F383236

General Info

Members Datasets Scaffolds Average Seq Length
279 189 269 240

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0073955|Ga0466967_0073955_1701_2603
Length 290
Sequence VSAASAGDGYGVPNQRVTVEKGQGGLAVMTPEPLLELRGVRASYGAIEVLHGVNLAVPAGGVVAVLGPNGAGKSTMLRVVGGLHTPTAGDIFLGGRRVNGVDPVELARAGLCTIPEGRGIFPNLTVKENLQMVTYRGMSRKEVEERAFSYFPRLSERRTQMAGTMSGGEQQMLAVARAIASDPSMLLLDELSMGLAPLIVDQLYEAVRTISKEGVTILVVEQFAAAVLDVADTAAVMVNGRVVLTGTPKEIEADLSSVYLGGEVASRLSADENPLADPDSVPESEILVNE

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2517572101 Frankia sp. DC12 Isolate Nodule
3 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
4 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
5 2687453737 Frankia sp. BMG5.36 Isolate Nodule
6 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
7 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
8 2922554459 Rhodococcus sp. 66b Isolate Unclassified
9 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
62 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
63 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
65 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
66 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
69 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
70 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
71 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
72 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
73 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
74 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
77 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
78 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
82 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
83 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
84 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
85 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
88 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
92 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
93 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
94 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
95 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
96 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
97 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
107 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
108 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
112 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
116 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
124 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
132 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
135 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
147 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
148 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
149 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
172 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
179 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
182 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
183 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
184 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
185 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
186 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
189 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.7
Metatranscriptomes 0.72
Isolates 3.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.39
Nodule 2.15
Rhizoplane 3.23
Rhizosphere 70.25
Stem 0
Stem Tuber 0
Unclassified 13.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10025396 3300003203 Bacteria 2301
2 Ga0070683_100290219 3300005329 Bacteria 1556
3 Ga0070661_100166767 3300005344 Bacteria 1671
4 Ga0070671_100008002 3300005355 Bacteria 8462
5 Ga0070714_100132561 3300005435 Bacteria 2228
6 Ga0070714_100303453 3300005435 Bacteria 1489
7 Ga0070714_100603489 3300005435 Bacteria 1054
8 Ga0070708_100005176 3300005445 Bacteria 10323
9 Ga0070706_100000084 3300005467 Bacteria 109077
10 Ga0070706_100047819 3300005467 Bacteria 3948
11 Ga0070706_100266198 3300005467 Bacteria 1600
12 Ga0070707_100016015 3300005468 Bacteria 7034
13 Ga0070707_100024292 3300005468 Bacteria 5738
14 Ga0070698_100141853 3300005471 Bacteria 2353
15 Ga0070698_100946816 3300005471 Bacteria 807
16 Ga0070699_100014955 3300005518 Bacteria 6669
17 Ga0070679_100563401 3300005530 Bacteria 1083
18 Ga0070704_100746672 3300005549 Bacteria 871
19 Ga0068852_100725407 3300005616 Bacteria 1005
20 Ga0068859_101278945 3300005617 Bacteria 808
21 Ga0068858_100010903 3300005842 Bacteria 8592
22 Ga0068860_100000237 3300005843 Bacteria 84631
23 Ga0081455_10344099 3300005937 Bacteria 1054
24 Ga0081539_10000196 3300005985 Bacteria 140882
25 Ga0081539_10004717 3300005985 Bacteria 14764
26 Ga0070717_10002711 3300006028 Bacteria 12488
27 Ga0075365_10060441 3300006038 Bacteria 2528
28 Ga0075365_10118210 3300006038 Bacteria 1827
29 Ga0075365_10145561 3300006038 Bacteria 1646
30 Ga0075365_10311408 3300006038 Bacteria 1108
31 Ga0075368_10155064 3300006042 Bacteria 957
32 Ga0075363_100022359 3300006048 Bacteria 3196
33 Ga0075364_10004794 3300006051 Bacteria 7826
34 Ga0075364_10146031 3300006051 Bacteria 1593
35 Ga0075364_10147268 3300006051 Bacteria 1586
36 Ga0075364_10342297 3300006051 Bacteria 1019
37 Ga0070715_10016961 3300006163 Bacteria 2747
38 Ga0075370_10167097 3300006353 Bacteria 1293
39 Ga0075428_100012364 3300006844 Bacteria 9497
40 Ga0075428_100084778 3300006844 Bacteria 3457
41 Ga0075430_100000584 3300006846 Bacteria 27631
42 Ga0075430_100002829 3300006846 Bacteria 14518
43 Ga0075430_100030254 3300006846 Bacteria 4597
44 Ga0075430_100095165 3300006846 Bacteria 2489
45 Ga0075431_100002267 3300006847 Bacteria 18430
46 Ga0075434_100064215 3300006871 Bacteria 3655
47 Ga0075429_100000239 3300006880 Bacteria 37819
48 Ga0097620_101279133 3300006931 Bacteria 808
49 Ga0111539_10000875 3300009094 Bacteria 39347
50 Ga0114129_10000630 3300009147 Bacteria 43905
51 Ga0114129_10146020 3300009147 Bacteria 3240
52 Ga0105249_10176919 3300009553 Bacteria 2073
53 Ga0105029_108631 3300009984 Bacteria 752
54 Ga0163163_10138777 3300014325 Bacteria 2473
55 Ga0163161_10249208 3300017792 Bacteria 1384
56 Ga0206353_11404119 3300020082 Bacteria 1422
57 Ga0213874_10023747 3300021377 Bacteria 1714
58 Ga0213876_10182657 3300021384 Bacteria 1115
59 Ga0207647_10016434 3300025904 Bacteria 5051
60 Ga0207647_10052684 3300025904 Bacteria 2511
61 Ga0207685_10099087 3300025905 Bacteria 1242
62 Ga0207705_10059467 3300025909 Bacteria 2758
63 Ga0207684_10000040 3300025910 Bacteria 262703
64 Ga0207684_10054848 3300025910 Bacteria 3382
65 Ga0207684_10598142 3300025910 Bacteria 942
66 Ga0207652_10088101 3300025921 Bacteria 2723
67 Ga0207646_10008708 3300025922 Bacteria 10124
68 Ga0207646_10012600 3300025922 Bacteria 8118
69 Ga0207646_10466232 3300025922 Bacteria 1139
70 Ga0207700_10010493 3300025928 Bacteria 5850
71 Ga0207644_10041791 3300025931 Bacteria 3245
72 Ga0207703_10010033 3300026035 Bacteria 7425
73 Ga0207428_10027997 3300027907 Bacteria 4685
74 Ga0207428_10056108 3300027907 Bacteria 3130
75 Ga0268264_10000195 3300028381 Bacteria 123899
76 Ga0307515_10003658 3300028794 Bacteria 32307
77 Ga0307515_10173131 3300028794 Bacteria 2141
78 Ga0307512_10005884 3300030522 Bacteria 12607
79 Ga0307512_10022852 3300030522 Bacteria 5604
80 Ga0265762_1007922 3300030760 Bacteria 1893
81 Ga0265327_10005890 3300031251 Bacteria 10016
82 Ga0265327_10014723 3300031251 Bacteria 5096
83 Ga0307513_10009246 3300031456 Bacteria 12474
84 Ga0307513_10075583 3300031456 Bacteria 3497
85 Ga0307509_10011262 3300031507 Bacteria 10850
86 Ga0307509_10086264 3300031507 Bacteria 3228
87 Ga0307509_10118735 3300031507 Bacteria 2627
88 Ga0307408_100004458 3300031548 Bacteria 9504
89 Ga0307408_100368643 3300031548 Bacteria 1224
90 Ga0307508_10001889 3300031616 Bacteria 23036
91 Ga0307508_10004794 3300031616 Bacteria 13050
92 Ga0307514_10144606 3300031649 Bacteria 1609
93 Ga0307514_10184597 3300031649 Bacteria 1339
94 Ga0316579_10128506 3300031691 Bacteria 1220
95 Ga0316576_10022295 3300031727 Bacteria 4396
96 Ga0316578_10109179 3300031728 Bacteria 1661
97 Ga0307516_10009889 3300031730 Bacteria 10578
98 Ga0316577_10024052 3300031733 Bacteria 3385
99 Ga0307413_10063781 3300031824 Bacteria 2286
100 Ga0307413_10149214 3300031824 Bacteria 1627
101 Ga0307413_10201474 3300031824 Bacteria 1438
102 Ga0307518_10084532 3300031838 Bacteria 2287
103 Ga0307518_10144873 3300031838 Bacteria 1651
104 Ga0307410_10252023 3300031852 Bacteria 1373
105 Ga0307407_10034723 3300031903 Bacteria 2764
106 Ga0307409_100080447 3300031995 Bacteria 2629
107 Ga0307411_10082378 3300032005 Bacteria 2219
108 Ga0307507_10018484 3300033179 Bacteria 7919
109 Ga0307510_10001697 3300033180 Bacteria 24476
110 Ga0307510_10041054 3300033180 Bacteria 5066
111 Ga0373943_0044322 3300035170 Bacteria 2165
112 Ga0316574_0011989 3300035398 Bacteria 4945
113 Ga0316574_0054321 3300035398 Bacteria 2502
114 Ga0373931_0181418 3300035691 Bacteria 1247
115 Ga0373931_0472044 3300035691 Bacteria 805
116 Ga0373947_0084763 3300035725 Bacteria 1967
117 Ga0316582_0001120 3300036647 Bacteria 11367
118 Ga0316582_0143833 3300036647 Bacteria 1609
119 Ga0316584_0002542 3300036712 Bacteria 11580
120 Ga0316584_0158349 3300036712 Bacteria 1683
121 Ga0316584_0200497 3300036712 Bacteria 1472
122 Ga0436364_0815283 3300037853 Bacteria 6162
123 Ga0436365_0288480 3300039437 Bacteria 2181
124 Ga0436365_0384598 3300039437 Bacteria 1624
125 Ga0436365_0667692 3300039437 Bacteria 2932
126 Ga0436360_0024612 3300039438 Bacteria 1329
127 Ga0436363_0324602 3300039450 Bacteria 832
128 Ga0436363_0663387 3300039450 Bacteria 1803
129 Ga0436363_1477826 3300039450 Bacteria 2109
130 Ga0451797_0964794 3300041453 Bacteria 1902
131 Ga0451798_0735535 3300041458 Bacteria 1163
132 Ga0451843_0019495 3300041509 Bacteria 1393
133 Ga0466969_0059915 3300044656 Bacteria 1851
134 Ga0466965_0041631 3300044683 Bacteria 2264
135 Ga0466961_0099537 3300044693 Bacteria 1832
136 Ga0466961_0146094 3300044693 Bacteria 1479
137 Ga0466961_0269156 3300044693 Bacteria 1044
138 Ga0466963_0011932 3300044694 Bacteria 5307
139 Ga0466963_0067782 3300044694 Bacteria 2395
140 Ga0466963_0077790 3300044694 Bacteria 2242
141 Ga0466971_0051206 3300044719 Bacteria 1858
142 Ga0466971_0126325 3300044719 Bacteria 1185
143 Ga0466957_0023760 3300044842 Bacteria 3626
144 Ga0466957_0081489 3300044842 Bacteria 2015
145 Ga0466960_0112174 3300044901 Bacteria 1418
146 Ga0466960_0148658 3300044901 Bacteria 1250
147 Ga0466959_0209424 3300045049 Bacteria 1355
148 Ga0466958_0008764 3300045836 Bacteria 5617
149 Ga0466958_0014403 3300045836 Bacteria 4516
150 Ga0466967_0001629 3300045976 Bacteria 13264
151 Ga0466967_0009715 3300045976 Bacteria 7163
152 Ga0466967_0042757 3300045976 Bacteria 3918
153 Ga0466967_0073538 3300045976 Bacteria 3067
154 Ga0466967_0073955 3300045976 Bacteria 3059
155 Ga0466967_0227221 3300045976 Bacteria 1776
156 Ga0466967_0525229 3300045976 Bacteria 1163
157 Ga0466967_0533280 3300045976 Bacteria 1154
158 Ga0466967_0568434 3300045976 Bacteria 1117
159 Ga0495627_039697 3300046453 Bacteria 1452
160 Ga0495629_0005045 3300046459 Bacteria 9880
161 Ga0495638_0018735 3300046460 Bacteria 4592
162 Ga0495651_0013019 3300046462 Bacteria 6425
163 Ga0495651_0297687 3300046462 Bacteria 1083
164 Ga0495653_0093444 3300046463 Bacteria 2194
165 Ga0495639_0058255 3300046475 Bacteria 1766
166 Ga0495662_0014092 3300046476 Bacteria 3891
167 Ga0495664_0002669 3300046477 Bacteria 9608
168 Ga0495594_0023851 3300046499 Bacteria 3281
169 Ga0495583_0159161 3300046506 Bacteria 932
170 Ga0495618_0067171 3300046514 Bacteria 2280
171 Ga0495628_0078267 3300046516 Bacteria 2572
172 Ga0495630_0010432 3300046517 Bacteria 6708
173 Ga0495630_0272990 3300046517 Bacteria 1292
174 Ga0495648_0002994 3300046524 Bacteria 15145
175 Ga0495652_0053519 3300046529 Bacteria 3440
176 Ga0495587_0004536 3300046536 Bacteria 9125
177 Ga0495645_0042428 3300046543 Bacteria 3316
178 Ga0495668_0023838 3300046616 Bacteria 3484
179 Ga0495634_0011761 3300046642 Bacteria 6363
180 Ga0495588_0027691 3300046674 Bacteria 2834
181 Ga0495657_0000085 3300046675 Bacteria 82569
182 Ga0495646_0005870 3300046680 Bacteria 7786
183 Ga0495647_0019189 3300046681 Bacteria 2444
184 Ga0495658_0007001 3300046683 Bacteria 5565
185 Ga0495613_0000396 3300046689 Bacteria 37260
186 Ga0495624_0180175 3300046690 Bacteria 1288
187 Ga0495581_0006197 3300047315 Bacteria 6937
188 Ga0495604_0000250 3300047317 Bacteria 47753
189 Ga0495676_0041334 3300047321 Bacteria 3796
190 Ga0495687_000735 3300047443 Bacteria 35916
191 Ga0495675_0103200 3300047444 Bacteria 1783
192 Ga0495593_0002533 3300047673 Bacteria 10972
193 Ga0495602_0033288 3300048088 Bacteria 4837
194 Ga0495614_0011521 3300048089 Bacteria 3890
195 Ga0495614_0037592 3300048089 Bacteria 2077
196 Ga0496102_0963697 3300048905 Bacteria 774
197 Ga0496104_0203552 3300048907 Bacteria 1891
198 Ga0496105_0304370 3300048908 Bacteria 1281
199 Ga0496108_0030249 3300048911 Bacteria 4488
200 Ga0496108_0214150 3300048911 Bacteria 1673
201 Ga0496112_0289558 3300048915 Bacteria 1584
202 Ga0496113_0213760 3300048916 Bacteria 1536
203 Ga0496116_0000014 3300048919 Bacteria 569049
204 Ga0496119_0000639 3300048922 Bacteria 47198
205 Ga0496120_0045357 3300048923 Bacteria 2547
206 Ga0496123_0013794 3300048926 Bacteria 6745
207 Ga0496125_0034110 3300048928 Bacteria 4490
208 Ga0496125_0129399 3300048928 Bacteria 1781
209 Ga0496126_0000040 3300048929 Bacteria 345144
210 Ga0501033_0244998 3300049570 Bacteria 1271
211 Ga0501034_0008428 3300049571 Bacteria 10889
212 Ga0501037_0293166 3300049573 Bacteria 1131
213 Ga0501047_0066251 3300049581 Bacteria 3481
214 Ga0501047_0286347 3300049581 Bacteria 1492
215 Ga0501048_0100015 3300049582 Bacteria 2046
216 Ga0501069_0006929 3300049585 Bacteria 5924
217 Ga0501070_0000008 3300049586 Bacteria 199963
218 Ga0501070_0003417 3300049586 Bacteria 13771
219 Ga0501070_0511079 3300049586 Bacteria 964
220 Ga0501070_0780932 3300049586 Bacteria 751
221 Ga0501071_0026745 3300049587 Bacteria 4052
222 Ga0501072_0457380 3300049588 Bacteria 1011
223 Ga0501073_0005502 3300049589 Bacteria 9487
224 Ga0501073_0144624 3300049589 Bacteria 1648
225 Ga0501074_0233817 3300049590 Bacteria 1308
226 Ga0501075_0567495 3300049591 Bacteria 866
227 Ga0501076_0025636 3300049592 Bacteria 4566
228 Ga0501080_0035648 3300049742 Bacteria 4643
229 Ga0501080_0072054 3300049742 Bacteria 3214
230 Ga0501083_0069656 3300049744 Bacteria 2340
231 Ga0501044_0158706 3300049823 Bacteria 2240
232 nmdc:mga03n38_206081_c1 3300050490 Bacteria 1020
233 nmdc:mga03n38_49641_c1 3300050490 Bacteria 1867
234 nmdc:mga00v17_130903_c1 3300050491 Bacteria 1603
235 nmdc:mga00v17_131594_c1 3300050491 Bacteria 1599
236 nmdc:mga00v17_158557_c1 3300050491 Bacteria 1456
237 nmdc:mga00v17_171896_c1 3300050491 Bacteria 1397
238 nmdc:mga00v17_2641_c1 3300050491 Bacteria 5593
239 nmdc:mga0yw44_199550_c1 3300050492 Bacteria 1321
240 nmdc:mga0yw44_33257_c1 3300050492 Bacteria 3011
241 nmdc:mga0yw44_95721_c1 3300050492 Bacteria 1884
242 nmdc:mga06z11_495634_c1 3300050494 Bacteria 740
243 nmdc:mga07m45_236167_c1 3300050496 Bacteria 1064
244 nmdc:mga05p37_1834_c1 3300050507 Bacteria 24768
245 nmdc:mga05p37_638065_c1 3300050507 Bacteria 1195
246 nmdc:mga09592_2630_c1 3300050508 Bacteria 14530
247 nmdc:mga0qj67_164563_c1 3300050509 Bacteria 1800
248 nmdc:mga0qj67_268057_c1 3300050509 Bacteria 1385
249 nmdc:mga0qj67_3741_c1 3300050509 Bacteria 10984
250 nmdc:mga0qj67_4638_c1 3300050509 Bacteria 9972
251 nmdc:mga0qj67_48150_c1 3300050509 Bacteria 3367
252 nmdc:mga06r32_16069_c1 3300050510 Bacteria 6815
253 nmdc:mga06r32_201034_c1 3300050510 Bacteria 1980
254 nmdc:mga06r32_21639_c1 3300050510 Bacteria 5938
255 nmdc:mga06r32_22267_c1 3300050510 Bacteria 5856
256 nmdc:mga08y16_29714_c1 3300050511 Bacteria 5754
257 Ga0495612_0004726 3300053078 Bacteria 5638
258 Ga0495612_0064796 3300053078 Bacteria 1517
259 Ga0495595_0083018 3300053084 Bacteria 1529
260 Ga0495619_0121065 3300053085 Bacteria 1794
261 Ga0500644_0000179 3300053088 Bacteria 40770
262 Ga0500651_0210634 3300053093 Bacteria 1143
263 Ga0500640_000249 3300053095 Bacteria 11943
264 Ga0500652_122864 3300053131 Bacteria 1085
265 Ga0500559_0000157 3300053136 Bacteria 53554
266 Ga0500624_002752 3300053157 Bacteria 2339
267 Ga0501084_0000580 3300054114 Bacteria 27978
268 Ga0501084_0305558 3300054114 Bacteria 1344
269 Ga0466962_0016328 3300061719 Bacteria 3580

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0568434 Ga0466967_0568434_300_1067 194
2 3300044693 Ga0466961_0146094 Ga0466961_0146094_574_1380 204
3 3300049586 Ga0501070_0780932 Ga0501070_0780932_42_734 207
4 3300006051 Ga0075364_10342297 Ga0075364_103422972 208
5 3300050491 nmdc:mga00v17_131594_c1 nmdc:mga00v17_131594_c1_601_1329 208
6 3300050490 nmdc:mga03n38_206081_c1 nmdc:mga03n38_206081_c1_141_893 209
7 3300009094 Ga0111539_10000875 Ga0111539_100008753 213
8 3300027907 Ga0207428_10027997 Ga0207428_100279974 213
9 3300035691 Ga0373931_0181418 Ga0373931_0181418_45_743 213
10 3300046475 Ga0495639_0058255 Ga0495639_0058255_1029_1739 213
11 3300046681 Ga0495647_0019189 Ga0495647_0019189_1425_2135 213
12 3300048089 Ga0495614_0037592 Ga0495614_0037592_1329_2039 213
13 3300048905 Ga0496102_0963697 Ga0496102_0963697_19_717 213
14 3300050511 nmdc:mga08y16_29714_c1 nmdc:mga08y16_29714_c1_660_1358 213
15 3300035691 Ga0373931_0472044 Ga0373931_0472044_37_738 214
16 3300039450 Ga0436363_0324602 Ga0436363_0324602_83_784 214
17 3300041453 Ga0451797_0964794 Ga0451797_0964794_727_1428 214
18 3300041509 Ga0451843_0019495 Ga0451843_0019495_489_1190 214
19 3300005329 Ga0070683_100290219 Ga0070683_1002902192 215
20 3300028794 Ga0307515_10003658 Ga0307515_1000365823 215
21 3300028794 Ga0307515_10173131 Ga0307515_101731312 215
22 3300030522 Ga0307512_10005884 Ga0307512_100058846 215
23 3300031456 Ga0307513_10009246 Ga0307513_1000924610 215
24 3300031456 Ga0307513_10075583 Ga0307513_100755835 215
25 3300031507 Ga0307509_10011262 Ga0307509_1001126211 215
26 3300031507 Ga0307509_10086264 Ga0307509_100862643 215
27 3300031507 Ga0307509_10118735 Ga0307509_101187353 215
28 3300031616 Ga0307508_10001889 Ga0307508_1000188911 215
29 3300031616 Ga0307508_10004794 Ga0307508_100047944 215
30 3300031649 Ga0307514_10144606 Ga0307514_101446062 215
31 3300031649 Ga0307514_10184597 Ga0307514_101845972 215
32 3300031728 Ga0316578_10109179 Ga0316578_101091793 215
33 3300031730 Ga0307516_10009889 Ga0307516_100098893 215
34 3300031838 Ga0307518_10084532 Ga0307518_100845323 215
35 3300031838 Ga0307518_10144873 Ga0307518_101448732 215
36 3300033179 Ga0307507_10018484 Ga0307507_100184845 215
37 3300033180 Ga0307510_10001697 Ga0307510_1000169720 215
38 3300033180 Ga0307510_10041054 Ga0307510_100410546 215
39 3300045976 Ga0466967_0533280 Ga0466967_0533280_292_999 215
40 3300046453 Ga0495627_039697 Ga0495627_039697_12_719 215
41 3300046459 Ga0495629_0005045 Ga0495629_0005045_5415_6122 215
42 3300046460 Ga0495638_0018735 Ga0495638_0018735_1986_2693 215
43 3300046462 Ga0495651_0013019 Ga0495651_0013019_3755_4462 215
44 3300046463 Ga0495653_0093444 Ga0495653_0093444_1417_2124 215
45 3300046476 Ga0495662_0014092 Ga0495662_0014092_2345_3052 215
46 3300046477 Ga0495664_0002669 Ga0495664_0002669_2008_2715 215
47 3300046499 Ga0495594_0023851 Ga0495594_0023851_220_927 215
48 3300046506 Ga0495583_0159161 Ga0495583_0159161_195_902 215
49 3300046514 Ga0495618_0067171 Ga0495618_0067171_1228_1935 215
50 3300046516 Ga0495628_0078267 Ga0495628_0078267_950_1657 215
51 3300046517 Ga0495630_0010432 Ga0495630_0010432_2354_3061 215
52 3300046529 Ga0495652_0053519 Ga0495652_0053519_2413_3120 215
53 3300046536 Ga0495587_0004536 Ga0495587_0004536_5853_6560 215
54 3300046543 Ga0495645_0042428 Ga0495645_0042428_2116_2823 215
55 3300046642 Ga0495634_0011761 Ga0495634_0011761_4645_5352 215
56 3300046674 Ga0495588_0027691 Ga0495588_0027691_1904_2611 215
57 3300046675 Ga0495657_0000085 Ga0495657_0000085_55379_56086 215
58 3300046680 Ga0495646_0005870 Ga0495646_0005870_2739_3446 215
59 3300046683 Ga0495658_0007001 Ga0495658_0007001_2639_3346 215
60 3300046689 Ga0495613_0000396 Ga0495613_0000396_9243_9950 215
61 3300046690 Ga0495624_0180175 Ga0495624_0180175_213_920 215
62 3300047315 Ga0495581_0006197 Ga0495581_0006197_1162_1869 215
63 3300047317 Ga0495604_0000250 Ga0495604_0000250_19655_20362 215
64 3300047321 Ga0495676_0041334 Ga0495676_0041334_1961_2668 215
65 3300047443 Ga0495687_000735 Ga0495687_000735_1981_2688 215
66 3300047444 Ga0495675_0103200 Ga0495675_0103200_906_1613 215
67 3300047673 Ga0495593_0002533 Ga0495593_0002533_5011_5718 215
68 3300048088 Ga0495602_0033288 Ga0495602_0033288_3706_4413 215
69 3300048089 Ga0495614_0011521 Ga0495614_0011521_2474_3181 215
70 3300049589 Ga0501073_0144624 Ga0501073_0144624_425_1129 215
71 3300053078 Ga0495612_0004726 Ga0495612_0004726_3007_3714 215
72 3300053078 Ga0495612_0064796 Ga0495612_0064796_443_1150 215
73 3300053085 Ga0495619_0121065 Ga0495619_0121065_1040_1747 215
74 3300053093 Ga0500651_0210634 Ga0500651_0210634_221_928 215
75 3300053095 Ga0500640_000249 Ga0500640_000249_10193_10900 215
76 3300053131 Ga0500652_122864 Ga0500652_122864_288_995 215
77 3300053157 Ga0500624_002752 Ga0500624_002752_548_1255 215
78 3300005355 Ga0070671_100008002 Ga0070671_1000080024 216
79 3300005842 Ga0068858_100010903 Ga0068858_1000109037 216
80 3300005843 Ga0068860_100000237 Ga0068860_10000023722 216
81 3300006038 Ga0075365_10060441 Ga0075365_100604412 216
82 3300006038 Ga0075365_10118210 Ga0075365_101182102 216
83 3300006038 Ga0075365_10311408 Ga0075365_103114082 216
84 3300006042 Ga0075368_10155064 Ga0075368_101550641 216
85 3300006048 Ga0075363_100022359 Ga0075363_1000223592 216
86 3300006051 Ga0075364_10146031 Ga0075364_101460312 216
87 3300006353 Ga0075370_10167097 Ga0075370_101670972 216
88 3300006844 Ga0075428_100084778 Ga0075428_1000847783 216
89 3300006846 Ga0075430_100002829 Ga0075430_1000028294 216
90 3300009147 Ga0114129_10146020 Ga0114129_101460202 216
91 3300025931 Ga0207644_10041791 Ga0207644_100417913 216
92 3300026035 Ga0207703_10010033 Ga0207703_100100336 216
93 3300028381 Ga0268264_10000195 Ga0268264_1000019546 216
94 3300031548 Ga0307408_100368643 Ga0307408_1003686432 216
95 3300031824 Ga0307413_10149214 Ga0307413_101492142 216
96 3300031995 Ga0307409_100080447 Ga0307409_1000804473 216
97 3300032005 Ga0307411_10082378 Ga0307411_100823782 216
98 3300046517 Ga0495630_0272990 Ga0495630_0272990_529_1236 216
99 3300049582 Ga0501048_0100015 Ga0501048_0100015_1049_1756 216
100 3300049588 Ga0501072_0457380 Ga0501072_0457380_187_894 216
101 3300050490 nmdc:mga03n38_49641_c1 nmdc:mga03n38_49641_c1_205_912 216
102 3300050491 nmdc:mga00v17_158557_c1 nmdc:mga00v17_158557_c1_16_723 216
103 3300050492 nmdc:mga0yw44_33257_c1 nmdc:mga0yw44_33257_c1_134_841 216
104 3300050492 nmdc:mga0yw44_95721_c1 nmdc:mga0yw44_95721_c1_342_1049 216
105 3300050494 nmdc:mga06z11_495634_c1 nmdc:mga06z11_495634_c1_23_730 216
106 3300050507 nmdc:mga05p37_638065_c1 nmdc:mga05p37_638065_c1_43_786 216
107 3300050509 nmdc:mga0qj67_4638_c1 nmdc:mga0qj67_4638_c1_25_768 216
108 3300050510 nmdc:mga06r32_16069_c1 nmdc:mga06r32_16069_c1_323_1066 216
109 3300053088 Ga0500644_0000179 Ga0500644_0000179_36354_37061 216
110 3300054114 Ga0501084_0305558 Ga0501084_0305558_585_1292 216
111 iso_pu_bacteria 2687453737 2689961092 216
112 3300005435 Ga0070714_100303453 Ga0070714_1003034532 217
113 3300006051 Ga0075364_10147268 Ga0075364_101472682 217
114 3300020082 Ga0206353_11404119 Ga0206353_114041192 217
115 3300044901 Ga0466960_0148658 Ga0466960_0148658_385_1095 217
116 3300045976 Ga0466967_0073538 Ga0466967_0073538_1407_2117 217
117 3300045976 Ga0466967_0525229 Ga0466967_0525229_298_1008 217
118 3300049570 Ga0501033_0244998 Ga0501033_0244998_472_1182 217
119 3300049573 Ga0501037_0293166 Ga0501037_0293166_68_778 217
120 3300049586 Ga0501070_0511079 Ga0501070_0511079_120_830 217
121 3300049590 Ga0501074_0233817 Ga0501074_0233817_194_904 217
122 3300050491 nmdc:mga00v17_130903_c1 nmdc:mga00v17_130903_c1_363_1073 217
123 3300005937 Ga0081455_10344099 Ga0081455_103440991 218
124 3300006844 Ga0075428_100012364 Ga0075428_1000123641 218
125 3300006846 Ga0075430_100000584 Ga0075430_10000058418 218
126 3300006847 Ga0075431_100002267 Ga0075431_1000022673 218
127 3300006880 Ga0075429_100000239 Ga0075429_10000023927 218
128 3300009147 Ga0114129_10000630 Ga0114129_1000063010 218
129 3300039450 Ga0436363_0663387 Ga0436363_0663387_536_1249 218
130 3300048916 Ga0496113_0213760 Ga0496113_0213760_717_1430 218
131 3300049592 Ga0501076_0025636 Ga0501076_0025636_1451_2152 218
132 3300050507 nmdc:mga05p37_1834_c1 nmdc:mga05p37_1834_c1_11471_12184 218
133 3300050508 nmdc:mga09592_2630_c1 nmdc:mga09592_2630_c1_4179_4892 218
134 3300050509 nmdc:mga0qj67_3741_c1 nmdc:mga0qj67_3741_c1_2513_3226 218
135 3300050510 nmdc:mga06r32_21639_c1 nmdc:mga06r32_21639_c1_4307_5020 218
136 3300005344 Ga0070661_100166767 Ga0070661_1001667672 219
137 3300005530 Ga0070679_100563401 Ga0070679_1005634012 219
138 3300005549 Ga0070704_100746672 Ga0070704_1007466721 219
139 3300021384 Ga0213876_10182657 Ga0213876_101826571 219
140 3300025921 Ga0207652_10088101 Ga0207652_100881014 219
141 3300031824 Ga0307413_10063781 Ga0307413_100637813 219
142 3300039437 Ga0436365_0288480 Ga0436365_0288480_1176_1835 219
143 3300039437 Ga0436365_0667692 Ga0436365_0667692_1832_2551 219
144 3300046524 Ga0495648_0002994 Ga0495648_0002994_14190_14891 219
145 3300048911 Ga0496108_0214150 Ga0496108_0214150_210_959 219
146 3300048923 Ga0496120_0045357 Ga0496120_0045357_159_878 219
147 3300049571 Ga0501034_0008428 Ga0501034_0008428_9766_10482 219
148 3300049823 Ga0501044_0158706 Ga0501044_0158706_1259_1975 219
149 3300050510 nmdc:mga06r32_201034_c1 nmdc:mga06r32_201034_c1_732_1448 219
150 3300044693 Ga0466961_0099537 Ga0466961_0099537_30_749 220
151 3300044694 Ga0466963_0011932 Ga0466963_0011932_2525_3244 220
152 3300044719 Ga0466971_0051206 Ga0466971_0051206_991_1710 220
153 3300044842 Ga0466957_0081489 Ga0466957_0081489_1226_1945 220
154 3300045836 Ga0466958_0008764 Ga0466958_0008764_3622_4341 220
155 3300045976 Ga0466967_0227221 Ga0466967_0227221_807_1526 220
156 3300049581 Ga0501047_0066251 Ga0501047_0066251_2717_3436 220
157 3300044694 Ga0466963_0067782 Ga0466963_0067782_1374_2096 221
158 3300044719 Ga0466971_0126325 Ga0466971_0126325_105_827 221
159 3300044842 Ga0466957_0023760 Ga0466957_0023760_2039_2761 221
160 3300045836 Ga0466958_0014403 Ga0466958_0014403_3063_3785 221
161 3300045976 Ga0466967_0001629 Ga0466967_0001629_8372_9094 221
162 3300050492 nmdc:mga0yw44_199550_c1 nmdc:mga0yw44_199550_c1_583_1305 221
163 3300061719 Ga0466962_0016328 Ga0466962_0016328_2450_3172 221
164 3300005435 Ga0070714_100603489 Ga0070714_1006034891 222
165 3300005467 Ga0070706_100047819 Ga0070706_1000478193 222
166 3300005467 Ga0070706_100266198 Ga0070706_1002661982 222
167 3300005471 Ga0070698_100946816 Ga0070698_1009468161 222
168 3300005617 Ga0068859_101278945 Ga0068859_1012789451 222
169 3300006931 Ga0097620_101279133 Ga0097620_1012791332 222
170 3300009984 Ga0105029_108631 Ga0105029_1086311 222
171 3300025910 Ga0207684_10054848 Ga0207684_100548483 222
172 3300025910 Ga0207684_10598142 Ga0207684_105981422 222
173 3300025922 Ga0207646_10466232 Ga0207646_104662322 222
174 3300030522 Ga0307512_10022852 Ga0307512_100228524 222
175 3300031691 Ga0316579_10128506 Ga0316579_101285062 222
176 3300035170 Ga0373943_0044322 Ga0373943_0044322_958_1626 222
177 3300035398 Ga0316574_0054321 Ga0316574_0054321_1157_1882 222
178 3300035725 Ga0373947_0084763 Ga0373947_0084763_381_1049 222
179 3300036647 Ga0316582_0143833 Ga0316582_0143833_330_1055 222
180 3300036712 Ga0316584_0200497 Ga0316584_0200497_194_919 222
181 3300037853 Ga0436364_0815283 Ga0436364_0815283_3829_4497 222
182 3300048915 Ga0496112_0289558 Ga0496112_0289558_228_899 222
183 3300005445 Ga0070708_100005176 Ga0070708_1000051763 223
184 3300005467 Ga0070706_100000084 Ga0070706_10000008441 223
185 3300005468 Ga0070707_100016015 Ga0070707_1000160152 223
186 3300005471 Ga0070698_100141853 Ga0070698_1001418532 223
187 3300006028 Ga0070717_10002711 Ga0070717_1000271110 223
188 3300006051 Ga0075364_10004794 Ga0075364_100047943 223
189 3300025910 Ga0207684_10000040 Ga0207684_10000040218 223
190 3300025922 Ga0207646_10008708 Ga0207646_100087087 223
191 3300044694 Ga0466963_0077790 Ga0466963_0077790_754_1482 223
192 3300045976 Ga0466967_0009715 Ga0466967_0009715_4792_5520 223
193 3300046462 Ga0495651_0297687 Ga0495651_0297687_104_871 223
194 3300048926 Ga0496123_0013794 Ga0496123_0013794_4520_5230 223
195 3300048928 Ga0496125_0129399 Ga0496125_0129399_158_886 223
196 3300049591 Ga0501075_0567495 Ga0501075_0567495_126_854 223
197 3300050491 nmdc:mga00v17_2641_c1 nmdc:mga00v17_2641_c1_2749_3495 223
198 3300053084 Ga0495595_0083018 Ga0495595_0083018_143_910 223
199 3300030760 Ga0265762_1007922 Ga0265762_10079222 224
200 3300044656 Ga0466969_0059915 Ga0466969_0059915_684_1415 224
201 3300044693 Ga0466961_0269156 Ga0466961_0269156_49_780 224
202 3300044901 Ga0466960_0112174 Ga0466960_0112174_320_994 224
203 3300045049 Ga0466959_0209424 Ga0466959_0209424_172_903 224
204 3300025928 Ga0207700_10010493 Ga0207700_100104935 225
205 3300053136 Ga0500559_0000157 Ga0500559_0000157_22709_23428 225
206 iso_pu_bacteria 2675902999 2676202079 225
207 iso_pu_bacteria 2773857921 2774846655 225
208 iso_pu_bacteria 8002784119 8002791766 225
209 3300006846 Ga0075430_100030254 Ga0075430_1000302542 227
210 3300031251 Ga0265327_10014723 Ga0265327_100147233 227
211 3300050509 nmdc:mga0qj67_268057_c1 nmdc:mga0qj67_268057_c1_555_1295 227
212 iso_pu_bacteria 2928142448 2928143121 227
213 3300005435 Ga0070714_100132561 Ga0070714_1001325612 228
214 3300006163 Ga0070715_10016961 Ga0070715_100169613 228
215 3300009553 Ga0105249_10176919 Ga0105249_101769192 228
216 3300025905 Ga0207685_10099087 Ga0207685_100990872 228
217 3300031548 Ga0307408_100004458 Ga0307408_1000044585 228
218 3300031727 Ga0316576_10022295 Ga0316576_100222956 228
219 3300031733 Ga0316577_10024052 Ga0316577_100240523 228
220 3300031824 Ga0307413_10201474 Ga0307413_102014742 228
221 3300031852 Ga0307410_10252023 Ga0307410_102520232 228
222 3300031903 Ga0307407_10034723 Ga0307407_100347232 228
223 3300035398 Ga0316574_0011989 Ga0316574_0011989_310_1071 228
224 3300036647 Ga0316582_0001120 Ga0316582_0001120_2731_3492 228
225 3300036712 Ga0316584_0002542 Ga0316584_0002542_7942_8703 228
226 3300044683 Ga0466965_0041631 Ga0466965_0041631_1351_2094 228
227 3300048919 Ga0496116_0000014 Ga0496116_0000014_104693_105424 228
228 3300048922 Ga0496119_0000639 Ga0496119_0000639_11069_11800 228
229 3300049581 Ga0501047_0286347 Ga0501047_0286347_214_957 228
230 3300005616 Ga0068852_100725407 Ga0068852_1007254071 229
231 3300006038 Ga0075365_10145561 Ga0075365_101455613 229
232 3300006871 Ga0075434_100064215 Ga0075434_1000642153 229
233 3300025904 Ga0207647_10052684 Ga0207647_100526842 229
234 3300025909 Ga0207705_10059467 Ga0207705_100594672 229
235 3300039438 Ga0436360_0024612 Ga0436360_0024612_39_803 229
236 3300041458 Ga0451798_0735535 Ga0451798_0735535_295_1134 229
237 iso_pu_bacteria 2565956761 2566992621 229
238 iso_pu_bacteria 2904535858 2904541517 229
239 iso_pu_bacteria 2922554459 2922560107 229
240 3300005985 Ga0081539_10004717 Ga0081539_100047178 230
241 3300031251 Ga0265327_10005890 Ga0265327_100058902 230
242 iso_pu_bacteria 2508501039 2508678135 230
243 3300045976 Ga0466967_0042757 Ga0466967_0042757_1738_2436 232
244 3300005468 Ga0070707_100024292 Ga0070707_1000242923 233
245 3300005518 Ga0070699_100014955 Ga0070699_1000149554 233
246 3300006846 Ga0075430_100095165 Ga0075430_1000951651 233
247 3300017792 Ga0163161_10249208 Ga0163161_102492082 233
248 3300025922 Ga0207646_10012600 Ga0207646_100126003 233
249 3300036712 Ga0316584_0158349 Ga0316584_0158349_108_893 233
250 3300046616 Ga0495668_0023838 Ga0495668_0023838_2317_3075 233
251 3300048908 Ga0496105_0304370 Ga0496105_0304370_274_1053 233
252 3300048911 Ga0496108_0030249 Ga0496108_0030249_1352_2110 233
253 3300048928 Ga0496125_0034110 Ga0496125_0034110_2351_3109 233
254 3300049586 Ga0501070_0000008 Ga0501070_0000008_132646_133449 233
255 3300049587 Ga0501071_0026745 Ga0501071_0026745_683_1486 233
256 3300049742 Ga0501080_0035648 Ga0501080_0035648_3772_4575 233
257 3300050491 nmdc:mga00v17_171896_c1 nmdc:mga00v17_171896_c1_605_1363 233
258 3300050496 nmdc:mga07m45_236167_c1 nmdc:mga07m45_236167_c1_34_792 233
259 3300050509 nmdc:mga0qj67_48150_c1 nmdc:mga0qj67_48150_c1_1681_2442 233
260 3300050510 nmdc:mga06r32_22267_c1 nmdc:mga06r32_22267_c1_2190_2951 233
261 3300014325 Ga0163163_10138777 Ga0163163_101387773 235
262 3300025904 Ga0207647_10016434 Ga0207647_100164343 235
263 3300048907 Ga0496104_0203552 Ga0496104_0203552_123_896 235
264 3300050509 nmdc:mga0qj67_164563_c1 nmdc:mga0qj67_164563_c1_858_1625 235
265 3300049585 Ga0501069_0006929 Ga0501069_0006929_489_1268 236
266 3300049586 Ga0501070_0003417 Ga0501070_0003417_200_979 236
267 3300049589 Ga0501073_0005502 Ga0501073_0005502_305_1084 236
268 3300049742 Ga0501080_0072054 Ga0501080_0072054_1507_2286 236
269 3300049744 Ga0501083_0069656 Ga0501083_0069656_327_1106 236
270 3300054114 Ga0501084_0000580 Ga0501084_0000580_11203_11982 236
271 iso_pu_bacteria 2517572101 2517759635 236
272 3300027907 Ga0207428_10056108 Ga0207428_100561083 238
273 3300021377 Ga0213874_10023747 Ga0213874_100237471 239
274 3300039437 Ga0436365_0384598 Ga0436365_0384598_70_789 239
275 3300039450 Ga0436363_1477826 Ga0436363_1477826_419_1138 239
276 3300048929 Ga0496126_0000040 Ga0496126_0000040_227861_228745 240
277 3300045976 Ga0466967_0073955 Ga0466967_0073955_1701_2603 241
278 3300003203 JGI25406J46586_10025396 JGI25406J46586_100253961 247
279 3300005985 Ga0081539_10000196 Ga0081539_10000196122 247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

50

192

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9047 26 229
1g9x-assembly3.cif.gz_C characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter 0.8942 25 236
1gaj-assembly1.cif.gz_A crystal structure of a nucleotide-free atp-binding cassette from an abc transporter 0.8911 25 234
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.8866 23 241
1g6h-assembly1.cif.gz_A crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter 0.8816 25 241
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9149 22 241 3.40.50.300
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9122 27 85 3.40.50.300
1vplA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9047 26 229 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8981 27 235 3.40.50.300
af_A0A0P0VBQ7_902_1031_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8966 27 85 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7Y9JAY0-F1-model_v4 Branched-chain amino acid transport system ATP-binding protein 0.921 27 240 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A523UH55-F1-model_v4 ATP-binding cassette domain-containing protein 0.9158 24 229 GO:0005524
GO:0016887
GO:0043215
GO:1900753
AF-H5XUG3-F1-model_v4 ABC-type branched-chain amino acid transport system, ATPase component 0.9141 27 240 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A254THI3-F1-model_v4 ABC transporter ATP-binding protein 0.9131 27 241 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A496QUQ5-F1-model_v4 ABC transporter ATP-binding protein 0.9114 27 241 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Feature Viewer

pLDDT pTM Quality
83.11 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map