324 | Ga0395901_0000324_53178_54065 | 291 |
| 251 | 3300038443 | Ga0395901_0099105 | Ga0395901_0099105_1355_2230 | 291 |
| 252 | 3300042006 | Ga0439432_018925 | Ga0439432_018925_1287_2162 | 291 |
| 253 | 3300042127 | Ga0450890_007322 | Ga0450890_007322_446_1321 | 291 |
| 254 | 3300042142 | Ga0450905_002764 | Ga0450905_002764_11_886 | 291 |
| 255 | 3300042144 | Ga0450889_000635 | Ga0450889_000635_388_1263 | 291 |
| 256 | 3300044694 | Ga0466963_0062116 | Ga0466963_0062116_1255_2130 | 291 |
| 257 | 3300045049 | Ga0466959_0244826 | Ga0466959_0244826_115_1074 | 291 |
| 258 | 3300045836 | Ga0466958_0113642 | Ga0466958_0113642_403_1362 | 291 |
| 259 | 3300045976 | Ga0466967_0047831 | Ga0466967_0047831_2584_3486 | 291 |
| 260 | 3300045976 | Ga0466967_0245065 | Ga0466967_0245065_203_1078 | 291 |
| 261 | 3300046684 | Ga0495669_0032910 | Ga0495669_0032910_927_1802 | 291 |
| 262 | 3300046691 | Ga0495670_0130965 | Ga0495670_0130965_253_1128 | 291 |
| 263 | 3300048910 | Ga0496107_0067643 | Ga0496107_0067643_1450_2325 | 291 |
| 264 | 3300048911 | Ga0496108_0021480 | Ga0496108_0021480_250_1125 | 291 |
| 265 | 3300048912 | Ga0496109_0003841 | Ga0496109_0003841_520_1395 | 291 |
| 266 | 3300048913 | Ga0496110_0112124 | Ga0496110_0112124_164_1039 | 291 |
| 267 | 3300048913 | Ga0496110_0120687 | Ga0496110_0120687_966_1841 | 291 |
| 268 | 3300048915 | Ga0496112_0018585 | Ga0496112_0018585_2919_3794 | 291 |
| 269 | 3300048916 | Ga0496113_0018129 | Ga0496113_0018129_513_1388 | 291 |
| 270 | 3300049680 | Ga0501250_002121 | Ga0501250_002121_669_1544 | 291 |
| 271 | 3300049686 | Ga0501257_029744 | Ga0501257_029744_225_1100 | 291 |
| 272 | 3300049704 | Ga0501221_004678 | Ga0501221_004678_1208_2083 | 291 |
| 273 | 3300049706 | Ga0501229_006556 | Ga0501229_006556_287_1162 | 291 |
| 274 | 3300049760 | Ga0501263_012921 | Ga0501263_012921_68_943 | 291 |
| 275 | 3300049765 | Ga0501268_000563 | Ga0501268_000563_1292_2167 | 291 |
| 276 | 3300049767 | Ga0501270_001285 | Ga0501270_001285_299_1174 | 291 |
| 277 | 3300049770 | Ga0501273_002790 | Ga0501273_002790_425_1300 | 291 |
| 278 | 3300050511 | nmdc:mga08y16_103313_c1 | nmdc:mga08y16_103313_c1_168_1043 | 291 |
| 279 | 3300053134 | Ga0500658_0000173 | Ga0500658_0000173_887_1837 | 291 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3g4e-assembly1.cif.gz_A | crystal structure of human senescence marker protein-30(smp30)(calcium bound) | 0.9721 | 7 | 291 |
| 4gna-assembly1.cif.gz_A | mouse smp30/gnl-xylitol complex | 0.9662 | 7 | 291 |
| 7plc-assembly4.cif.gz_D | caulobacter crescentus xylonolactonase with d-xylose, p21 space group | 0.9638 | 7 | 290 |
| 2ghs-assembly1.cif.gz_A | crystal structure of a calcium-binding protein, regucalcin (agr_c_1268) from agrobacterium tumefaciens str. c58 at 1.55 a resolution | 0.9558 | 5 | 289 |
| 7plc-assembly4.cif.gz_D | caulobacter crescentus xylonolactonase with d-xylose, p21 space group | 0.9506 | 7 | 290 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6TLF6_1_295_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.9647 | 7 | 291 | 2.120.10.30 |
| 2ghsA00 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.9431 | 5 | 289 | 2.120.10.30 |
| af_Q6TLF6_1_295_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.9421 | 7 | 291 | 2.120.10.30 |
| 5xfeA00 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.9356 | 7 | 290 | 2.120.10.30 |
| af_Q54ZP3_33_320_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.9278 | 6 | 291 | 2.120.10.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X5Y303-F1-model_v4 | Sugar lactone lactonase YvrE | 0.9896 | 6 | 291 |
GO:0004341
GO:0005509 GO:0019853 |
| AF-A0A2D6PZI3-F1-model_v4 | Gluconolaconase | 0.9892 | 6 | 291 |
GO:0004341
GO:0005509 GO:0019853 |
| AF-A0A7Y4J7I3-F1-model_v4 | deleted | 0.9888 | 160 | 291 |
|
| AF-A0A520I4Q6-F1-model_v4 | SMP-30/gluconolactonase/LRE family protein | 0.9878 | 145 | 288 |
GO:0004341
GO:0005509 GO:0019853 |
| AF-A0A2A5D1M4-F1-model_v4 | Gluconolaconase | 0.9878 | 125 | 254 |
GO:0004341
GO:0005509 GO:0019853 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar