F383441

General Info

Members Datasets Scaffolds Average Seq Length
280 170 561 239

Family's Representative Sequence

Representative Sequence 3300005262|Ga0065165_1001739|Ga0065165_100173914
Length 264
Sequence MSEVAEIIEGNQQDILLLCDHASNAVPGDIALGIAPELLDRHIAVDIGAGPLTRSLAARLEAPAILATVSRLVIDLHREPDHVGLIPHRSDGHWIPGNDQVDRAGRIARFHAPYHRLLARRIRAQRPRLILSIHSFTPRLEHGGTPRPWQVGILYNRDTRAARPAIDWLRAQGLETGDNEPYSGRLLNATLNRHAEANGIPSIAIEVRNDLIGDSGGVEHWAGTLAELARHLRNVIPAKAGISIDESGGGSHAIPAFAGMTNSL

Samples

Sample ID Description Type Environment
1 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
49 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
50 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
51 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
52 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
85 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
89 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
90 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
91 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
92 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
93 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
94 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
95 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
96 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
97 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
98 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
99 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
100 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
101 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
104 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
105 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
106 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
109 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
110 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
111 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
112 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
116 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
117 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
124 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
125 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
126 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
127 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
139 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
140 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
141 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
145 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
146 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
147 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
148 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
149 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
150 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
151 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
152 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
153 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
154 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
155 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
156 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
157 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
158 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
159 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
160 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
161 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
162 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
163 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
164 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
165 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
166 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
167 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
168 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
169 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
170 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.36
Metatranscriptomes 0
Isolates 4.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 32.5
Nodule 0
Rhizoplane 1.43
Rhizosphere 55.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065165_1001739 3300005262 Bacteria 21750
2 JGI25150J39212_1000672 3300002774 Bacteria 12562
3 JGI25165J46597_1000032 3300003214 Bacteria 294371
4 JGI25153J46596_10000017 3300003215 Bacteria 274325
5 JGI25153J46596_10007786 3300003215 Bacteria 5205
6 rootH1_10042889 3300003316 Bacteria 1378
7 rootH1_10042889 3300003323 Bacteria 1357
8 rootH2_10120440 3300003320 Bacteria 1313
9 rootH2_10146928 3300003320 Bacteria 1009
10 rootL2_10000144 3300003322 Bacteria 1801
11 Ga0055526_1009390 3300003771 Bacteria 4712
12 Ga0055537_1001041 3300003773 Bacteria 12442
13 Ga0055537_1004947 3300003773 Bacteria 3679
14 Ga0055524_1000199 3300003775 Bacteria 66009
15 Ga0055536_1001142 3300003781 Bacteria 16627
16 Ga0055536_1005028 3300003781 Bacteria 6569
17 Ga0055536_1025081 3300003781 Bacteria 1709
18 Ga0055534_1013647 3300003784 Bacteria 1553
19 Ga0055530_10000060 3300003791 Bacteria 95767
20 Ga0055530_10000095 3300003791 Bacteria 74707
21 Ga0055530_10016229 3300003791 Bacteria 2390
22 Ga0055530_10023116 3300003791 Bacteria 1793
23 Ga0055540_1003362 3300003792 Bacteria 7757
24 Ga0055531_10000049 3300003794 Bacteria 130662
25 Ga0055531_10000671 3300003794 Bacteria 29301
26 Ga0055531_10005302 3300003794 Bacteria 7566
27 Ga0055531_10015072 3300003794 Bacteria 3433
28 Ga0055531_10022602 3300003794 Bacteria 2390
29 Ga0055531_10022923 3300003794 Bacteria 2361
30 Ga0065165_1008868 3300005262 Bacteria 4617
31 Ga0065165_1024167 3300005262 Bacteria 2047
32 Ga0065165_1033960 3300005262 Bacteria 1582
33 Ga0065704_10002515 3300005289 Bacteria 5085
34 Ga0065707_10115071 3300005295 Bacteria 2278
35 Ga0065707_10347026 3300005295 Bacteria 924
36 Ga0070683_100432337 3300005329 Bacteria 1256
37 Ga0070666_10000305 3300005335 Bacteria 31836
38 Ga0070669_100000013 3300005353 Bacteria 210577
39 Ga0070671_100000009 3300005355 Bacteria 206508
40 Ga0070671_100099436 3300005355 Bacteria 2440
41 Ga0070667_100000678 3300005367 Bacteria 33073
42 Ga0070667_100139972 3300005367 Bacteria 2118
43 Ga0070686_100216466 3300005544 Bacteria 1382
44 Ga0068857_100112065 3300005577 Bacteria 2453
45 Ga0068857_100209791 3300005577 Bacteria 1777
46 Ga0068859_100000202 3300005617 Bacteria 58573
47 Ga0068859_100057544 3300005617 Bacteria 3916
48 Ga0068864_100000188 3300005618 Bacteria 56337
49 Ga0068864_100005285 3300005618 Bacteria 10581
50 Ga0068861_100000474 3300005719 Bacteria 23369
51 Ga0068861_100087598 3300005719 Bacteria 2450
52 Ga0068863_100047572 3300005841 Bacteria 4068
53 Ga0068863_100055070 3300005841 Bacteria 3767
54 Ga0068858_100000688 3300005842 Bacteria 35297
55 Ga0068858_100008985 3300005842 Bacteria 9568
56 Ga0068858_100057446 3300005842 Bacteria 3596
57 Ga0068858_100171954 3300005842 Bacteria 2043
58 Ga0068860_100093856 3300005843 Bacteria 2860
59 Ga0068862_100005465 3300005844 Bacteria 10620
60 Ga0081539_10014967 3300005985 Bacteria 5685
61 Ga0068865_100295161 3300006881 Bacteria 1295
62 Ga0097620_100000202 3300006931 Bacteria 58573
63 Ga0097620_100057543 3300006931 Bacteria 3916
64 Ga0105245_10000918 3300009098 Bacteria 26787
65 Ga0105247_10000831 3300009101 Bacteria 23501
66 Ga0105243_10019992 3300009148 Bacteria 5077
67 Ga0105243_10542597 3300009148 Bacteria 1110
68 Ga0105243_10926375 3300009148 Bacteria 869
69 Ga0105248_10264922 3300009177 Bacteria 1934
70 Ga0105237_10028020 3300009545 Bacteria 5740
71 Ga0105238_10075210 3300009551 Bacteria 3369
72 Ga0105249_10066967 3300009553 Bacteria 3307
73 Ga0105249_11194917 3300009553 Bacteria 831
74 Ga0105239_10492516 3300010375 Bacteria 1393
75 Ga0157370_10389360 3300013104 Bacteria 1283
76 Ga0163162_10018534 3300013306 Bacteria 6821
77 Ga0163162_10050948 3300013306 Bacteria 4153
78 Ga0163162_10071043 3300013306 Bacteria 3533
79 Ga0163163_10155607 3300014325 Bacteria 2330
80 Ga0157379_10245297 3300014968 Bacteria 1625
81 Ga0157379_10389283 3300014968 Bacteria 1280
82 Ga0163161_10097956 3300017792 Bacteria 2179
83 Ga0209437_110447 3300025233 Bacteria 1418
84 Ga0207425_1000022 3300025245 Bacteria 355305
85 Ga0207425_1008356 3300025245 Bacteria 2655
86 Ga0209129_1002797 3300025258 Bacteria 8122
87 Ga0209233_1000066 3300025261 Bacteria 381218
88 Ga0209565_1000010 3300025263 Bacteria 687724
89 Ga0209565_1000099 3300025263 Bacteria 131080
90 Ga0209673_1001971 3300025273 Bacteria 16032
91 Ga0209675_1000025 3300025291 Bacteria 294102
92 Ga0209675_1010607 3300025291 Bacteria 3131
93 Ga0209676_1000276 3300025292 Bacteria 106867
94 Ga0209676_1000362 3300025292 Bacteria 85770
95 Ga0209676_1012889 3300025292 Bacteria 3250
96 Ga0209676_1015121 3300025292 Bacteria 2860
97 Ga0209676_1019141 3300025292 Bacteria 2364
98 Ga0209676_1027504 3300025292 Bacteria 1789
99 Ga0209676_1030743 3300025292 Bacteria 1637
100 Ga0209025_1000318 3300025294 Bacteria 107348
101 Ga0209564_1003178 3300025295 Bacteria 11543
102 Ga0209564_1004032 3300025295 Bacteria 9283
103 Ga0209564_1039773 3300025295 Bacteria 1287
104 Ga0209758_1000004 3300025297 Bacteria 1375322
105 Ga0209758_1009669 3300025297 Bacteria 5940
106 Ga0209758_1022215 3300025297 Bacteria 2922
107 Ga0209050_1000001 3300025298 Bacteria 3563507
108 Ga0209050_1000010 3300025298 Bacteria 980454
109 Ga0209050_1000728 3300025298 Bacteria 47923
110 Ga0209050_1001953 3300025298 Bacteria 19508
111 Ga0209050_1004955 3300025298 Bacteria 8676
112 Ga0209050_1027857 3300025298 Bacteria 1850
113 Ga0209050_1057028 3300025298 Bacteria 947
114 Ga0209256_1000034 3300025299 Bacteria 388475
115 Ga0209051_1000450 3300025303 Bacteria 54435
116 Ga0209257_1000009 3300025304 Bacteria 1205047
117 Ga0209257_1000487 3300025304 Bacteria 71315
118 Ga0209257_1000596 3300025304 Bacteria 59951
119 Ga0209257_1000695 3300025304 Bacteria 52248
120 Ga0209257_1000872 3300025304 Bacteria 42806
121 Ga0209257_1000921 3300025304 Bacteria 40974
122 Ga0209257_1001879 3300025304 Bacteria 22727
123 Ga0209257_1019073 3300025304 Bacteria 2602
124 Ga0207697_10001013 3300025315 Bacteria 15719
125 Ga0207710_10003272 3300025900 Bacteria 7238
126 Ga0207680_10000429 3300025903 Bacteria 19832
127 Ga0207671_10073154 3300025914 Bacteria 2560
128 Ga0207681_10000008 3300025923 Bacteria 414329
129 Ga0207694_10047452 3300025924 Bacteria 3322
130 Ga0207650_10012622 3300025925 Bacteria 5831
131 Ga0207687_10009216 3300025927 Bacteria 6458
132 Ga0207644_10000006 3300025931 Bacteria 408793
133 Ga0207644_10311465 3300025931 Bacteria 1271
134 Ga0207709_10441121 3300025935 Bacteria 1004
135 Ga0207711_10054184 3300025941 Bacteria 3441
136 Ga0207711_10109497 3300025941 Bacteria 2455
137 Ga0207712_10029836 3300025961 Bacteria 3662
138 Ga0207712_10575476 3300025961 Bacteria 971
139 Ga0207668_10000731 3300025972 Bacteria 20103
140 Ga0207658_10003035 3300025986 Bacteria 12000
141 Ga0207658_10005218 3300025986 Bacteria 8941
142 Ga0207703_10000717 3300026035 Bacteria 32692
143 Ga0207703_10001382 3300026035 Bacteria 22160
144 Ga0207703_10030735 3300026035 Bacteria 4243
145 Ga0207703_10134217 3300026035 Bacteria 2141
146 Ga0207641_10040103 3300026088 Bacteria 3918
147 Ga0207676_10000184 3300026095 Bacteria 55154
148 Ga0207676_10002410 3300026095 Bacteria 13340
149 Ga0207675_100000016 3300026118 Bacteria 126353
150 Ga0207675_100006560 3300026118 Bacteria 11012
151 Ga0268266_10031727 3300028379 Bacteria 4489
152 Ga0268265_10000392 3300028380 Bacteria 46740
153 Ga0268264_10000310 3300028381 Bacteria 78142
154 Ga0268264_10195903 3300028381 Bacteria 1845
155 Ga0307513_10162970 3300031456 Bacteria 2119
156 Ga0307508_10008297 3300031616 Bacteria 9613
157 Ga0307412_10001326 3300031911 Bacteria 13846
158 Ga0307412_10006734 3300031911 Bacteria 6514
159 Ga0307414_10002401 3300032004 Bacteria 9801
160 Ga0307414_10010725 3300032004 Bacteria 5336
161 Ga0307414_10025059 3300032004 Bacteria 3813
162 Ga0307510_10055679 3300033180 Bacteria 4128
163 Ga0439439_0007224 3300041406 Bacteria 2592
164 Ga0439461_0000029 3300041410 Bacteria 18346
165 Ga0439461_0001913 3300041410 Bacteria 3284
166 Ga0439466_0075421 3300041411 Bacteria 1069
167 Ga0439465_0000372 3300041413 Bacteria 12866
168 Ga0451843_0058334 3300041509 Bacteria 877
169 Ga0439431_0001265 3300041997 Bacteria 5536
170 Ga0439445_0003216 3300042004 Bacteria 3660
171 Ga0439445_0010439 3300042004 Bacteria 2197
172 Ga0439432_000872 3300042006 Bacteria 11305
173 Ga0439457_018289 3300042014 Bacteria 1556
174 Ga0439462_0000375 3300042015 Bacteria 8567
175 Ga0439434_0000237 3300042435 Bacteria 15345
176 Ga0451577_0258406 3300042876 Bacteria 1577
177 Ga0495627_000579 3300046453 Bacteria 29423
178 Ga0495638_0000344 3300046460 Bacteria 58565
179 Ga0495638_0029884 3300046460 Bacteria 3513
180 Ga0495650_0001710 3300046471 Bacteria 20145
181 Ga0495596_0000430 3300046500 Bacteria 26887
182 Ga0495607_0101519 3300046501 Bacteria 1540
183 Ga0495583_0037857 3300046506 Bacteria 2284
184 Ga0495606_0055970 3300046507 Bacteria 2548
185 Ga0495610_0000018 3300046512 Bacteria 355044
186 Ga0495610_0001676 3300046512 Bacteria 19476
187 Ga0495616_0000521 3300046513 Bacteria 29127
188 Ga0495616_0125781 3300046513 Bacteria 1179
189 Ga0495620_0031017 3300046515 Bacteria 2453
190 Ga0495632_0001865 3300046519 Bacteria 16917
191 Ga0495643_0000007 3300046522 Bacteria 383435
192 Ga0495643_0075494 3300046522 Bacteria 1764
193 Ga0495668_0000001 3300046616 Bacteria 1013420
194 Ga0495668_0100033 3300046616 Bacteria 1586
195 Ga0495625_0001272 3300046660 Bacteria 31687
196 Ga0495625_0002664 3300046660 Bacteria 19010
197 Ga0495625_0239057 3300046660 Bacteria 1183
198 Ga0495670_0000004 3300046691 Bacteria 310086
199 Ga0495670_0080044 3300046691 Bacteria 1663
200 Ga0495677_0025158 3300047445 Bacteria 2159
201 Ga0495681_0000040 3300047470 Bacteria 119638
202 Ga0495681_0036002 3300047470 Bacteria 2453
203 Ga0495686_0115381 3300047472 Bacteria 1606
204 Ga0495615_0000112 3300048090 Bacteria 21734
205 Ga0496102_0345410 3300048905 Bacteria 1401
206 Ga0496106_0326437 3300048909 Bacteria 1232
207 Ga0496115_0000504 3300048918 Bacteria 30605
208 Ga0496121_0000347 3300048924 Bacteria 96608
209 Ga0496122_0000934 3300048925 Bacteria 53129
210 Ga0496122_0003206 3300048925 Bacteria 21770
211 Ga0496122_0089742 3300048925 Bacteria 2100
212 Ga0496122_0109590 3300048925 Bacteria 1817
213 Ga0496123_0000740 3300048926 Bacteria 52939
214 Ga0496123_0002110 3300048926 Bacteria 25520
215 Ga0496123_0048514 3300048926 Bacteria 2856
216 Ga0496123_0081808 3300048926 Bacteria 1960
217 Ga0496124_0001292 3300048927 Bacteria 38002
218 Ga0496124_0001741 3300048927 Bacteria 30480
219 Ga0496124_0027022 3300048927 Bacteria 5162
220 Ga0496124_0124907 3300048927 Bacteria 2051
221 Ga0496125_0148901 3300048928 Bacteria 1612
222 Ga0496126_0072226 3300048929 Bacteria 3070
223 Ga0496126_0136116 3300048929 Bacteria 2119
224 Ga0501031_0121532 3300049568 Bacteria 1706
225 Ga0501031_0243070 3300049568 Bacteria 1170
226 Ga0501032_0023440 3300049569 Bacteria 4263
227 Ga0501032_0075163 3300049569 Bacteria 2250
228 Ga0501033_0005387 3300049570 Bacteria 10138
229 Ga0501033_0097832 3300049570 Bacteria 2143
230 Ga0501034_0015835 3300049571 Bacteria 7743
231 Ga0501034_0203124 3300049571 Bacteria 1939
232 Ga0501036_0026765 3300049572 Bacteria 4872
233 Ga0501037_0122035 3300049573 Bacteria 1873
234 Ga0501038_0041681 3300049574 Bacteria 4003
235 Ga0501039_0091041 3300049575 Bacteria 2377
236 Ga0501047_0063098 3300049581 Bacteria 3574
237 Ga0501047_0112166 3300049581 Bacteria 2609
238 Ga0501225_0091071 3300049705 Bacteria 883
239 Ga0501241_010816 3300049758 Bacteria 1657
240 Ga0501262_039373 3300049759 Bacteria 702
241 Ga0501264_001204 3300049761 Bacteria 2974
242 Ga0501035_0005118 3300049822 Bacteria 12415
243 Ga0501035_0055651 3300049822 Bacteria 3531
244 Ga0501044_0006703 3300049823 Bacteria 12701
245 Ga0501044_0201128 3300049823 Bacteria 1950
246 Ga0500643_001273 3300053087 Bacteria 14899
247 Ga0500643_007173 3300053087 Bacteria 4553
248 Ga0500566_0023489 3300053094 Bacteria 3620
249 Ga0500641_0035601 3300053096 Bacteria 1987
250 Ga0500562_062840 3300053108 Bacteria 998
251 Ga0500592_005654 3300053116 Bacteria 1989
252 Ga0500595_014639 3300053119 Bacteria 2971
253 Ga0500658_0000355 3300053134 Bacteria 20221
254 Ga0500658_0001058 3300053134 Bacteria 11275
255 Ga0500559_0007717 3300053136 Bacteria 4750
256 Ga0500559_0157297 3300053136 Bacteria 1067
257 Ga0500559_0162295 3300053136 Bacteria 1050
258 Ga0500559_0197938 3300053136 Bacteria 947
259 Ga0500568_0002416 3300053139 Bacteria 11013
260 Ga0500568_0006805 3300053139 Bacteria 5697
261 Ga0500568_0120456 3300053139 Bacteria 978
262 Ga0500577_0086707 3300053142 Bacteria 1258
263 Ga0500604_0021147 3300053151 Bacteria 1837
264 Ga0500624_000007 3300053157 Bacteria 184487
265 Ga0500624_000249 3300053157 Bacteria 18976
266 Ga0500627_0000991 3300053158 Bacteria 7713
267 Ga0500636_0057444 3300053177 Bacteria 2277
268 Ga0500636_0077035 3300053177 Bacteria 1927
269 2600226304 2599185359 Bacteria 4772316
270 2643821653 2643221560 Bacteria 4801179
271 2643835802 2643221563 Bacteria 4726935
272 2644056728 2643221608 Bacteria 4724829
273 2644126645 2643221622 Bacteria 4212502
274 2819712651 2818991466 Bacteria 4748179
275 2852655409 2852653556 Bacteria 4050083
276 2852681766 2852680915 Bacteria 4100189
277 2879164524 2879163058 Bacteria 4223965
278 2928527248 2928526807 Bacteria 4760224
279 2928969268 2928968154 Bacteria 4633371
280 3000866225 3000865235 Bacteria 3106258
281 8054302606 8054302542 Bacteria 5698134
282 Ga0065165_1001739
283 JGI25150J39212_1000672
284 JGI25165J46597_1000032
285 JGI25153J46596_10000017
286 JGI25153J46596_10007786
287 rootH1_10042889
288 rootH2_10120440
289 rootH2_10146928
290 rootL2_10000144
291 Ga0055526_1009390
292 Ga0055537_1001041
293 Ga0055537_1004947
294 Ga0055524_1000199
295 Ga0055536_1001142
296 Ga0055536_1005028
297 Ga0055536_1025081
298 Ga0055534_1013647
299 Ga0055530_10000060
300 Ga0055530_10000095
301 Ga0055530_10016229
302 Ga0055530_10023116
303 Ga0055540_1003362
304 Ga0055531_10000049
305 Ga0055531_10000671
306 Ga0055531_10005302
307 Ga0055531_10015072
308 Ga0055531_10022602
309 Ga0055531_10022923
310 Ga0065165_1008868
311 Ga0065165_1024167
312 Ga0065165_1033960
313 Ga0065704_10002515
314 Ga0065707_10115071
315 Ga0065707_10347026
316 Ga0070683_100432337
317 Ga0070666_10000305
318 Ga0070669_100000013
319 Ga0070671_100000009
320 Ga0070671_100099436
321 Ga0070667_100000678
322 Ga0070667_100139972
323 Ga0070686_100216466
324 Ga0068857_100112065
325 Ga0068857_100209791
326 Ga0068859_100000202
327 Ga0068859_100057544
328 Ga0068864_100000188
329 Ga0068864_100005285
330 Ga0068861_100000474
331 Ga0068861_100087598
332 Ga0068863_100047572
333 Ga0068863_100055070
334 Ga0068858_100000688
335 Ga0068858_100008985
336 Ga0068858_100057446
337 Ga0068858_100171954
338 Ga0068860_100093856
339 Ga0068862_100005465
340 Ga0081539_10014967
341 Ga0068865_100295161
342 Ga0097620_100000202
343 Ga0097620_100057543
344 Ga0105245_10000918
345 Ga0105247_10000831
346 Ga0105243_10019992
347 Ga0105243_10542597
348 Ga0105243_10926375
349 Ga0105248_10264922
350 Ga0105237_10028020
351 Ga0105238_10075210
352 Ga0105249_10066967
353 Ga0105249_11194917
354 Ga0105239_10492516
355 Ga0157370_10389360
356 Ga0163162_10018534
357 Ga0163162_10050948
358 Ga0163162_10071043
359 Ga0163163_10155607
360 Ga0157379_10245297
361 Ga0157379_10389283
362 Ga0163161_10097956
363 Ga0209437_110447
364 Ga0207425_1000022
365 Ga0207425_1008356
366 Ga0209129_1002797
367 Ga0209233_1000066
368 Ga0209565_1000010
369 Ga0209565_1000099
370 Ga0209673_1001971
371 Ga0209675_1000025
372 Ga0209675_1010607
373 Ga0209676_1000276
374 Ga0209676_1000362
375 Ga0209676_1012889
376 Ga0209676_1015121
377 Ga0209676_1019141
378 Ga0209676_1027504
379 Ga0209676_1030743
380 Ga0209025_1000318
381 Ga0209564_1003178
382 Ga0209564_1004032
383 Ga0209564_1039773
384 Ga0209758_1000004
385 Ga0209758_1009669
386 Ga0209758_1022215
387 Ga0209050_1000001
388 Ga0209050_1000010
389 Ga0209050_1000728
390 Ga0209050_1001953
391 Ga0209050_1004955
392 Ga0209050_1027857
393 Ga0209050_1057028
394 Ga0209256_1000034
395 Ga0209051_1000450
396 Ga0209257_1000009
397 Ga0209257_1000487
398 Ga0209257_1000596
399 Ga0209257_1000695
400 Ga0209257_1000872
401 Ga0209257_1000921
402 Ga0209257_1001879
403 Ga0209257_1019073
404 Ga0207697_10001013
405 Ga0207710_10003272
406 Ga0207680_10000429
407 Ga0207671_10073154
408 Ga0207681_10000008
409 Ga0207694_10047452
410 Ga0207650_10012622
411 Ga0207687_10009216
412 Ga0207644_10000006
413 Ga0207644_10311465
414 Ga0207709_10441121
415 Ga0207711_10054184
416 Ga0207711_10109497
417 Ga0207712_10029836
418 Ga0207712_10575476
419 Ga0207668_10000731
420 Ga0207658_10003035
421 Ga0207658_10005218
422 Ga0207703_10000717
423 Ga0207703_10001382
424 Ga0207703_10030735
425 Ga0207703_10134217
426 Ga0207641_10040103
427 Ga0207676_10000184
428 Ga0207676_10002410
429 Ga0207675_100000016
430 Ga0207675_100006560
431 Ga0268266_10031727
432 Ga0268265_10000392
433 Ga0268264_10000310
434 Ga0268264_10195903
435 Ga0307513_10162970
436 Ga0307508_10008297
437 Ga0307412_10001326
438 Ga0307412_10006734
439 Ga0307414_10002401
440 Ga0307414_10010725
441 Ga0307414_10025059
442 Ga0307510_10055679
443 Ga0439439_0007224
444 Ga0439461_0000029
445 Ga0439461_0001913
446 Ga0439466_0075421
447 Ga0439465_0000372
448 Ga0451843_0058334
449 Ga0439431_0001265
450 Ga0439445_0003216
451 Ga0439445_0010439
452 Ga0439432_000872
453 Ga0439457_018289
454 Ga0439462_0000375
455 Ga0439434_0000237
456 Ga0451577_0258406
457 Ga0495627_000579
458 Ga0495638_0000344
459 Ga0495638_0029884
460 Ga0495650_0001710
461 Ga0495596_0000430
462 Ga0495607_0101519
463 Ga0495583_0037857
464 Ga0495606_0055970
465 Ga0495610_0000018
466 Ga0495610_0001676
467 Ga0495616_0000521
468 Ga0495616_0125781
469 Ga0495620_0031017
470 Ga0495632_0001865
471 Ga0495643_0000007
472 Ga0495643_0075494
473 Ga0495668_0000001
474 Ga0495668_0100033
475 Ga0495625_0001272
476 Ga0495625_0002664
477 Ga0495625_0239057
478 Ga0495670_0000004
479 Ga0495670_0080044
480 Ga0495677_0025158
481 Ga0495681_0000040
482 Ga0495681_0036002
483 Ga0495686_0115381
484 Ga0495615_0000112
485 Ga0496102_0345410
486 Ga0496106_0326437
487 Ga0496115_0000504
488 Ga0496121_0000347
489 Ga0496122_0000934
490 Ga0496122_0003206
491 Ga0496122_0089742
492 Ga0496122_0109590
493 Ga0496123_0000740
494 Ga0496123_0002110
495 Ga0496123_0048514
496 Ga0496123_0081808
497 Ga0496124_0001292
498 Ga0496124_0001741
499 Ga0496124_0027022
500 Ga0496124_0124907
501 Ga0496125_0148901
502 Ga0496126_0072226
503 Ga0496126_0136116
504 Ga0501031_0121532
505 Ga0501031_0243070
506 Ga0501032_0023440
507 Ga0501032_0075163
508 Ga0501033_0005387
509 Ga0501033_0097832
510 Ga0501034_0015835
511 Ga0501034_0203124
512 Ga0501036_0026765
513 Ga0501037_0122035
514 Ga0501038_0041681
515 Ga0501039_0091041
516 Ga0501047_0063098
517 Ga0501047_0112166
518 Ga0501225_0091071
519 Ga0501241_010816
520 Ga0501262_039373
521 Ga0501264_001204
522 Ga0501035_0005118
523 Ga0501035_0055651
524 Ga0501044_0006703
525 Ga0501044_0201128
526 Ga0500643_001273
527 Ga0500643_007173
528 Ga0500566_0023489
529 Ga0500641_0035601
530 Ga0500562_062840
531 Ga0500592_005654
532 Ga0500595_014639
533 Ga0500658_0000355
534 Ga0500658_0001058
535 Ga0500559_0007717
536 Ga0500559_0157297
537 Ga0500559_0162295
538 Ga0500559_0197938
539 Ga0500568_0002416
540 Ga0500568_0006805
541 Ga0500568_0120456
542 Ga0500577_0086707
543 Ga0500604_0021147
544 Ga0500624_000007
545 Ga0500624_000249
546 Ga0500627_0000991
547 Ga0500636_0057444
548 Ga0500636_0077035
549 2600226304
550 2643821653
551 2643835802
552 2644056728
553 2644126645
554 2819712651
555 2852655409
556 2852681766
557 2879164524
558 2928527248
559 2928969268
560 3000866225
561 8054302606

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05013

FGase

N-formylglutamate amidohydrolase

13

213

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2odf-assembly3.cif.gz_C the crystal structure of gene product atu2144 from agrobacterium tumefaciens 0.9072 2 232
2odf-assembly3.cif.gz_C the crystal structure of gene product atu2144 from agrobacterium tumefaciens 0.8961 2 232
2odf-assembly2.cif.gz_B the crystal structure of gene product atu2144 from agrobacterium tumefaciens 0.8834 2 232
2odf-assembly2.cif.gz_B the crystal structure of gene product atu2144 from agrobacterium tumefaciens 0.8724 2 232
4zb7-assembly1.cif.gz_A phanerochaete chrysosporium ure2p6 in apo form. 0.7786 148 185
ID Description Score Start End Superfamily
2odfB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.8827 4 232 3.40.630.40
2odfB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn-dependent exopeptidases 0.8645 4 232 3.40.630.40
af_A0A286Y8C0_82_329_3.40.50.980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8201 114 132 3.40.50.980
4ld0B00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7761 104 135 3.30.420.10
af_Q9Y7Q2_1_228_1.20.1050.130 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.7431 148 186 1.20.1050.130
ID Description Score Start End GO Terms
AF-A0A7W7K1R4-F1-model_v4 Putative N-formylglutamate amidohydrolase 0.9797 4 231 GO:0016787
AF-A0A258SHA1-F1-model_v4 N-formylglutamate amidohydrolase 0.9754 4 231 GO:0016787
AF-A0A7W0HYD9-F1-model_v4 N-formylglutamate amidohydrolase 0.9727 1 231 GO:0016787
AF-A0A285R091-F1-model_v4 Predicted N-formylglutamate amidohydrolase 0.9699 4 231 GO:0016787
AF-A0A0E9MMP6-F1-model_v4 Putative N-formylglutamate amidohydrolase 0.968 1 231 GO:0016787

Map