F383755

General Info

Members Datasets Scaffolds Average Seq Length
280 136 280 292

Family's Representative Sequence

Representative Sequence 3300028653|Ga0265323_10014305|Ga0265323_100143053
Length 326
Sequence MGLAAGSAYSTSKCDQTRFHPRANRSPLARFVFVKTMPLEKNSPCKVNLLLNILGRRADGFHELETVMQPVNLCDRLTFERCGGGIELSCSDATLPVDARNLVHRAATGFMQAAKINNGVRIHLEKKIPLAAGLGGGSGNAATTLLGLNELFGQPLPAAKLNELAAGLGSDVPFFLQGKPVLATGRGEKIQPLDFFPALSGKALLLIHPGFGISTPWAYQNLARFPVALNGQPNRAQKLVARLQAGDWRAASAEFYNSLEAPALEKYPVLALFQEFLRANGALAALMSGSGSTTFAIAKNQAAAESLVEKFKSKFGQNCWTAVVGI

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
53 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
54 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
55 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
56 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
57 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
58 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
59 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
62 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
63 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
64 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
65 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
66 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
67 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
68 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
69 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
70 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
71 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
79 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
80 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
81 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
82 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
83 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
84 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
85 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
86 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
95 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
96 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
97 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
98 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
99 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
100 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
101 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
102 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
103 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
109 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
110 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
136 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 0
Rhizosphere 99.29
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10059108 3300003320 Bacteria 25565
2 Ga0070658_10388284 3300005327 Unclassified 1198
3 Ga0070690_100134292 3300005330 Bacteria 1674
4 Ga0070690_100293659 3300005330 Bacteria 1163
5 Ga0070670_100077684 3300005331 Bacteria 2852
6 Ga0070670_100171252 3300005331 Bacteria 1883
7 Ga0070689_100275251 3300005340 Bacteria 1395
8 Ga0070689_100324592 3300005340 Bacteria 1286
9 Ga0070691_10011583 3300005341 Unclassified 4030
10 Ga0070669_100188639 3300005353 Unclassified 1616
11 Ga0070688_100100386 3300005365 Unclassified 1907
12 Ga0070688_100234260 3300005365 Bacteria 1300
13 Ga0070714_100004453 3300005435 Bacteria 10551
14 Ga0070711_100000512 3300005439 Bacteria 20157
15 Ga0070708_100024997 3300005445 Bacteria 5103
16 Ga0070681_10017749 3300005458 Bacteria 7111
17 Ga0068867_100126342 3300005459 Unclassified 1982
18 Ga0070685_10149902 3300005466 Unclassified 1477
19 Ga0070684_100199969 3300005535 Bacteria 1820
20 Ga0070684_100505242 3300005535 Unclassified 1120
21 Ga0068855_100012591 3300005563 Bacteria 10207
22 Ga0068855_100095683 3300005563 Bacteria 3423
23 Ga0068855_100150993 3300005563 Unclassified 2642
24 Ga0068855_100300183 3300005563 Bacteria 1779
25 Ga0068857_100047357 3300005577 Bacteria 3817
26 Ga0068856_100000247 3300005614 Bacteria 58943
27 Ga0068856_100286788 3300005614 Unclassified 1663
28 Ga0068859_100001997 3300005617 Bacteria 20834
29 Ga0068859_100236725 3300005617 Bacteria 1915
30 Ga0068859_100602734 3300005617 Bacteria 1191
31 Ga0068863_100007278 3300005841 Bacteria 10842
32 Ga0068863_100326562 3300005841 Bacteria 1491
33 Ga0068858_100160149 3300005842 Bacteria 2119
34 Ga0070712_100318359 3300006175 Bacteria 1264
35 Ga0075428_100003980 3300006844 Bacteria 16209
36 Ga0075428_100309476 3300006844 Bacteria 1698
37 Ga0075430_100307739 3300006846 Bacteria 1310
38 Ga0075431_100062369 3300006847 Bacteria 3846
39 Ga0075431_100142351 3300006847 Bacteria 2472
40 Ga0075429_100175563 3300006880 Bacteria 1877
41 Ga0075429_100597208 3300006880 Unclassified 967
42 Ga0097620_100001997 3300006931 Bacteria 20834
43 Ga0097620_100236712 3300006931 Bacteria 1915
44 Ga0097620_100602730 3300006931 Bacteria 1191
45 Ga0075435_100334795 3300007076 Bacteria 1297
46 Ga0105240_10033120 3300009093 Bacteria 6679
47 Ga0105240_10079068 3300009093 Bacteria 4048
48 Ga0105240_10082045 3300009093 Bacteria 3960
49 Ga0105240_10097586 3300009093 Bacteria 3580
50 Ga0105240_10376186 3300009093 Unclassified 1605
51 Ga0105240_10642916 3300009093 Unclassified 1164
52 Ga0105240_10817316 3300009093 Unclassified 1008
53 Ga0111539_10065588 3300009094 Unclassified 4289
54 Ga0111539_10151627 3300009094 Bacteria 2713
55 Ga0111539_10163115 3300009094 Bacteria 2607
56 Ga0111539_10530386 3300009094 Unclassified 1372
57 Ga0114129_10432580 3300009147 Bacteria 1729
58 Ga0105241_10284836 3300009174 Bacteria 1413
59 Ga0105242_10413022 3300009176 Unclassified 1263
60 Ga0105242_10429690 3300009176 Unclassified 1240
61 Ga0105238_10001266 3300009551 Bacteria 25411
62 Ga0105238_10009770 3300009551 Bacteria 9608
63 Ga0105238_10040409 3300009551 Bacteria 4727
64 Ga0105238_10587744 3300009551 Bacteria 1120
65 Ga0157370_10192064 3300013104 Unclassified 1895
66 Ga0163162_10471662 3300013306 Bacteria 1387
67 Ga0157372_10561365 3300013307 Bacteria 1331
68 Ga0157375_10000080 3300013308 Bacteria 96665
69 Ga0163163_10001224 3300014325 Bacteria 21706
70 Ga0163163_10102840 3300014325 Bacteria 2881
71 Ga0207707_10078089 3300025912 Bacteria 2890
72 Ga0207707_10229728 3300025912 Bacteria 1614
73 Ga0207695_10039233 3300025913 Bacteria 5091
74 Ga0207695_10058308 3300025913 Bacteria 4008
75 Ga0207695_10177591 3300025913 Unclassified 2051
76 Ga0207695_10388288 3300025913 Bacteria 1281
77 Ga0207693_10291970 3300025915 Bacteria 1278
78 Ga0207663_10004819 3300025916 Bacteria 6744
79 Ga0207681_10478099 3300025923 Unclassified 1017
80 Ga0207694_10004972 3300025924 Bacteria 10291
81 Ga0207700_10453076 3300025928 Unclassified 1131
82 Ga0207686_10327516 3300025934 Unclassified 1147
83 Ga0207670_10008251 3300025936 Bacteria 5867
84 Ga0207670_10153007 3300025936 Bacteria 1714
85 Ga0207670_10289769 3300025936 Bacteria 1279
86 Ga0207667_10108825 3300025949 Bacteria 2859
87 Ga0207667_10208867 3300025949 Bacteria 2001
88 Ga0207667_10210430 3300025949 Bacteria 1993
89 Ga0207641_10006537 3300026088 Bacteria 9804
90 Ga0207641_10138383 3300026088 Bacteria 2194
91 Ga0207674_10015794 3300026116 Bacteria 8281
92 Ga0265337_1000172 3300028556 Bacteria 33853
93 Ga0265337_1011813 3300028556 Bacteria 2995
94 Ga0265337_1016796 3300028556 Bacteria 2359
95 Ga0265337_1028108 3300028556 Unclassified 1691
96 Ga0265337_1041644 3300028556 Bacteria 1320
97 Ga0265337_1063744 3300028556 Bacteria 1018
98 Ga0265326_10004027 3300028558 Unclassified 4752
99 Ga0265326_10011200 3300028558 Bacteria 2647
100 Ga0265326_10019360 3300028558 Unclassified 1956
101 Ga0265319_1000007 3300028563 Bacteria 217194
102 Ga0265319_1008051 3300028563 Bacteria 4660
103 Ga0265319_1012635 3300028563 Unclassified 3402
104 Ga0265334_10013261 3300028573 Bacteria 3452
105 Ga0265334_10048069 3300028573 Bacteria 1644
106 Ga0265318_10032690 3300028577 Unclassified 2012
107 Ga0265323_10000183 3300028653 Bacteria 37704
108 Ga0265323_10006585 3300028653 Bacteria 4875
109 Ga0265323_10014305 3300028653 Bacteria 3147
110 Ga0265322_10005233 3300028654 Bacteria 3838
111 Ga0265322_10039326 3300028654 Unclassified 1345
112 Ga0265336_10017777 3300028666 Bacteria 2312
113 Ga0265336_10026630 3300028666 Bacteria 1816
114 Ga0265336_10034251 3300028666 Bacteria 1570
115 Ga0265336_10043028 3300028666 Bacteria 1378
116 Ga0265338_10000138 3300028800 Bacteria 135457
117 Ga0265338_10000184 3300028800 Bacteria 116834
118 Ga0265338_10000263 3300028800 Bacteria 95638
119 Ga0265338_10001365 3300028800 Bacteria 39706
120 Ga0265338_10001550 3300028800 Bacteria 37131
121 Ga0265338_10001666 3300028800 Bacteria 35378
122 Ga0265338_10001733 3300028800 Bacteria 34498
123 Ga0265338_10002298 3300028800 Bacteria 29060
124 Ga0265338_10006727 3300028800 Bacteria 14515
125 Ga0265338_10007778 3300028800 Bacteria 13185
126 Ga0265338_10008583 3300028800 Bacteria 12364
127 Ga0265338_10008919 3300028800 Bacteria 12075
128 Ga0265338_10010037 3300028800 Bacteria 11190
129 Ga0265338_10010134 3300028800 Bacteria 11119
130 Ga0265338_10010400 3300028800 Bacteria 10916
131 Ga0265338_10018829 3300028800 Bacteria 7365
132 Ga0265338_10022151 3300028800 Bacteria 6593
133 Ga0265338_10028485 3300028800 Bacteria 5569
134 Ga0265338_10028756 3300028800 Bacteria 5534
135 Ga0265338_10036965 3300028800 Bacteria 4659
136 Ga0265338_10059572 3300028800 Bacteria 3363
137 Ga0265338_10079009 3300028800 Bacteria 2771
138 Ga0265338_10095767 3300028800 Unclassified 2437
139 Ga0265338_10192360 3300028800 Bacteria 1545
140 Ga0265338_10208458 3300028800 Bacteria 1469
141 Ga0265338_10228700 3300028800 Unclassified 1384
142 Ga0265338_10233101 3300028800 Bacteria 1368
143 Ga0265324_10000146 3300029957 Bacteria 54469
144 Ga0265324_10007170 3300029957 Unclassified 4551
145 Ga0265324_10011881 3300029957 Bacteria 3305
146 Ga0265324_10020906 3300029957 Bacteria 2350
147 Ga0265324_10054946 3300029957 Bacteria 1365
148 Ga0265330_10067327 3300031235 Bacteria 1552
149 Ga0265320_10000296 3300031240 Bacteria 40524
150 Ga0265320_10005311 3300031240 Bacteria 8295
151 Ga0265320_10006964 3300031240 Bacteria 7054
152 Ga0265320_10007133 3300031240 Bacteria 6968
153 Ga0265320_10011044 3300031240 Bacteria 5335
154 Ga0265320_10024492 3300031240 Bacteria 3192
155 Ga0265320_10046225 3300031240 Unclassified 2135
156 Ga0265320_10152166 3300031240 Bacteria 1044
157 Ga0265325_10001910 3300031241 Bacteria 14389
158 Ga0265325_10065049 3300031241 Bacteria 1842
159 Ga0265329_10003874 3300031242 Bacteria 6411
160 Ga0265340_10000859 3300031247 Bacteria 17275
161 Ga0265339_10009706 3300031249 Bacteria 6020
162 Ga0265339_10018724 3300031249 Bacteria 4077
163 Ga0265331_10043695 3300031250 Bacteria 2169
164 Ga0265327_10001384 3300031251 Bacteria 30970
165 Ga0265327_10075353 3300031251 Bacteria 1678
166 Ga0265316_10005083 3300031344 Bacteria 12899
167 Ga0265316_10007693 3300031344 Bacteria 10104
168 Ga0265316_10008162 3300031344 Bacteria 9742
169 Ga0265316_10012135 3300031344 Bacteria 7735
170 Ga0265316_10163654 3300031344 Bacteria 1662
171 Ga0265316_10170074 3300031344 Unclassified 1626
172 Ga0265316_10288090 3300031344 Unclassified 1199
173 Ga0265313_10001258 3300031595 Bacteria 24105
174 Ga0265313_10002127 3300031595 Bacteria 17629
175 Ga0265313_10106631 3300031595 Unclassified 1237
176 Ga0265314_10000147 3300031711 Bacteria 105307
177 Ga0265314_10071112 3300031711 Bacteria 2329
178 Ga0265314_10079016 3300031711 Unclassified 2176
179 Ga0265314_10089336 3300031711 Bacteria 2010
180 Ga0265342_10065074 3300031712 Bacteria 2138
181 Ga0265342_10076025 3300031712 Bacteria 1947
182 Ga0316576_10349804 3300031727 Unclassified 1100
183 Ga0307405_10076403 3300031731 Unclassified 2173
184 Ga0307416_100045775 3300032002 Unclassified 3448
185 Ga0307411_10080924 3300032005 Unclassified 2235
186 Ga0373938_0012549 3300034957 Unclassified 1592
187 Ga0373928_0000452 3300035084 Bacteria 8078
188 Ga0373929_0011301 3300035085 Unclassified 1681
189 Ga0373944_0000766 3300035089 Bacteria 7815
190 Ga0373951_0001905 3300035091 Bacteria 5378
191 Ga0373932_0000001 3300035112 Bacteria 1459067
192 Ga0373945_0007215 3300035116 Bacteria 3598
193 Ga0373962_0000045 3300035242 Bacteria 28368
194 Ga0316574_0035844 3300035398 Bacteria 3034
195 Ga0373931_0000002 3300035691 Bacteria 599830
196 Ga0373931_0087443 3300035691 Bacteria 1731
197 Ga0373931_0174697 3300035691 Bacteria 1268
198 Ga0373935_0007108 3300035692 Bacteria 6684
199 Ga0373935_0046052 3300035692 Bacteria 2754
200 Ga0373927_0003325 3300035695 Bacteria 11571
201 Ga0373927_0004094 3300035695 Bacteria 10273
202 Ga0373927_0012620 3300035695 Bacteria 5620
203 Ga0373947_0007686 3300035725 Bacteria 6228
204 Ga0373925_0005746 3300037068 Bacteria 9219
205 Ga0373925_0009483 3300037068 Bacteria 7087
206 Ga0373925_0123223 3300037068 Bacteria 2014
207 Ga0451577_0001349 3300042876 Bacteria 33188
208 Ga0451577_0002638 3300042876 Bacteria 21011
209 Ga0451577_0028117 3300042876 Bacteria 5088
210 Ga0453684_0002234 3300044712 Bacteria 48025
211 Ga0453684_0005116 3300044712 Bacteria 26414
212 Ga0453684_0029499 3300044712 Bacteria 7785
213 Ga0451576_0071938 3300045051 Bacteria 3599
214 Ga0451576_0090229 3300045051 Unclassified 3188
215 Ga0451576_0111352 3300045051 Unclassified 2849
216 Ga0451576_0145269 3300045051 Bacteria 2473
217 Ga0451576_0256633 3300045051 Bacteria 1827
218 Ga0451576_0310347 3300045051 Bacteria 1650
219 Ga0495592_0047453 3300046454 Bacteria 3199
220 Ga0495592_0052854 3300046454 Bacteria 3015
221 Ga0495603_0228084 3300046455 Unclassified 1074
222 Ga0495641_0011673 3300046461 Bacteria 4981
223 Ga0495582_0011528 3300046473 Bacteria 4872
224 Ga0495639_0022694 3300046475 Bacteria 2754
225 Ga0495662_0031162 3300046476 Bacteria 2576
226 Ga0495664_0197546 3300046477 Bacteria 1219
227 Ga0495618_0006236 3300046514 Bacteria 7236
228 Ga0495618_0191593 3300046514 Bacteria 1296
229 Ga0495628_0078500 3300046516 Bacteria 2567
230 Ga0495630_0009780 3300046517 Bacteria 6902
231 Ga0495630_0027619 3300046517 Bacteria 4212
232 Ga0495630_0104546 3300046517 Bacteria 2143
233 Ga0495630_0242851 3300046517 Bacteria 1376
234 Ga0495666_0048980 3300046526 Bacteria 2033
235 Ga0495652_0007198 3300046529 Bacteria 10271
236 Ga0495640_0023074 3300046533 Bacteria 4543
237 Ga0495640_0052118 3300046533 Bacteria 2811
238 Ga0495640_0065192 3300046533 Unclassified 2460
239 Ga0495640_0209760 3300046533 Unclassified 1232
240 Ga0495586_0000009 3300046535 Bacteria 144639
241 Ga0495586_0003482 3300046535 Bacteria 8438
242 Ga0495586_0007496 3300046535 Bacteria 5824
243 Ga0495586_0062133 3300046535 Bacteria 2033
244 Ga0495645_0006553 3300046543 Bacteria 8087
245 Ga0495622_0056436 3300046557 Bacteria 1821
246 Ga0495667_0261136 3300046559 Bacteria 1101
247 Ga0495634_0000900 3300046642 Bacteria 28505
248 Ga0495635_0010693 3300046663 Bacteria 6426
249 Ga0495647_0007197 3300046681 Bacteria 3721
250 Ga0495658_0026625 3300046683 Bacteria 3101
251 Ga0495658_0038896 3300046683 Bacteria 2636
252 Ga0495613_0003718 3300046689 Bacteria 11448
253 Ga0495624_0089153 3300046690 Bacteria 1904
254 Ga0495624_0101898 3300046690 Bacteria 1767
255 Ga0495674_0000043 3300047319 Bacteria 92585
256 Ga0495674_0058536 3300047319 Bacteria 3368
257 Ga0495674_0097155 3300047319 Bacteria 2509
258 Ga0495680_0143368 3300047322 Bacteria 1746
259 Ga0495684_0202315 3300047471 Bacteria 1464
260 Ga0501031_0000239 3300049568 Bacteria 31192
261 Ga0501032_0011009 3300049569 Bacteria 6503
262 Ga0501033_0001502 3300049570 Bacteria 20665
263 Ga0501034_0535513 3300049571 Bacteria 1082
264 Ga0501037_0214190 3300049573 Bacteria 1357
265 Ga0501043_0051625 3300049579 Bacteria 3231
266 Ga0501048_0189445 3300049582 Unclassified 1458
267 Ga0501080_0048909 3300049742 Bacteria 3935
268 Ga0501035_0004557 3300049822 Bacteria 13153
269 Ga0501035_0043628 3300049822 Unclassified 4040
270 Ga0501044_0000668 3300049823 Bacteria 41414
271 Ga0501044_0018648 3300049823 Bacteria 7432
272 nmdc:mga09592_158205_c1 3300050508 Bacteria 1956
273 nmdc:mga09592_243247_c1 3300050508 Bacteria 1559
274 nmdc:mga0qj67_162805_c1 3300050509 Bacteria 1811
275 nmdc:mga06r32_114598_c1 3300050510 Bacteria 2654
276 nmdc:mga08y16_259629_c1 3300050511 Bacteria 1794
277 nmdc:mga08y16_342668_c1 3300050511 Unclassified 1536
278 nmdc:mga08y16_438963_c1 3300050511 Unclassified 1333
279 Ga0495601_0028257 3300053077 Bacteria 3473
280 Ga0500650_0007551 3300053098 Unclassified 4242

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0214190 Ga0501037_0214190_14_808 262
2 3300005331 Ga0070670_100171252 Ga0070670_1001712522 271
3 3300013306 Ga0163162_10471662 Ga0163162_104716622 271
4 3300042876 Ga0451577_0001349 Ga0451577_0001349_16869_17741 273
5 3300044712 Ga0453684_0005116 Ga0453684_0005116_3405_4277 273
6 3300035691 Ga0373931_0174697 Ga0373931_0174697_252_1088 274
7 3300009093 Ga0105240_10376186 Ga0105240_103761862 276
8 3300046473 Ga0495582_0011528 Ga0495582_0011528_19_852 276
9 3300044712 Ga0453684_0029499 Ga0453684_0029499_5524_6486 277
10 3300006846 Ga0075430_100307739 Ga0075430_1003077392 278
11 3300006847 Ga0075431_100062369 Ga0075431_1000623692 278
12 3300006880 Ga0075429_100597208 Ga0075429_1005972081 278
13 3300050508 nmdc:mga09592_243247_c1 nmdc:mga09592_243247_c1_609_1454 278
14 3300050509 nmdc:mga0qj67_162805_c1 nmdc:mga0qj67_162805_c1_911_1756 278
15 3300050510 nmdc:mga06r32_114598_c1 nmdc:mga06r32_114598_c1_343_1188 278
16 3300005365 Ga0070688_100100386 Ga0070688_1001003863 287
17 3300005466 Ga0070685_10149902 Ga0070685_101499022 287
18 3300005617 Ga0068859_100001997 Ga0068859_1000019979 287
19 3300005842 Ga0068858_100160149 Ga0068858_1001601492 287
20 3300006880 Ga0075429_100175563 Ga0075429_1001755632 287
21 3300006931 Ga0097620_100001997 Ga0097620_1000019979 287
22 3300009093 Ga0105240_10082045 Ga0105240_100820451 287
23 3300009094 Ga0111539_10151627 Ga0111539_101516272 287
24 3300025913 Ga0207695_10058308 Ga0207695_100583085 287
25 3300028573 Ga0265334_10048069 Ga0265334_100480691 287
26 3300046517 Ga0495630_0104546 Ga0495630_0104546_1127_1993 287
27 3300046559 Ga0495667_0261136 Ga0495667_0261136_200_1066 287
28 3300050508 nmdc:mga09592_158205_c1 nmdc:mga09592_158205_c1_324_1202 287
29 3300050511 nmdc:mga08y16_259629_c1 nmdc:mga08y16_259629_c1_733_1611 287
30 3300005331 Ga0070670_100077684 Ga0070670_1000776842 288
31 3300005353 Ga0070669_100188639 Ga0070669_1001886392 288
32 3300005459 Ga0068867_100126342 Ga0068867_1001263422 288
33 3300005617 Ga0068859_100602734 Ga0068859_1006027342 288
34 3300006844 Ga0075428_100003980 Ga0075428_1000039805 288
35 3300006844 Ga0075428_100309476 Ga0075428_1003094762 288
36 3300006931 Ga0097620_100602730 Ga0097620_1006027302 288
37 3300007076 Ga0075435_100334795 Ga0075435_1003347952 288
38 3300009094 Ga0111539_10065588 Ga0111539_100655884 288
39 3300009094 Ga0111539_10530386 Ga0111539_105303861 288
40 3300009147 Ga0114129_10432580 Ga0114129_104325802 288
41 3300009176 Ga0105242_10429690 Ga0105242_104296901 288
42 3300025923 Ga0207681_10478099 Ga0207681_104780991 288
43 3300026088 Ga0207641_10138383 Ga0207641_101383832 288
44 3300028556 Ga0265337_1011813 Ga0265337_10118131 288
45 3300028556 Ga0265337_1016796 Ga0265337_10167961 288
46 3300028556 Ga0265337_1041644 Ga0265337_10416442 288
47 3300028558 Ga0265326_10011200 Ga0265326_100112003 288
48 3300028666 Ga0265336_10026630 Ga0265336_100266302 288
49 3300028800 Ga0265338_10010134 Ga0265338_100101343 288
50 3300028800 Ga0265338_10208458 Ga0265338_102084581 288
51 3300029957 Ga0265324_10054946 Ga0265324_100549462 288
52 3300031235 Ga0265330_10067327 Ga0265330_100673272 288
53 3300031240 Ga0265320_10007133 Ga0265320_100071338 288
54 3300031241 Ga0265325_10001910 Ga0265325_100019104 288
55 3300031249 Ga0265339_10009706 Ga0265339_100097065 288
56 3300031250 Ga0265331_10043695 Ga0265331_100436952 288
57 3300031344 Ga0265316_10005083 Ga0265316_1000508310 288
58 3300031595 Ga0265313_10001258 Ga0265313_1000125810 288
59 3300031711 Ga0265314_10089336 Ga0265314_100893362 288
60 3300031712 Ga0265342_10065074 Ga0265342_100650742 288
61 3300031731 Ga0307405_10076403 Ga0307405_100764033 288
62 3300032002 Ga0307416_100045775 Ga0307416_1000457753 288
63 3300032005 Ga0307411_10080924 Ga0307411_100809243 288
64 3300045051 Ga0451576_0145269 Ga0451576_0145269_676_1566 288
65 3300046461 Ga0495641_0011673 Ga0495641_0011673_2566_3513 288
66 3300046475 Ga0495639_0022694 Ga0495639_0022694_383_1330 288
67 3300046533 Ga0495640_0052118 Ga0495640_0052118_1180_2127 288
68 3300046533 Ga0495640_0209760 Ga0495640_0209760_33_902 288
69 3300046535 Ga0495586_0003482 Ga0495586_0003482_1542_2453 288
70 3300046681 Ga0495647_0007197 Ga0495647_0007197_1537_2484 288
71 3300046683 Ga0495658_0026625 Ga0495658_0026625_427_1314 288
72 3300046683 Ga0495658_0038896 Ga0495658_0038896_1032_1979 288
73 3300046689 Ga0495613_0003718 Ga0495613_0003718_2157_3104 288
74 3300049571 Ga0501034_0535513 Ga0501034_0535513_23_895 288
75 3300050511 nmdc:mga08y16_438963_c1 nmdc:mga08y16_438963_c1_398_1321 288
76 3300003320 rootH2_10059108 rootH2_1005910823 289
77 3300005327 Ga0070658_10388284 Ga0070658_103882841 289
78 3300005330 Ga0070690_100134292 Ga0070690_1001342922 289
79 3300005330 Ga0070690_100293659 Ga0070690_1002936592 289
80 3300005340 Ga0070689_100275251 Ga0070689_1002752511 289
81 3300005340 Ga0070689_100324592 Ga0070689_1003245922 289
82 3300005341 Ga0070691_10011583 Ga0070691_100115832 289
83 3300005365 Ga0070688_100234260 Ga0070688_1002342602 289
84 3300005435 Ga0070714_100004453 Ga0070714_1000044534 289
85 3300005439 Ga0070711_100000512 Ga0070711_10000051210 289
86 3300005445 Ga0070708_100024997 Ga0070708_1000249976 289
87 3300005458 Ga0070681_10017749 Ga0070681_100177496 289
88 3300005535 Ga0070684_100199969 Ga0070684_1001999692 289
89 3300005535 Ga0070684_100505242 Ga0070684_1005052421 289
90 3300005563 Ga0068855_100012591 Ga0068855_1000125914 289
91 3300005563 Ga0068855_100095683 Ga0068855_1000956834 289
92 3300005563 Ga0068855_100150993 Ga0068855_1001509932 289
93 3300005563 Ga0068855_100300183 Ga0068855_1003001831 289
94 3300005577 Ga0068857_100047357 Ga0068857_1000473572 289
95 3300005614 Ga0068856_100000247 Ga0068856_10000024724 289
96 3300005614 Ga0068856_100286788 Ga0068856_1002867882 289
97 3300005617 Ga0068859_100236725 Ga0068859_1002367252 289
98 3300005841 Ga0068863_100007278 Ga0068863_1000072787 289
99 3300005841 Ga0068863_100326562 Ga0068863_1003265622 289
100 3300006175 Ga0070712_100318359 Ga0070712_1003183592 289
101 3300006847 Ga0075431_100142351 Ga0075431_1001423512 289
102 3300006931 Ga0097620_100236712 Ga0097620_1002367122 289
103 3300009093 Ga0105240_10033120 Ga0105240_100331205 289
104 3300009093 Ga0105240_10079068 Ga0105240_100790682 289
105 3300009093 Ga0105240_10097586 Ga0105240_100975863 289
106 3300009093 Ga0105240_10642916 Ga0105240_106429161 289
107 3300009093 Ga0105240_10817316 Ga0105240_108173161 289
108 3300009094 Ga0111539_10163115 Ga0111539_101631153 289
109 3300009174 Ga0105241_10284836 Ga0105241_102848362 289
110 3300009176 Ga0105242_10413022 Ga0105242_104130221 289
111 3300009551 Ga0105238_10001266 Ga0105238_1000126612 289
112 3300009551 Ga0105238_10009770 Ga0105238_100097709 289
113 3300009551 Ga0105238_10040409 Ga0105238_100404093 289
114 3300009551 Ga0105238_10587744 Ga0105238_105877441 289
115 3300013104 Ga0157370_10192064 Ga0157370_101920642 289
116 3300013307 Ga0157372_10561365 Ga0157372_105613651 289
117 3300013308 Ga0157375_10000080 Ga0157375_1000008024 289
118 3300014325 Ga0163163_10001224 Ga0163163_100012243 289
119 3300014325 Ga0163163_10102840 Ga0163163_101028403 289
120 3300025912 Ga0207707_10078089 Ga0207707_100780893 289
121 3300025912 Ga0207707_10229728 Ga0207707_102297282 289
122 3300025913 Ga0207695_10039233 Ga0207695_100392335 289
123 3300025913 Ga0207695_10177591 Ga0207695_101775912 289
124 3300025913 Ga0207695_10388288 Ga0207695_103882881 289
125 3300025915 Ga0207693_10291970 Ga0207693_102919702 289
126 3300025916 Ga0207663_10004819 Ga0207663_100048192 289
127 3300025924 Ga0207694_10004972 Ga0207694_100049724 289
128 3300025928 Ga0207700_10453076 Ga0207700_104530761 289
129 3300025934 Ga0207686_10327516 Ga0207686_103275162 289
130 3300025936 Ga0207670_10008251 Ga0207670_100082512 289
131 3300025936 Ga0207670_10153007 Ga0207670_101530071 289
132 3300025936 Ga0207670_10289769 Ga0207670_102897692 289
133 3300025949 Ga0207667_10108825 Ga0207667_101088252 289
134 3300025949 Ga0207667_10208867 Ga0207667_102088672 289
135 3300025949 Ga0207667_10210430 Ga0207667_102104303 289
136 3300026088 Ga0207641_10006537 Ga0207641_100065376 289
137 3300026116 Ga0207674_10015794 Ga0207674_100157944 289
138 3300028556 Ga0265337_1000172 Ga0265337_10001727 289
139 3300028556 Ga0265337_1028108 Ga0265337_10281082 289
140 3300028556 Ga0265337_1063744 Ga0265337_10637441 289
141 3300028558 Ga0265326_10004027 Ga0265326_100040276 289
142 3300028558 Ga0265326_10019360 Ga0265326_100193602 289
143 3300028563 Ga0265319_1000007 Ga0265319_100000729 289
144 3300028563 Ga0265319_1008051 Ga0265319_10080514 289
145 3300028563 Ga0265319_1012635 Ga0265319_10126353 289
146 3300028573 Ga0265334_10013261 Ga0265334_100132612 289
147 3300028577 Ga0265318_10032690 Ga0265318_100326903 289
148 3300028653 Ga0265323_10000183 Ga0265323_1000018334 289
149 3300028653 Ga0265323_10006585 Ga0265323_100065854 289
150 3300028653 Ga0265323_10014305 Ga0265323_100143053 289
151 3300028654 Ga0265322_10005233 Ga0265322_100052332 289
152 3300028654 Ga0265322_10039326 Ga0265322_100393262 289
153 3300028666 Ga0265336_10017777 Ga0265336_100177772 289
154 3300028666 Ga0265336_10034251 Ga0265336_100342512 289
155 3300028666 Ga0265336_10043028 Ga0265336_100430282 289
156 3300028800 Ga0265338_10000138 Ga0265338_1000013848 289
157 3300028800 Ga0265338_10000184 Ga0265338_1000018481 289
158 3300028800 Ga0265338_10000263 Ga0265338_100002633 289
159 3300028800 Ga0265338_10001365 Ga0265338_1000136516 289
160 3300028800 Ga0265338_10001550 Ga0265338_100015506 289
161 3300028800 Ga0265338_10001666 Ga0265338_1000166612 289
162 3300028800 Ga0265338_10001733 Ga0265338_1000173324 289
163 3300028800 Ga0265338_10002298 Ga0265338_100022983 289
164 3300028800 Ga0265338_10006727 Ga0265338_1000672710 289
165 3300028800 Ga0265338_10007778 Ga0265338_100077784 289
166 3300028800 Ga0265338_10008583 Ga0265338_100085835 289
167 3300028800 Ga0265338_10008919 Ga0265338_1000891910 289
168 3300028800 Ga0265338_10010037 Ga0265338_100100371 289
169 3300028800 Ga0265338_10010400 Ga0265338_100104009 289
170 3300028800 Ga0265338_10018829 Ga0265338_100188296 289
171 3300028800 Ga0265338_10022151 Ga0265338_100221515 289
172 3300028800 Ga0265338_10028485 Ga0265338_100284856 289
173 3300028800 Ga0265338_10028756 Ga0265338_100287564 289
174 3300028800 Ga0265338_10036965 Ga0265338_100369654 289
175 3300028800 Ga0265338_10059572 Ga0265338_100595721 289
176 3300028800 Ga0265338_10079009 Ga0265338_100790092 289
177 3300028800 Ga0265338_10095767 Ga0265338_100957672 289
178 3300028800 Ga0265338_10192360 Ga0265338_101923602 289
179 3300028800 Ga0265338_10228700 Ga0265338_102287002 289
180 3300028800 Ga0265338_10233101 Ga0265338_102331012 289
181 3300029957 Ga0265324_10000146 Ga0265324_1000014625 289
182 3300029957 Ga0265324_10007170 Ga0265324_100071704 289
183 3300029957 Ga0265324_10011881 Ga0265324_100118812 289
184 3300029957 Ga0265324_10020906 Ga0265324_100209062 289
185 3300031240 Ga0265320_10000296 Ga0265320_100002967 289
186 3300031240 Ga0265320_10005311 Ga0265320_1000531110 289
187 3300031240 Ga0265320_10006964 Ga0265320_100069649 289
188 3300031240 Ga0265320_10011044 Ga0265320_100110443 289
189 3300031240 Ga0265320_10024492 Ga0265320_100244922 289
190 3300031240 Ga0265320_10046225 Ga0265320_100462252 289
191 3300031240 Ga0265320_10152166 Ga0265320_101521661 289
192 3300031241 Ga0265325_10065049 Ga0265325_100650492 289
193 3300031242 Ga0265329_10003874 Ga0265329_100038745 289
194 3300031247 Ga0265340_10000859 Ga0265340_100008599 289
195 3300031249 Ga0265339_10018724 Ga0265339_100187245 289
196 3300031251 Ga0265327_10001384 Ga0265327_100013846 289
197 3300031251 Ga0265327_10075353 Ga0265327_100753532 289
198 3300031344 Ga0265316_10007693 Ga0265316_100076938 289
199 3300031344 Ga0265316_10008162 Ga0265316_1000816210 289
200 3300031344 Ga0265316_10012135 Ga0265316_100121355 289
201 3300031344 Ga0265316_10163654 Ga0265316_101636542 289
202 3300031344 Ga0265316_10170074 Ga0265316_101700742 289
203 3300031344 Ga0265316_10288090 Ga0265316_102880902 289
204 3300031595 Ga0265313_10002127 Ga0265313_1000212715 289
205 3300031595 Ga0265313_10106631 Ga0265313_101066312 289
206 3300031711 Ga0265314_10000147 Ga0265314_1000014774 289
207 3300031711 Ga0265314_10071112 Ga0265314_100711123 289
208 3300031711 Ga0265314_10079016 Ga0265314_100790162 289
209 3300031712 Ga0265342_10076025 Ga0265342_100760252 289
210 3300031727 Ga0316576_10349804 Ga0316576_103498042 289
211 3300034957 Ga0373938_0012549 Ga0373938_0012549_479_1351 289
212 3300035084 Ga0373928_0000452 Ga0373928_0000452_4797_5669 289
213 3300035085 Ga0373929_0011301 Ga0373929_0011301_401_1273 289
214 3300035089 Ga0373944_0000766 Ga0373944_0000766_2416_3288 289
215 3300035091 Ga0373951_0001905 Ga0373951_0001905_2886_3758 289
216 3300035112 Ga0373932_0000001 Ga0373932_0000001_1092072_1092944 289
217 3300035116 Ga0373945_0007215 Ga0373945_0007215_1613_2485 289
218 3300035242 Ga0373962_0000045 Ga0373962_0000045_9767_10639 289
219 3300035398 Ga0316574_0035844 Ga0316574_0035844_2127_2999 289
220 3300035691 Ga0373931_0000002 Ga0373931_0000002_402454_403326 289
221 3300035691 Ga0373931_0087443 Ga0373931_0087443_429_1301 289
222 3300035692 Ga0373935_0007108 Ga0373935_0007108_5303_6208 289
223 3300035692 Ga0373935_0046052 Ga0373935_0046052_653_1525 289
224 3300035695 Ga0373927_0003325 Ga0373927_0003325_910_1815 289
225 3300035695 Ga0373927_0004094 Ga0373927_0004094_77_949 289
226 3300035695 Ga0373927_0012620 Ga0373927_0012620_4040_4912 289
227 3300035725 Ga0373947_0007686 Ga0373947_0007686_4237_5142 289
228 3300037068 Ga0373925_0005746 Ga0373925_0005746_1113_2018 289
229 3300037068 Ga0373925_0009483 Ga0373925_0009483_5679_6551 289
230 3300037068 Ga0373925_0123223 Ga0373925_0123223_20_892 289
231 3300042876 Ga0451577_0002638 Ga0451577_0002638_17204_18076 289
232 3300042876 Ga0451577_0028117 Ga0451577_0028117_2341_3216 289
233 3300044712 Ga0453684_0002234 Ga0453684_0002234_29410_30285 289
234 3300045051 Ga0451576_0071938 Ga0451576_0071938_1638_2510 289
235 3300045051 Ga0451576_0090229 Ga0451576_0090229_1052_1927 289
236 3300045051 Ga0451576_0111352 Ga0451576_0111352_1764_2639 289
237 3300045051 Ga0451576_0256633 Ga0451576_0256633_389_1264 289
238 3300045051 Ga0451576_0310347 Ga0451576_0310347_699_1571 289
239 3300046454 Ga0495592_0047453 Ga0495592_0047453_64_936 289
240 3300046454 Ga0495592_0052854 Ga0495592_0052854_710_1588 289
241 3300046455 Ga0495603_0228084 Ga0495603_0228084_57_950 289
242 3300046476 Ga0495662_0031162 Ga0495662_0031162_421_1299 289
243 3300046477 Ga0495664_0197546 Ga0495664_0197546_101_973 289
244 3300046514 Ga0495618_0006236 Ga0495618_0006236_5149_6027 289
245 3300046514 Ga0495618_0191593 Ga0495618_0191593_62_934 289
246 3300046516 Ga0495628_0078500 Ga0495628_0078500_1224_2102 289
247 3300046517 Ga0495630_0009780 Ga0495630_0009780_1682_2587 289
248 3300046517 Ga0495630_0027619 Ga0495630_0027619_664_1542 289
249 3300046517 Ga0495630_0242851 Ga0495630_0242851_351_1223 289
250 3300046526 Ga0495666_0048980 Ga0495666_0048980_518_1396 289
251 3300046529 Ga0495652_0007198 Ga0495652_0007198_2691_3569 289
252 3300046533 Ga0495640_0023074 Ga0495640_0023074_2576_3454 289
253 3300046533 Ga0495640_0065192 Ga0495640_0065192_51_923 289
254 3300046535 Ga0495586_0000009 Ga0495586_0000009_48891_49763 289
255 3300046535 Ga0495586_0007496 Ga0495586_0007496_4283_5161 289
256 3300046535 Ga0495586_0062133 Ga0495586_0062133_55_927 289
257 3300046543 Ga0495645_0006553 Ga0495645_0006553_5148_6026 289
258 3300046557 Ga0495622_0056436 Ga0495622_0056436_908_1786 289
259 3300046642 Ga0495634_0000900 Ga0495634_0000900_18586_19458 289
260 3300046663 Ga0495635_0010693 Ga0495635_0010693_4186_5058 289
261 3300046690 Ga0495624_0089153 Ga0495624_0089153_25_903 289
262 3300046690 Ga0495624_0101898 Ga0495624_0101898_124_996 289
263 3300047319 Ga0495674_0000043 Ga0495674_0000043_5374_6246 289
264 3300047319 Ga0495674_0058536 Ga0495674_0058536_345_1223 289
265 3300047319 Ga0495674_0097155 Ga0495674_0097155_198_1070 289
266 3300047322 Ga0495680_0143368 Ga0495680_0143368_698_1570 289
267 3300047471 Ga0495684_0202315 Ga0495684_0202315_442_1317 289
268 3300049568 Ga0501031_0000239 Ga0501031_0000239_6380_7255 289
269 3300049569 Ga0501032_0011009 Ga0501032_0011009_4774_5649 289
270 3300049570 Ga0501033_0001502 Ga0501033_0001502_6358_7233 289
271 3300049579 Ga0501043_0051625 Ga0501043_0051625_380_1252 289
272 3300049582 Ga0501048_0189445 Ga0501048_0189445_477_1349 289
273 3300049742 Ga0501080_0048909 Ga0501080_0048909_2285_3157 289
274 3300049822 Ga0501035_0004557 Ga0501035_0004557_6020_6895 289
275 3300049822 Ga0501035_0043628 Ga0501035_0043628_85_957 289
276 3300049823 Ga0501044_0000668 Ga0501044_0000668_34153_35028 289
277 3300049823 Ga0501044_0018648 Ga0501044_0018648_3732_4604 289
278 3300050511 nmdc:mga08y16_342668_c1 nmdc:mga08y16_342668_c1_518_1411 289
279 3300053077 Ga0495601_0028257 Ga0495601_0028257_1781_2656 289
280 3300053098 Ga0500650_0007551 Ga0500650_0007551_1185_2057 289

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00288

GHMP_kinases_N

GHMP kinases N terminal domain

101

179

0.95

PF08544

GHMP_kinases_C

GHMP kinases C terminal

236

317

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v2q-assembly1.cif.gz_A ispe in complex with ligand 0.8888 1 289
2v2q-assembly1.cif.gz_A ispe in complex with ligand 0.8857 1 289
4emd-assembly1.cif.gz_A crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to cmp and so4 0.8839 1 289
1uek-assembly1.cif.gz_A crystal structure of 4-(cytidine 5'-diphospho)-2c-methyl-d-erythritol kinase 0.8828 3 289
4emd-assembly1.cif.gz_A crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to cmp and so4 0.881 1 289
ID Description Score Start End Superfamily
af_Q2G0S8_1_157_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9749 3 157 3.30.230.10
af_Q8S2G0_72_245_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9661 2 158 3.30.230.10
af_Q2G0S8_1_157_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9567 3 157 3.30.230.10
2v2qB01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9448 2 158 3.30.230.10
4dxlA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9397 2 158 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A2E8ST52-F1-model_v4 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (EC 2.7.1.148) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) 0.9855 1 289 GO:0005524
GO:0016114
GO:0019288
GO:0050515
AF-A0A2E8ST52-F1-model_v4 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (EC 2.7.1.148) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) 0.982 1 289 GO:0005524
GO:0016114
GO:0019288
GO:0050515
AF-A0A3D5K0R6-F1-model_v4 4-(Cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase 0.9726 99 289 GO:0005524
GO:0050515
AF-A0A4A1NZX1-F1-model_v4 deleted 0.9722 1 161
AF-A0A015NXR7-F1-model_v4 deleted 0.9721 1 155

Feature Viewer

pLDDT pTM Quality
94.02 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map