F383233

General Info

Members Datasets Scaffolds Average Seq Length
279 147 279 290

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0244826|Ga0466959_0244826_115_1074
Length 319
Sequence MRPLITENRLDATWLPVFFSADEAIPRLVSAESPVQCVADVHAVLGEGPVWVARETALYWLDIQGRKIFRLDSQGQRAEWPTPRRIGSLAPRRSGGFIGGTENGIAAIDPQAGRFDILFNPEEDKPGNRFNDGKLDRQGRFWAGTMDDAEKATTGTLYRIDADLSCRAIDSGYKVTNGPAFSPDGKLMYHNDSARSVTYVYDLNADGTATNRRVFLQFKDGEGHPDGMTVDADGCLWVCLWDGWAVRRYSPQGEWLETIKMPVQRPTSCTFGGRDLDRLYISSASKDLDDEARKMQPNAGALFMITPGVRGLADVPFAG

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
114 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
115 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
116 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
117 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
124 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
125 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
138 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
139 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
140 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
141 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
142 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
143 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
144 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
145 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 4.3
Rhizosphere 95.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10047117 3300001979 Bacteria 1261
2 JGI24751J29686_10019480 3300002459 Bacteria 1405
3 Ga0070658_10019049 3300005327 Bacteria 5497
4 Ga0070658_10120871 3300005327 Bacteria 2176
5 Ga0070676_10061747 3300005328 Bacteria 2228
6 Ga0070676_10135427 3300005328 Bacteria 1562
7 Ga0070683_100495432 3300005329 Bacteria 1167
8 Ga0068868_100022300 3300005338 Bacteria 4776
9 Ga0068868_100107438 3300005338 Bacteria 2265
10 Ga0070660_100004510 3300005339 Bacteria 9625
11 Ga0070660_100116599 3300005339 Bacteria 2129
12 Ga0070660_100226620 3300005339 Bacteria 1520
13 Ga0070660_100284873 3300005339 Bacteria 1352
14 Ga0070661_100035368 3300005344 Bacteria 3627
15 Ga0070661_100050609 3300005344 Bacteria 3040
16 Ga0070668_100007660 3300005347 Bacteria 8014
17 Ga0070669_100040262 3300005353 Bacteria 3397
18 Ga0070669_100100661 3300005353 Bacteria 2179
19 Ga0070669_100403815 3300005353 Bacteria 1118
20 Ga0070675_100190130 3300005354 Bacteria 1778
21 Ga0070671_100003781 3300005355 Bacteria 11876
22 Ga0070671_100031062 3300005355 Bacteria 4411
23 Ga0070671_100088453 3300005355 Bacteria 2592
24 Ga0070671_100131190 3300005355 Bacteria 2111
25 Ga0070674_100164823 3300005356 Bacteria 1685
26 Ga0070673_100017746 3300005364 Bacteria 5070
27 Ga0070673_100078291 3300005364 Bacteria 2674
28 Ga0070659_100060457 3300005366 Bacteria 2992
29 Ga0070659_100108797 3300005366 Bacteria 2237
30 Ga0070659_100298476 3300005366 Bacteria 1343
31 Ga0070659_100344302 3300005366 Bacteria 1250
32 Ga0070667_100003528 3300005367 Bacteria 13330
33 Ga0070667_100036328 3300005367 Bacteria 4130
34 Ga0070667_100182895 3300005367 Bacteria 1854
35 Ga0070694_100018841 3300005444 Bacteria 4385
36 Ga0070663_100006862 3300005455 Bacteria 6890
37 Ga0070663_100020110 3300005455 Bacteria 4415
38 Ga0070663_100100191 3300005455 Bacteria 2161
39 Ga0070663_100303471 3300005455 Bacteria 1279
40 Ga0070662_100087724 3300005457 Bacteria 2330
41 Ga0070662_100099830 3300005457 Bacteria 2195
42 Ga0070662_100141587 3300005457 Bacteria 1864
43 Ga0068867_100028424 3300005459 Bacteria 4026
44 Ga0070679_100254026 3300005530 Bacteria 1713
45 Ga0070679_100361954 3300005530 Bacteria 1398
46 Ga0070679_100575180 3300005530 Bacteria 1070
47 Ga0068853_100092743 3300005539 Bacteria 2657
48 Ga0068853_100110128 3300005539 Bacteria 2445
49 Ga0068853_100311237 3300005539 Bacteria 1458
50 Ga0070672_100038689 3300005543 Bacteria 3647
51 Ga0070672_100489831 3300005543 Bacteria 1062
52 Ga0070695_100008351 3300005545 Bacteria 6143
53 Ga0070696_100003105 3300005546 Bacteria 11047
54 Ga0070693_100119749 3300005547 Bacteria 1631
55 Ga0068855_100534231 3300005563 Bacteria 1271
56 Ga0068855_100586295 3300005563 Bacteria 1204
57 Ga0070664_100009377 3300005564 Bacteria 7936
58 Ga0070664_100052331 3300005564 Bacteria 3458
59 Ga0070664_100333724 3300005564 Bacteria 1376
60 Ga0068854_100016808 3300005578 Bacteria 4883
61 Ga0068852_100141018 3300005616 Bacteria 2230
62 Ga0068852_100608527 3300005616 Bacteria 1097
63 Ga0068859_100022894 3300005617 Bacteria 6264
64 Ga0068859_100116252 3300005617 Bacteria 2739
65 Ga0068859_100625068 3300005617 Bacteria 1170
66 Ga0068864_100000291 3300005618 Bacteria 44522
67 Ga0068864_100001458 3300005618 Bacteria 19498
68 Ga0068861_100412131 3300005719 Bacteria 1202
69 Ga0068851_10003637 3300005834 Bacteria 6881
70 Ga0068851_10073600 3300005834 Bacteria 1772
71 Ga0068863_100000816 3300005841 Bacteria 31200
72 Ga0068863_100114124 3300005841 Bacteria 2574
73 Ga0068858_100002150 3300005842 Bacteria 19979
74 Ga0068860_100001926 3300005843 Bacteria 21977
75 Ga0068860_100017319 3300005843 Bacteria 7020
76 Ga0068860_100232816 3300005843 Bacteria 1790
77 Ga0068862_100016468 3300005844 Bacteria 6153
78 Ga0068862_100059667 3300005844 Bacteria 3276
79 Ga0097621_100107561 3300006237 Bacteria 2353
80 Ga0097621_100505714 3300006237 Bacteria 1095
81 Ga0068871_100140425 3300006358 Bacteria 2054
82 Ga0068871_100366704 3300006358 Bacteria 1277
83 Ga0068865_100005327 3300006881 Bacteria 7788
84 Ga0068865_100016371 3300006881 Bacteria 4744
85 Ga0097620_100022895 3300006931 Bacteria 6264
86 Ga0097620_100116267 3300006931 Bacteria 2739
87 Ga0097620_100625080 3300006931 Bacteria 1170
88 Ga0105251_10018248 3300009011 Bacteria 3735
89 Ga0105250_10020677 3300009092 Bacteria 2659
90 Ga0111539_10089126 3300009094 Bacteria 3625
91 Ga0105243_10114036 3300009148 Bacteria 2267
92 Ga0105241_10073410 3300009174 Bacteria 2661
93 Ga0105248_10000123 3300009177 Bacteria 89301
94 Ga0105248_10001489 3300009177 Bacteria 26067
95 Ga0105249_10081940 3300009553 Bacteria 3001
96 Ga0157373_10051806 3300013100 Bacteria 2922
97 Ga0157373_10065134 3300013100 Bacteria 2579
98 Ga0157373_10099593 3300013100 Bacteria 2045
99 Ga0157371_10029402 3300013102 Bacteria 3974
100 Ga0157370_10027228 3300013104 Bacteria 5637
101 Ga0157370_10358918 3300013104 Bacteria 1343
102 Ga0157374_10179125 3300013296 Bacteria 2070
103 Ga0157374_10183091 3300013296 Bacteria 2047
104 Ga0157378_10383703 3300013297 Bacteria 1380
105 Ga0163162_10226300 3300013306 Bacteria 2000
106 Ga0157375_10102029 3300013308 Bacteria 2953
107 Ga0157375_10114472 3300013308 Bacteria 2799
108 Ga0157375_10290682 3300013308 Bacteria 1797
109 Ga0163163_10002107 3300014325 Bacteria 16792
110 Ga0157379_10002249 3300014968 Bacteria 16076
111 Ga0207696_1024031 3300025711 Bacteria 1914
112 Ga0207680_10037306 3300025903 Bacteria 2805
113 Ga0207645_10016623 3300025907 Bacteria 4867
114 Ga0207645_10063393 3300025907 Bacteria 2362
115 Ga0207705_10006422 3300025909 Bacteria 8707
116 Ga0207705_10011481 3300025909 Bacteria 6406
117 Ga0207705_10019940 3300025909 Bacteria 4796
118 Ga0207705_10099943 3300025909 Bacteria 2133
119 Ga0207660_10479375 3300025917 Bacteria 1008
120 Ga0207657_10000267 3300025919 Bacteria 55426
121 Ga0207657_10009316 3300025919 Bacteria 9888
122 Ga0207657_10042503 3300025919 Bacteria 4009
123 Ga0207657_10072964 3300025919 Bacteria 2902
124 Ga0207657_10132061 3300025919 Bacteria 2046
125 Ga0207657_10138042 3300025919 Bacteria 1994
126 Ga0207657_10200931 3300025919 Bacteria 1603
127 Ga0207657_10251387 3300025919 Bacteria 1409
128 Ga0207652_10133361 3300025921 Bacteria 2216
129 Ga0207652_10373178 3300025921 Bacteria 1288
130 Ga0207681_10097271 3300025923 Bacteria 2115
131 Ga0207681_10290527 3300025923 Bacteria 1290
132 Ga0207694_10492308 3300025924 Bacteria 1026
133 Ga0207659_10042746 3300025926 Bacteria 3179
134 Ga0207644_10000954 3300025931 Bacteria 18456
135 Ga0207644_10020085 3300025931 Bacteria 4538
136 Ga0207644_10102729 3300025931 Bacteria 2150
137 Ga0207644_10229293 3300025931 Bacteria 1475
138 Ga0207690_10030566 3300025932 Bacteria 3437
139 Ga0207690_10164927 3300025932 Bacteria 1655
140 Ga0207690_10176131 3300025932 Bacteria 1606
141 Ga0207690_10214678 3300025932 Bacteria 1469
142 Ga0207706_10010395 3300025933 Bacteria 8502
143 Ga0207706_10062451 3300025933 Bacteria 3280
144 Ga0207706_10260468 3300025933 Bacteria 1514
145 Ga0207706_10321814 3300025933 Bacteria 1346
146 Ga0207669_10081980 3300025937 Bacteria 2069
147 Ga0207669_10217508 3300025937 Bacteria 1399
148 Ga0207691_10153581 3300025940 Bacteria 2023
149 Ga0207691_10228885 3300025940 Bacteria 1610
150 Ga0207691_10236040 3300025940 Bacteria 1582
151 Ga0207711_10000100 3300025941 Bacteria 91024
152 Ga0207711_10005132 3300025941 Bacteria 11104
153 Ga0207711_10096526 3300025941 Bacteria 2609
154 Ga0207711_10097343 3300025941 Bacteria 2598
155 Ga0207711_10247626 3300025941 Bacteria 1635
156 Ga0207689_10181318 3300025942 Bacteria 1736
157 Ga0207661_10343166 3300025944 Bacteria 1346
158 Ga0207679_10007146 3300025945 Bacteria 7071
159 Ga0207667_10190369 3300025949 Bacteria 2105
160 Ga0207651_10073858 3300025960 Bacteria 2426
161 Ga0207651_10522921 3300025960 Bacteria 1028
162 Ga0207712_10321757 3300025961 Bacteria 1276
163 Ga0207668_10000080 3300025972 Bacteria 72198
164 Ga0207668_10011413 3300025972 Bacteria 5397
165 Ga0207668_10242048 3300025972 Bacteria 1460
166 Ga0207640_10287913 3300025981 Bacteria 1294
167 Ga0207658_10003101 3300025986 Bacteria 11895
168 Ga0207658_10005467 3300025986 Bacteria 8714
169 Ga0207658_10098828 3300025986 Bacteria 2281
170 Ga0207658_10368894 3300025986 Bacteria 1254
171 Ga0207677_10216676 3300026023 Bacteria 1532
172 Ga0207703_10019609 3300026035 Bacteria 5285
173 Ga0207639_10064641 3300026041 Bacteria 2837
174 Ga0207639_10065283 3300026041 Bacteria 2825
175 Ga0207639_10520452 3300026041 Bacteria 1089
176 Ga0207678_10015898 3300026067 Bacteria 6611
177 Ga0207678_10020554 3300026067 Bacteria 5788
178 Ga0207678_10036410 3300026067 Bacteria 4283
179 Ga0207641_10000221 3300026088 Bacteria 74390
180 Ga0207648_10008887 3300026089 Bacteria 9672
181 Ga0207648_10110602 3300026089 Bacteria 2412
182 Ga0207676_10003162 3300026095 Bacteria 11751
183 Ga0207676_10023058 3300026095 Bacteria 4585
184 Ga0207674_10062411 3300026116 Bacteria 3764
185 Ga0207675_100116048 3300026118 Bacteria 2530
186 Ga0207675_100429333 3300026118 Bacteria 1306
187 Ga0207683_10064992 3300026121 Bacteria 3216
188 Ga0207698_10100364 3300026142 Bacteria 2397
189 Ga0207698_10316446 3300026142 Bacteria 1460
190 Ga0268266_10160959 3300028379 Bacteria 2031
191 Ga0268265_10002770 3300028380 Bacteria 12931
192 Ga0268265_10220436 3300028380 Bacteria 1659
193 Ga0268264_10001272 3300028381 Bacteria 23913
194 Ga0268264_10003351 3300028381 Bacteria 13846
195 Ga0268264_10049208 3300028381 Bacteria 3506
196 Ga0307408_100119598 3300031548 Bacteria 2039
197 Ga0307413_10058348 3300031824 Bacteria 2365
198 Ga0307413_10065356 3300031824 Bacteria 2265
199 Ga0307413_10106963 3300031824 Bacteria 1863
200 Ga0307410_10094739 3300031852 Bacteria 2127
201 Ga0307410_10154045 3300031852 Bacteria 1714
202 Ga0307410_10251760 3300031852 Bacteria 1373
203 Ga0307410_10252280 3300031852 Bacteria 1372
204 Ga0307406_10053713 3300031901 Bacteria 2567
205 Ga0307406_10122632 3300031901 Bacteria 1810
206 Ga0307406_10134605 3300031901 Bacteria 1740
207 Ga0307407_10203087 3300031903 Bacteria 1329
208 Ga0307409_100006386 3300031995 Bacteria 6921
209 Ga0307409_100135046 3300031995 Bacteria 2115
210 Ga0307409_100139133 3300031995 Bacteria 2088
211 Ga0307409_100196791 3300031995 Bacteria 1799
212 Ga0307409_100611494 3300031995 Bacteria 1078
213 Ga0307416_100001051 3300032002 Bacteria 14704
214 Ga0307414_10056260 3300032004 Bacteria 2758
215 Ga0307414_10102893 3300032004 Bacteria 2153
216 Ga0307414_10291195 3300032004 Bacteria 1376
217 Ga0307411_10030684 3300032005 Bacteria 3298
218 Ga0307411_10038930 3300032005 Bacteria 3004
219 Ga0307411_10091737 3300032005 Bacteria 2122
220 Ga0307411_10173851 3300032005 Bacteria 1627
221 Ga0307411_10245888 3300032005 Bacteria 1403
222 Ga0307415_100385332 3300032126 Bacteria 1192
223 Ga0395899_0005357 3300037312 Bacteria 9967
224 Ga0395900_0000447 3300037418 Bacteria 59069
225 Ga0395898_0005900 3300037466 Bacteria 13169
226 Ga0395898_0008790 3300037466 Bacteria 10643
227 Ga0395898_0165010 3300037466 Bacteria 2118
228 Ga0395905_0000974 3300037471 Bacteria 36725
229 Ga0395905_0028956 3300037471 Bacteria 5220
230 Ga0395905_0081425 3300037471 Bacteria 3034
231 Ga0395905_0150459 3300037471 Bacteria 2190
232 Ga0395905_0173985 3300037471 Bacteria 2022
233 Ga0395901_0000324 3300038443 Bacteria 59134
234 Ga0395901_0099105 3300038443 Bacteria 3055
235 Ga0395901_0251129 3300038443 Bacteria 1842
236 Ga0439432_018925 3300042006 Bacteria 2298
237 Ga0450917_000833 3300042120 Bacteria 2269
238 Ga0450890_007322 3300042127 Bacteria 1409
239 Ga0450905_002764 3300042142 Bacteria 2274
240 Ga0450889_000635 3300042144 Bacteria 3884
241 Ga0466963_0062116 3300044694 Bacteria 2499
242 Ga0466970_0039058 3300044765 Bacteria 2519
243 Ga0466959_0244826 3300045049 Bacteria 1237
244 Ga0466958_0113642 3300045836 Bacteria 1691
245 Ga0466967_0047831 3300045976 Bacteria 3731
246 Ga0466967_0079237 3300045976 Bacteria 2961
247 Ga0466967_0091727 3300045976 Bacteria 2761
248 Ga0466967_0245065 3300045976 Bacteria 1710
249 Ga0495663_0011388 3300046525 Bacteria 2475
250 Ga0495642_0082917 3300046528 Bacteria 1352
251 Ga0495621_0038545 3300046539 Bacteria 1668
252 Ga0495669_0029822 3300046684 Bacteria 2393
253 Ga0495669_0032910 3300046684 Bacteria 2280
254 Ga0495669_0169556 3300046684 Bacteria 1038
255 Ga0495670_0130965 3300046691 Bacteria 1307
256 Ga0495677_0011983 3300047445 Bacteria 3164
257 Ga0496105_0106791 3300048908 Bacteria 2311
258 Ga0496107_0067643 3300048910 Bacteria 2592
259 Ga0496108_0021480 3300048911 Bacteria 5305
260 Ga0496108_0022113 3300048911 Bacteria 5228
261 Ga0496109_0003841 3300048912 Bacteria 12548
262 Ga0496109_0762982 3300048912 Bacteria 905
263 Ga0496110_0112124 3300048913 Bacteria 2452
264 Ga0496110_0120687 3300048913 Bacteria 2361
265 Ga0496112_0018585 3300048915 Bacteria 6549
266 Ga0496112_0116106 3300048915 Bacteria 2647
267 Ga0496113_0018129 3300048916 Bacteria 4899
268 Ga0496115_0000691 3300048918 Bacteria 25050
269 Ga0501250_002121 3300049680 Bacteria 1757
270 Ga0501257_029744 3300049686 Bacteria 1313
271 Ga0501221_004678 3300049704 Bacteria 2271
272 Ga0501225_0019653 3300049705 Bacteria 1869
273 Ga0501229_006556 3300049706 Bacteria 1440
274 Ga0501263_012921 3300049760 Bacteria 1052
275 Ga0501268_000563 3300049765 Bacteria 4104
276 Ga0501270_001285 3300049767 Bacteria 2368
277 Ga0501273_002790 3300049770 Bacteria 1807
278 nmdc:mga08y16_103313_c1 3300050511 Bacteria 2967
279 Ga0500658_0000173 3300053134 Bacteria 30720

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013296 Ga0157374_10183091 Ga0157374_101830911 252
2 3300042120 Ga0450917_000833 Ga0450917_000833_1313_2128 263
3 3300049705 Ga0501225_0019653 Ga0501225_0019653_942_1835 263
4 3300037471 Ga0395905_0150459 Ga0395905_0150459_951_1805 265
5 3300048908 Ga0496105_0106791 Ga0496105_0106791_563_1417 265
6 3300046684 Ga0495669_0169556 Ga0495669_0169556_17_820 267
7 3300048912 Ga0496109_0762982 Ga0496109_0762982_85_888 267
8 3300005355 Ga0070671_100003781 Ga0070671_1000037819 271
9 3300048911 Ga0496108_0022113 Ga0496108_0022113_1567_2439 271
10 3300002459 JGI24751J29686_10019480 JGI24751J29686_100194802 275
11 3300046525 Ga0495663_0011388 Ga0495663_0011388_890_1765 279
12 3300046528 Ga0495642_0082917 Ga0495642_0082917_173_1048 279
13 3300046539 Ga0495621_0038545 Ga0495621_0038545_102_977 279
14 3300046684 Ga0495669_0029822 Ga0495669_0029822_467_1342 279
15 3300047445 Ga0495677_0011983 Ga0495677_0011983_1712_2587 279
16 3300038443 Ga0395901_0251129 Ga0395901_0251129_19_867 282
17 3300045976 Ga0466967_0091727 Ga0466967_0091727_152_1006 284
18 3300025903 Ga0207680_10037306 Ga0207680_100373062 287
19 3300025972 Ga0207668_10242048 Ga0207668_102420482 287
20 3300025986 Ga0207658_10098828 Ga0207658_100988282 287
21 3300005328 Ga0070676_10061747 Ga0070676_100617472 288
22 3300005338 Ga0068868_100107438 Ga0068868_1001074382 288
23 3300005347 Ga0070668_100007660 Ga0070668_1000076607 288
24 3300005353 Ga0070669_100100661 Ga0070669_1001006613 288
25 3300005353 Ga0070669_100403815 Ga0070669_1004038151 288
26 3300005367 Ga0070667_100182895 Ga0070667_1001828951 288
27 3300005455 Ga0070663_100100191 Ga0070663_1001001912 288
28 3300005459 Ga0068867_100028424 Ga0068867_1000284244 288
29 3300005543 Ga0070672_100489831 Ga0070672_1004898311 288
30 3300005563 Ga0068855_100534231 Ga0068855_1005342311 288
31 3300005564 Ga0070664_100052331 Ga0070664_1000523312 288
32 3300005617 Ga0068859_100625068 Ga0068859_1006250681 288
33 3300005834 Ga0068851_10003637 Ga0068851_100036378 288
34 3300005843 Ga0068860_100017319 Ga0068860_1000173196 288
35 3300005844 Ga0068862_100059667 Ga0068862_1000596672 288
36 3300006881 Ga0068865_100016371 Ga0068865_1000163712 288
37 3300006931 Ga0097620_100625080 Ga0097620_1006250802 288
38 3300025907 Ga0207645_10016623 Ga0207645_100166236 288
39 3300025909 Ga0207705_10011481 Ga0207705_100114813 288
40 3300025919 Ga0207657_10009316 Ga0207657_100093162 288
41 3300025937 Ga0207669_10217508 Ga0207669_102175082 288
42 3300025940 Ga0207691_10236040 Ga0207691_102360402 288
43 3300025941 Ga0207711_10097343 Ga0207711_100973432 288
44 3300025944 Ga0207661_10343166 Ga0207661_103431662 288
45 3300025960 Ga0207651_10073858 Ga0207651_100738583 288
46 3300025960 Ga0207651_10522921 Ga0207651_105229211 288
47 3300025972 Ga0207668_10000080 Ga0207668_1000008032 288
48 3300025986 Ga0207658_10368894 Ga0207658_103688942 288
49 3300026041 Ga0207639_10064641 Ga0207639_100646412 288
50 3300026067 Ga0207678_10015898 Ga0207678_100158987 288
51 3300026089 Ga0207648_10008887 Ga0207648_100088876 288
52 3300026118 Ga0207675_100116048 Ga0207675_1001160482 288
53 3300026121 Ga0207683_10064992 Ga0207683_100649922 288
54 3300026142 Ga0207698_10100364 Ga0207698_101003643 288
55 3300028380 Ga0268265_10002770 Ga0268265_100027702 288
56 3300028381 Ga0268264_10003351 Ga0268264_100033512 288
57 3300005367 Ga0070667_100036328 Ga0070667_1000363284 289
58 3300031852 Ga0307410_10252280 Ga0307410_102522802 289
59 3300031901 Ga0307406_10122632 Ga0307406_101226322 289
60 3300031903 Ga0307407_10203087 Ga0307407_102030872 289
61 3300032005 Ga0307411_10173851 Ga0307411_101738512 289
62 3300005327 Ga0070658_10019049 Ga0070658_100190494 290
63 3300005327 Ga0070658_10120871 Ga0070658_101208712 290
64 3300005329 Ga0070683_100495432 Ga0070683_1004954321 290
65 3300005339 Ga0070660_100004510 Ga0070660_10000451011 290
66 3300005344 Ga0070661_100035368 Ga0070661_1000353684 290
67 3300005366 Ga0070659_100344302 Ga0070659_1003443021 290
68 3300005455 Ga0070663_100006862 Ga0070663_1000068623 290
69 3300005457 Ga0070662_100099830 Ga0070662_1000998302 290
70 3300005530 Ga0070679_100361954 Ga0070679_1003619542 290
71 3300005539 Ga0068853_100092743 Ga0068853_1000927432 290
72 3300005539 Ga0068853_100311237 Ga0068853_1003112372 290
73 3300005616 Ga0068852_100141018 Ga0068852_1001410183 290
74 3300013104 Ga0157370_10027228 Ga0157370_100272286 290
75 3300013296 Ga0157374_10179125 Ga0157374_101791252 290
76 3300013297 Ga0157378_10383703 Ga0157378_103837031 290
77 3300025909 Ga0207705_10006422 Ga0207705_100064227 290
78 3300025917 Ga0207660_10479375 Ga0207660_104793751 290
79 3300025919 Ga0207657_10132061 Ga0207657_101320612 290
80 3300025932 Ga0207690_10176131 Ga0207690_101761312 290
81 3300026142 Ga0207698_10316446 Ga0207698_103164462 290
82 3300028379 Ga0268266_10160959 Ga0268266_101609592 290
83 3300031824 Ga0307413_10065356 Ga0307413_100653562 290
84 3300031824 Ga0307413_10106963 Ga0307413_101069632 290
85 3300031852 Ga0307410_10154045 Ga0307410_101540452 290
86 3300031995 Ga0307409_100196791 Ga0307409_1001967912 290
87 3300032004 Ga0307414_10056260 Ga0307414_100562602 290
88 3300032005 Ga0307411_10038930 Ga0307411_100389302 290
89 3300044765 Ga0466970_0039058 Ga0466970_0039058_1382_2323 290
90 3300045976 Ga0466967_0079237 Ga0466967_0079237_381_1283 290
91 3300048915 Ga0496112_0116106 Ga0496112_0116106_1026_1898 290
92 3300048918 Ga0496115_0000691 Ga0496115_0000691_4508_5380 290
93 3300001979 JGI24740J21852_10047117 JGI24740J21852_100471172 291
94 3300005328 Ga0070676_10135427 Ga0070676_101354272 291
95 3300005338 Ga0068868_100022300 Ga0068868_1000223002 291
96 3300005339 Ga0070660_100116599 Ga0070660_1001165992 291
97 3300005339 Ga0070660_100226620 Ga0070660_1002266202 291
98 3300005339 Ga0070660_100284873 Ga0070660_1002848731 291
99 3300005344 Ga0070661_100050609 Ga0070661_1000506092 291
100 3300005353 Ga0070669_100040262 Ga0070669_1000402624 291
101 3300005354 Ga0070675_100190130 Ga0070675_1001901302 291
102 3300005355 Ga0070671_100031062 Ga0070671_1000310625 291
103 3300005355 Ga0070671_100088453 Ga0070671_1000884532 291
104 3300005355 Ga0070671_100131190 Ga0070671_1001311902 291
105 3300005356 Ga0070674_100164823 Ga0070674_1001648232 291
106 3300005364 Ga0070673_100017746 Ga0070673_1000177466 291
107 3300005364 Ga0070673_100078291 Ga0070673_1000782912 291
108 3300005366 Ga0070659_100060457 Ga0070659_1000604572 291
109 3300005366 Ga0070659_100108797 Ga0070659_1001087973 291
110 3300005366 Ga0070659_100298476 Ga0070659_1002984761 291
111 3300005367 Ga0070667_100003528 Ga0070667_1000035286 291
112 3300005444 Ga0070694_100018841 Ga0070694_1000188415 291
113 3300005455 Ga0070663_100020110 Ga0070663_1000201102 291
114 3300005455 Ga0070663_100303471 Ga0070663_1003034712 291
115 3300005457 Ga0070662_100087724 Ga0070662_1000877241 291
116 3300005457 Ga0070662_100141587 Ga0070662_1001415872 291
117 3300005530 Ga0070679_100254026 Ga0070679_1002540262 291
118 3300005530 Ga0070679_100575180 Ga0070679_1005751801 291
119 3300005539 Ga0068853_100110128 Ga0068853_1001101282 291
120 3300005543 Ga0070672_100038689 Ga0070672_1000386892 291
121 3300005545 Ga0070695_100008351 Ga0070695_1000083512 291
122 3300005546 Ga0070696_100003105 Ga0070696_10000310511 291
123 3300005547 Ga0070693_100119749 Ga0070693_1001197492 291
124 3300005563 Ga0068855_100586295 Ga0068855_1005862952 291
125 3300005564 Ga0070664_100009377 Ga0070664_1000093777 291
126 3300005564 Ga0070664_100333724 Ga0070664_1003337241 291
127 3300005578 Ga0068854_100016808 Ga0068854_1000168083 291
128 3300005616 Ga0068852_100608527 Ga0068852_1006085272 291
129 3300005617 Ga0068859_100022894 Ga0068859_1000228947 291
130 3300005617 Ga0068859_100116252 Ga0068859_1001162522 291
131 3300005618 Ga0068864_100000291 Ga0068864_10000029144 291
132 3300005618 Ga0068864_100001458 Ga0068864_1000014583 291
133 3300005719 Ga0068861_100412131 Ga0068861_1004121312 291
134 3300005834 Ga0068851_10073600 Ga0068851_100736002 291
135 3300005841 Ga0068863_100000816 Ga0068863_10000081624 291
136 3300005841 Ga0068863_100114124 Ga0068863_1001141242 291
137 3300005842 Ga0068858_100002150 Ga0068858_1000021502 291
138 3300005843 Ga0068860_100001926 Ga0068860_10000192611 291
139 3300005843 Ga0068860_100232816 Ga0068860_1002328162 291
140 3300005844 Ga0068862_100016468 Ga0068862_1000164686 291
141 3300006237 Ga0097621_100107561 Ga0097621_1001075611 291
142 3300006237 Ga0097621_100505714 Ga0097621_1005057141 291
143 3300006358 Ga0068871_100140425 Ga0068871_1001404251 291
144 3300006358 Ga0068871_100366704 Ga0068871_1003667042 291
145 3300006881 Ga0068865_100005327 Ga0068865_1000053271 291
146 3300006931 Ga0097620_100022895 Ga0097620_1000228957 291
147 3300006931 Ga0097620_100116267 Ga0097620_1001162672 291
148 3300009011 Ga0105251_10018248 Ga0105251_100182483 291
149 3300009092 Ga0105250_10020677 Ga0105250_100206773 291
150 3300009094 Ga0111539_10089126 Ga0111539_100891261 291
151 3300009148 Ga0105243_10114036 Ga0105243_101140363 291
152 3300009174 Ga0105241_10073410 Ga0105241_100734102 291
153 3300009177 Ga0105248_10000123 Ga0105248_1000012326 291
154 3300009177 Ga0105248_10001489 Ga0105248_1000148919 291
155 3300009553 Ga0105249_10081940 Ga0105249_100819402 291
156 3300013100 Ga0157373_10051806 Ga0157373_100518063 291
157 3300013100 Ga0157373_10065134 Ga0157373_100651343 291
158 3300013100 Ga0157373_10099593 Ga0157373_100995932 291
159 3300013102 Ga0157371_10029402 Ga0157371_100294025 291
160 3300013104 Ga0157370_10358918 Ga0157370_103589182 291
161 3300013306 Ga0163162_10226300 Ga0163162_102263002 291
162 3300013308 Ga0157375_10102029 Ga0157375_101020291 291
163 3300013308 Ga0157375_10114472 Ga0157375_101144722 291
164 3300013308 Ga0157375_10290682 Ga0157375_102906822 291
165 3300014325 Ga0163163_10002107 Ga0163163_1000210717 291
166 3300014968 Ga0157379_10002249 Ga0157379_100022492 291
167 3300025711 Ga0207696_1024031 Ga0207696_10240312 291
168 3300025907 Ga0207645_10063393 Ga0207645_100633932 291
169 3300025909 Ga0207705_10019940 Ga0207705_100199403 291
170 3300025909 Ga0207705_10099943 Ga0207705_100999432 291
171 3300025919 Ga0207657_10000267 Ga0207657_100002678 291
172 3300025919 Ga0207657_10042503 Ga0207657_100425035 291
173 3300025919 Ga0207657_10072964 Ga0207657_100729643 291
174 3300025919 Ga0207657_10138042 Ga0207657_101380422 291
175 3300025919 Ga0207657_10200931 Ga0207657_102009312 291
176 3300025919 Ga0207657_10251387 Ga0207657_102513872 291
177 3300025921 Ga0207652_10133361 Ga0207652_101333612 291
178 3300025921 Ga0207652_10373178 Ga0207652_103731782 291
179 3300025923 Ga0207681_10097271 Ga0207681_100972712 291
180 3300025923 Ga0207681_10290527 Ga0207681_102905272 291
181 3300025924 Ga0207694_10492308 Ga0207694_104923082 291
182 3300025926 Ga0207659_10042746 Ga0207659_100427463 291
183 3300025931 Ga0207644_10000954 Ga0207644_1000095412 291
184 3300025931 Ga0207644_10020085 Ga0207644_100200852 291
185 3300025931 Ga0207644_10102729 Ga0207644_101027292 291
186 3300025931 Ga0207644_10229293 Ga0207644_102292932 291
187 3300025932 Ga0207690_10030566 Ga0207690_100305661 291
188 3300025932 Ga0207690_10164927 Ga0207690_101649272 291
189 3300025932 Ga0207690_10214678 Ga0207690_102146782 291
190 3300025933 Ga0207706_10010395 Ga0207706_100103956 291
191 3300025933 Ga0207706_10062451 Ga0207706_100624514 291
192 3300025933 Ga0207706_10260468 Ga0207706_102604682 291
193 3300025933 Ga0207706_10321814 Ga0207706_103218142 291
194 3300025937 Ga0207669_10081980 Ga0207669_100819802 291
195 3300025940 Ga0207691_10153581 Ga0207691_101535812 291
196 3300025940 Ga0207691_10228885 Ga0207691_102288852 291
197 3300025941 Ga0207711_10000100 Ga0207711_1000010028 291
198 3300025941 Ga0207711_10005132 Ga0207711_1000513212 291
199 3300025941 Ga0207711_10096526 Ga0207711_100965262 291
200 3300025941 Ga0207711_10247626 Ga0207711_102476262 291
201 3300025942 Ga0207689_10181318 Ga0207689_101813182 291
202 3300025945 Ga0207679_10007146 Ga0207679_100071468 291
203 3300025949 Ga0207667_10190369 Ga0207667_101903693 291
204 3300025961 Ga0207712_10321757 Ga0207712_103217572 291
205 3300025972 Ga0207668_10011413 Ga0207668_100114137 291
206 3300025981 Ga0207640_10287913 Ga0207640_102879132 291
207 3300025986 Ga0207658_10003101 Ga0207658_100031012 291
208 3300025986 Ga0207658_10005467 Ga0207658_100054672 291
209 3300026023 Ga0207677_10216676 Ga0207677_102166762 291
210 3300026035 Ga0207703_10019609 Ga0207703_100196096 291
211 3300026041 Ga0207639_10065283 Ga0207639_100652833 291
212 3300026041 Ga0207639_10520452 Ga0207639_105204522 291
213 3300026067 Ga0207678_10020554 Ga0207678_100205547 291
214 3300026067 Ga0207678_10036410 Ga0207678_100364104 291
215 3300026088 Ga0207641_10000221 Ga0207641_1000022127 291
216 3300026089 Ga0207648_10110602 Ga0207648_101106022 291
217 3300026095 Ga0207676_10003162 Ga0207676_100031628 291
218 3300026095 Ga0207676_10023058 Ga0207676_100230582 291
219 3300026116 Ga0207674_10062411 Ga0207674_100624115 291
220 3300026118 Ga0207675_100429333 Ga0207675_1004293332 291
221 3300028380 Ga0268265_10220436 Ga0268265_102204361 291
222 3300028381 Ga0268264_10001272 Ga0268264_100012723 291
223 3300028381 Ga0268264_10049208 Ga0268264_100492083 291
224 3300031548 Ga0307408_100119598 Ga0307408_1001195982 291
225 3300031824 Ga0307413_10058348 Ga0307413_100583482 291
226 3300031852 Ga0307410_10094739 Ga0307410_100947392 291
227 3300031852 Ga0307410_10251760 Ga0307410_102517602 291
228 3300031901 Ga0307406_10053713 Ga0307406_100537133 291
229 3300031901 Ga0307406_10134605 Ga0307406_101346052 291
230 3300031995 Ga0307409_100006386 Ga0307409_1000063863 291
231 3300031995 Ga0307409_100135046 Ga0307409_1001350462 291
232 3300031995 Ga0307409_100139133 Ga0307409_1001391331 291
233 3300031995 Ga0307409_100611494 Ga0307409_1006114942 291
234 3300032002 Ga0307416_100001051 Ga0307416_1000010512 291
235 3300032004 Ga0307414_10102893 Ga0307414_101028932 291
236 3300032004 Ga0307414_10291195 Ga0307414_102911952 291
237 3300032005 Ga0307411_10030684 Ga0307411_100306842 291
238 3300032005 Ga0307411_10091737 Ga0307411_100917372 291
239 3300032005 Ga0307411_10245888 Ga0307411_102458882 291
240 3300032126 Ga0307415_100385332 Ga0307415_1003853322 291
241 3300037312 Ga0395899_0005357 Ga0395899_0005357_3379_4266 291
242 3300037418 Ga0395900_0000447 Ga0395900_0000447_53146_54033 291
243 3300037466 Ga0395898_0005900 Ga0395898_0005900_6653_7540 291
244 3300037466 Ga0395898_0008790 Ga0395898_0008790_826_1701 291
245 3300037466 Ga0395898_0165010 Ga0395898_0165010_46_921 291
246 3300037471 Ga0395905_0000974 Ga0395905_0000974_31548_32423 291
247 3300037471 Ga0395905_0028956 Ga0395905_0028956_1340_2215 291
248 3300037471 Ga0395905_0081425 Ga0395905_0081425_1801_2760 291
249 3300037471 Ga0395905_0173985 Ga0395905_0173985_185_1072 291
250 3300038443 Ga0395901_0000324 Ga0395901_0000324_53178_54065 291
251 3300038443 Ga0395901_0099105 Ga0395901_0099105_1355_2230 291
252 3300042006 Ga0439432_018925 Ga0439432_018925_1287_2162 291
253 3300042127 Ga0450890_007322 Ga0450890_007322_446_1321 291
254 3300042142 Ga0450905_002764 Ga0450905_002764_11_886 291
255 3300042144 Ga0450889_000635 Ga0450889_000635_388_1263 291
256 3300044694 Ga0466963_0062116 Ga0466963_0062116_1255_2130 291
257 3300045049 Ga0466959_0244826 Ga0466959_0244826_115_1074 291
258 3300045836 Ga0466958_0113642 Ga0466958_0113642_403_1362 291
259 3300045976 Ga0466967_0047831 Ga0466967_0047831_2584_3486 291
260 3300045976 Ga0466967_0245065 Ga0466967_0245065_203_1078 291
261 3300046684 Ga0495669_0032910 Ga0495669_0032910_927_1802 291
262 3300046691 Ga0495670_0130965 Ga0495670_0130965_253_1128 291
263 3300048910 Ga0496107_0067643 Ga0496107_0067643_1450_2325 291
264 3300048911 Ga0496108_0021480 Ga0496108_0021480_250_1125 291
265 3300048912 Ga0496109_0003841 Ga0496109_0003841_520_1395 291
266 3300048913 Ga0496110_0112124 Ga0496110_0112124_164_1039 291
267 3300048913 Ga0496110_0120687 Ga0496110_0120687_966_1841 291
268 3300048915 Ga0496112_0018585 Ga0496112_0018585_2919_3794 291
269 3300048916 Ga0496113_0018129 Ga0496113_0018129_513_1388 291
270 3300049680 Ga0501250_002121 Ga0501250_002121_669_1544 291
271 3300049686 Ga0501257_029744 Ga0501257_029744_225_1100 291
272 3300049704 Ga0501221_004678 Ga0501221_004678_1208_2083 291
273 3300049706 Ga0501229_006556 Ga0501229_006556_287_1162 291
274 3300049760 Ga0501263_012921 Ga0501263_012921_68_943 291
275 3300049765 Ga0501268_000563 Ga0501268_000563_1292_2167 291
276 3300049767 Ga0501270_001285 Ga0501270_001285_299_1174 291
277 3300049770 Ga0501273_002790 Ga0501273_002790_425_1300 291
278 3300050511 nmdc:mga08y16_103313_c1 nmdc:mga08y16_103313_c1_168_1043 291
279 3300053134 Ga0500658_0000173 Ga0500658_0000173_887_1837 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08450

SGL

SMP-30/Gluconolactonase/LRE-like region

45

285

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g4e-assembly1.cif.gz_A crystal structure of human senescence marker protein-30(smp30)(calcium bound) 0.9721 7 291
4gna-assembly1.cif.gz_A mouse smp30/gnl-xylitol complex 0.9662 7 291
7plc-assembly4.cif.gz_D caulobacter crescentus xylonolactonase with d-xylose, p21 space group 0.9638 7 290
2ghs-assembly1.cif.gz_A crystal structure of a calcium-binding protein, regucalcin (agr_c_1268) from agrobacterium tumefaciens str. c58 at 1.55 a resolution 0.9558 5 289
7plc-assembly4.cif.gz_D caulobacter crescentus xylonolactonase with d-xylose, p21 space group 0.9506 7 290
ID Description Score Start End Superfamily
af_Q6TLF6_1_295_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9647 7 291 2.120.10.30
2ghsA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9431 5 289 2.120.10.30
af_Q6TLF6_1_295_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9421 7 291 2.120.10.30
5xfeA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9356 7 290 2.120.10.30
af_Q54ZP3_33_320_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9278 6 291 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A7X5Y303-F1-model_v4 Sugar lactone lactonase YvrE 0.9896 6 291 GO:0004341
GO:0005509
GO:0019853
AF-A0A2D6PZI3-F1-model_v4 Gluconolaconase 0.9892 6 291 GO:0004341
GO:0005509
GO:0019853
AF-A0A7Y4J7I3-F1-model_v4 deleted 0.9888 160 291
AF-A0A520I4Q6-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9878 145 288 GO:0004341
GO:0005509
GO:0019853
AF-A0A2A5D1M4-F1-model_v4 Gluconolaconase 0.9878 125 254 GO:0004341
GO:0005509
GO:0019853

Feature Viewer

pLDDT pTM Quality
95.23 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map