F384031

General Info

Members Datasets Scaffolds Average Seq Length
281 196 268 145

Family's Representative Sequence

Representative Sequence 3300002075|JGI24738J21930_10021291|JGI24738J21930_100212913
Length 163
Sequence VSXARAAHXGRGMRGTARYGLVALVAFAAALXAVLVARVWIAPEPRVESEVHALIHEKLRLDPAQEQRIHALEXDFAQRRAXLEAEMRADNARLAQAIAAEHGYGPKVAEAVDRSHHVMGMLQKETLKHIFAMRAVLRPDQAAQFDAAVVNALTRPAAVPPDR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
4 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
5 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
6 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
7 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
8 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
9 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
10 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
11 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
12 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
13 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
14 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
19 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
20 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
106 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
107 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
108 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
109 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
110 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
111 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
112 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
113 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
114 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
115 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
116 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
117 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
120 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
121 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
122 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
123 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
124 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
125 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
126 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
127 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
131 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
132 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
133 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
134 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
141 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
142 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
172 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
173 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
174 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
175 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
176 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
183 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
184 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
185 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
186 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
187 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
188 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
189 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
190 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
191 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
192 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
193 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
194 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
195 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
196 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.37
Metatranscriptomes 0
Isolates 4.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.74
Nodule 0.36
Rhizoplane 7.83
Rhizosphere 72.24
Stem 0
Stem Tuber 0
Unclassified 7.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2231187 2162886007 Bacteria 1921
2 SwRhRL2b_contig_965153 2162886007 Bacteria 804
3 JGI24741J21665_1000129 3300001915 Bacteria 20677
4 JGI24737J22298_10026263 3300001990 Bacteria 1839
5 JGI24735J21928_10008890 3300002067 Bacteria 3240
6 JGI24738J21930_10021291 3300002075 Bacteria 1345
7 JGI24751J29686_10000201 3300002459 Bacteria 26014
8 Ga0055532_1006745 3300003758 Bacteria 1515
9 JGI25405J52794_10044927 3300003911 Bacteria 939
10 Ga0065704_10004641 3300005289 Bacteria 5469
11 Ga0065704_10077680 3300005289 Bacteria 4657
12 Ga0070658_10916845 3300005327 Bacteria 762
13 Ga0070690_100423852 3300005330 Bacteria 982
14 Ga0070666_10001913 3300005335 Bacteria 12662
15 Ga0070666_10102421 3300005335 Unclassified 1974
16 Ga0070660_100120826 3300005339 Bacteria 2090
17 Ga0070660_100939383 3300005339 Archaea 730
18 Ga0070689_100314405 3300005340 Bacteria 1306
19 Ga0070661_100112559 3300005344 Bacteria 2033
20 Ga0070668_100057660 3300005347 Bacteria 3002
21 Ga0070669_100002513 3300005353 Bacteria 13270
22 Ga0070669_100046226 3300005353 Bacteria 3174
23 Ga0070669_100253887 3300005353 Bacteria 1401
24 Ga0070669_100295137 3300005353 Bacteria 1302
25 Ga0070669_100654903 3300005353 Bacteria 884
26 Ga0070671_100000005 3300005355 Bacteria 256547
27 Ga0070671_100181951 3300005355 Bacteria 1779
28 Ga0070667_101170826 3300005367 Bacteria 719
29 Ga0070663_100043895 3300005455 Bacteria 3148
30 Ga0068853_100306838 3300005539 Bacteria 1468
31 Ga0070686_100116593 3300005544 Bacteria 1828
32 Ga0068855_100009420 3300005563 Bacteria 11795
33 Ga0068855_100105538 3300005563 Bacteria 3239
34 Ga0068854_100019877 3300005578 Bacteria 4533
35 Ga0068854_100234067 3300005578 Bacteria 1459
36 Ga0068856_100514503 3300005614 Bacteria 1218
37 Ga0068852_100069917 3300005616 Bacteria 3078
38 Ga0068852_100147665 3300005616 Bacteria 2183
39 Ga0068859_100121478 3300005617 Bacteria 2679
40 Ga0068859_100259777 3300005617 Bacteria 1828
41 Ga0068859_100757792 3300005617 Bacteria 1059
42 Ga0068864_100248210 3300005618 Bacteria 1651
43 Ga0068863_100000058 3300005841 Bacteria 123096
44 Ga0068863_100000073 3300005841 Bacteria 110576
45 Ga0068863_100069578 3300005841 Bacteria 3327
46 Ga0068858_100284137 3300005842 Bacteria 1576
47 Ga0068860_100002024 3300005843 Bacteria 21395
48 Ga0068862_100009665 3300005844 Bacteria 7971
49 Ga0068862_100060987 3300005844 Bacteria 3241
50 Ga0068862_100224820 3300005844 Bacteria 1701
51 Ga0081455_10000280 3300005937 Bacteria 67482
52 Ga0075365_10035210 3300006038 Bacteria 3238
53 Ga0075368_10014844 3300006042 Bacteria 2882
54 Ga0075363_100005446 3300006048 Bacteria 5662
55 Ga0075364_10000022 3300006051 Bacteria 53466
56 Ga0075367_10002696 3300006178 Bacteria 8187
57 Ga0075369_10000245 3300006186 Bacteria 16141
58 Ga0075366_10335919 3300006195 Unclassified 926
59 Ga0075370_10055585 3300006353 Bacteria 2249
60 Ga0075370_10059401 3300006353 Bacteria 2176
61 Ga0097620_100121474 3300006931 Bacteria 2679
62 Ga0097620_100259767 3300006931 Bacteria 1828
63 Ga0097620_100757850 3300006931 Bacteria 1059
64 Ga0079104_1033237 3300006946 Bacteria 1264
65 Ga0105251_10000296 3300009011 Bacteria 49888
66 Ga0105240_10035093 3300009093 Bacteria 6467
67 Ga0105240_10084656 3300009093 Bacteria 3887
68 Ga0105247_10012618 3300009101 Bacteria 5073
69 Ga0105241_10012841 3300009174 Bacteria 6148
70 Ga0105241_10098537 3300009174 Bacteria 2319
71 Ga0105248_10028117 3300009177 Bacteria 6263
72 Ga0105248_10122307 3300009177 Bacteria 2936
73 Ga0105248_10747458 3300009177 Unclassified 1104
74 Ga0105237_10169809 3300009545 Bacteria 2181
75 Ga0105237_10368980 3300009545 Bacteria 1440
76 Ga0105238_10005648 3300009551 Bacteria 12366
77 Ga0105238_10092182 3300009551 Bacteria 3017
78 Ga0105249_10000045 3300009553 Bacteria 182927
79 Ga0105249_10149590 3300009553 Bacteria 2247
80 Ga0105249_10413141 3300009553 Bacteria 1382
81 Ga0105148_100037 3300009978 Bacteria 19472
82 Ga0105239_10169070 3300010375 Bacteria 2444
83 Ga0157369_11652833 3300013105 Bacteria 651
84 Ga0163162_10012470 3300013306 Bacteria 8306
85 Ga0163162_10381072 3300013306 Bacteria 1543
86 Ga0163163_10892265 3300014325 Bacteria 952
87 Ga0163163_10909119 3300014325 Bacteria 944
88 Ga0157380_10099180 3300014326 Bacteria 2422
89 Ga0157380_10299278 3300014326 Unclassified 1481
90 Ga0163161_10068296 3300017792 Bacteria 2597
91 Ga0209147_100193 3300025229 Bacteria 69946
92 Ga0209257_1020267 3300025304 Bacteria 2465
93 Ga0207697_10047528 3300025315 Bacteria 1769
94 Ga0207697_10057347 3300025315 Bacteria 1617
95 Ga0207713_1005804 3300025735 Bacteria 7640
96 Ga0207713_1025569 3300025735 Bacteria 2722
97 Ga0207710_10006339 3300025900 Bacteria 5058
98 Ga0207680_10072407 3300025903 Bacteria 2139
99 Ga0207705_10897984 3300025909 Bacteria 686
100 Ga0207654_10147929 3300025911 Bacteria 1505
101 Ga0207695_10048345 3300025913 Bacteria 4493
102 Ga0207681_10000096 3300025923 Bacteria 74995
103 Ga0207681_10256529 3300025923 Bacteria 1367
104 Ga0207694_10204251 3300025924 Bacteria 1608
105 Ga0207650_10823253 3300025925 Bacteria 787
106 Ga0207644_10000008 3300025931 Bacteria 354219
107 Ga0207711_10078961 3300025941 Bacteria 2872
108 Ga0207711_11376414 3300025941 Bacteria 648
109 Ga0207667_10002930 3300025949 Bacteria 21192
110 Ga0207667_10011422 3300025949 Bacteria 10325
111 Ga0207667_10108114 3300025949 Bacteria 2870
112 Ga0207667_10440224 3300025949 Bacteria 1325
113 Ga0207712_10000078 3300025961 Bacteria 117785
114 Ga0207668_10114335 3300025972 Bacteria 2031
115 Ga0207640_10167360 3300025981 Bacteria 1634
116 Ga0207703_10378379 3300026035 Bacteria 1309
117 Ga0207639_10003713 3300026041 Bacteria 10272
118 Ga0207641_10000018 3300026088 Bacteria 298209
119 Ga0207641_10001231 3300026088 Bacteria 25648
120 Ga0207641_10001337 3300026088 Bacteria 24395
121 Ga0207641_10047704 3300026088 Bacteria 3613
122 Ga0207676_10273201 3300026095 Unclassified 1531
123 Ga0207674_10063880 3300026116 Bacteria 3714
124 Ga0207698_10097380 3300026142 Bacteria 2428
125 Ga0207698_10727950 3300026142 Bacteria 989
126 Ga0209983_1081157 3300027665 Bacteria 727
127 Ga0209813_10000023 3300027866 Bacteria 72775
128 Ga0209813_10000185 3300027866 Bacteria 19852
129 Ga0268265_10000097 3300028380 Bacteria 110755
130 Ga0268265_10067011 3300028380 Bacteria 2777
131 Ga0268265_10218445 3300028380 Bacteria 1666
132 Ga0268264_10000440 3300028381 Bacteria 57263
133 Ga0307408_100243761 3300031548 Bacteria 1478
134 Ga0307405_10014497 3300031731 Bacteria 4239
135 Ga0307405_10035269 3300031731 Bacteria 2986
136 Ga0307410_10135028 3300031852 Bacteria 1817
137 Ga0307412_11680349 3300031911 Bacteria 581
138 Ga0307409_100618977 3300031995 Bacteria 1072
139 Ga0307414_10005594 3300032004 Bacteria 6933
140 Ga0439439_0017791 3300041406 Bacteria 1751
141 Ga0439461_0003341 3300041410 Bacteria 2632
142 Ga0439466_0030318 3300041411 Unclassified 1856
143 Ga0439465_0005582 3300041413 Bacteria 4009
144 Ga0439431_0164294 3300041997 Unclassified 635
145 Ga0439442_055620 3300042002 Bacteria 837
146 Ga0439445_0021134 3300042004 Unclassified 1633
147 Ga0439432_071969 3300042006 Unclassified 1053
148 Ga0439462_0000203 3300042015 Bacteria 10309
149 Ga0450910_015387 3300042147 Unclassified 1126
150 Ga0450909_036627 3300042185 Bacteria 750
151 Ga0439459_0095422 3300042438 Bacteria 721
152 Ga0450918_025723 3300042531 Bacteria 1032
153 Ga0451576_0514687 3300045051 Bacteria 1257
154 Ga0451576_1640559 3300045051 Unclassified 667
155 Ga0495617_004500 3300046452 Bacteria 5071
156 Ga0495627_000127 3300046453 Bacteria 92757
157 Ga0495627_001785 3300046453 Bacteria 11512
158 Ga0495627_023804 3300046453 Bacteria 2002
159 Ga0495638_0028118 3300046460 Bacteria 3633
160 Ga0495638_0478506 3300046460 Bacteria 631
161 Ga0495584_0042748 3300046491 Bacteria 2287
162 Ga0495583_0000030 3300046506 Bacteria 254970
163 Ga0495610_0003896 3300046512 Bacteria 11324
164 Ga0495631_0411408 3300046518 Bacteria 576
165 Ga0495632_0000038 3300046519 Bacteria 155743
166 Ga0495632_0061414 3300046519 Bacteria 1824
167 Ga0495637_0000061 3300046520 Bacteria 95460
168 Ga0495637_0004422 3300046520 Bacteria 7293
169 Ga0495643_0000088 3300046522 Bacteria 155458
170 Ga0495648_0005047 3300046524 Bacteria 11085
171 Ga0495648_0052482 3300046524 Bacteria 2476
172 Ga0495663_0000013 3300046525 Bacteria 155493
173 Ga0495597_0191424 3300046542 Unclassified 823
174 Ga0495633_0000166 3300046558 Bacteria 86835
175 Ga0495633_0000212 3300046558 Bacteria 73041
176 Ga0495633_0010649 3300046558 Bacteria 5010
177 Ga0495633_0051192 3300046558 Bacteria 1946
178 Ga0495668_0120792 3300046616 Unclassified 1433
179 Ga0495611_0055701 3300046648 Bacteria 1789
180 Ga0495611_0284829 3300046648 Bacteria 763
181 Ga0495625_0066094 3300046660 Bacteria 2548
182 Ga0495625_0109614 3300046660 Bacteria 1888
183 Ga0495661_0015247 3300046665 Bacteria 5131
184 Ga0495661_0022825 3300046665 Bacteria 4068
185 Ga0495670_0140333 3300046691 Bacteria 1263
186 Ga0495670_0304243 3300046691 Bacteria 855
187 Ga0495671_0000048 3300046692 Bacteria 155712
188 Ga0495672_0340372 3300047320 Bacteria 699
189 Ga0495683_0104437 3300047323 Unclassified 1359
190 Ga0495673_0056051 3300047469 Bacteria 1707
191 Ga0495681_0000022 3300047470 Bacteria 165281
192 Ga0495681_0000451 3300047470 Bacteria 31452
193 Ga0495686_0001389 3300047472 Bacteria 26874
194 Ga0495686_0066428 3300047472 Bacteria 2228
195 Ga0495686_0194038 3300047472 Bacteria 1169
196 Ga0495686_0411173 3300047472 Bacteria 724
197 Ga0496100_0037001 3300048903 Bacteria 3082
198 Ga0496101_0075005 3300048904 Bacteria 2489
199 Ga0496102_0000284 3300048905 Bacteria 64681
200 Ga0496102_0145163 3300048905 Bacteria 2227
201 Ga0496102_0181146 3300048905 Bacteria 1985
202 Ga0496103_0000176 3300048906 Bacteria 65606
203 Ga0496103_0296017 3300048906 Bacteria 1041
204 Ga0496103_0819153 3300048906 Bacteria 586
205 Ga0496104_0006895 3300048907 Bacteria 10018
206 Ga0496104_0611848 3300048907 Bacteria 999
207 Ga0496104_0798962 3300048907 Bacteria 850
208 Ga0496105_0010248 3300048908 Bacteria 7368
209 Ga0496105_0114306 3300048908 Bacteria 2226
210 Ga0496105_0495794 3300048908 Bacteria 959
211 Ga0496106_0000498 3300048909 Bacteria 27838
212 Ga0496107_0000243 3300048910 Bacteria 28621
213 Ga0496108_0001246 3300048911 Bacteria 19937
214 Ga0496108_0083888 3300048911 Bacteria 2703
215 Ga0496108_0110238 3300048911 Bacteria 2353
216 Ga0496110_0111478 3300048913 Bacteria 2459
217 Ga0496112_0045712 3300048915 Bacteria 4292
218 Ga0496113_0004077 3300048916 Bacteria 8899
219 Ga0496116_0002314 3300048919 Bacteria 20195
220 Ga0496117_0000501 3300048920 Bacteria 64696
221 Ga0496117_0018797 3300048920 Bacteria 5707
222 Ga0496117_0171093 3300048920 Bacteria 1261
223 Ga0496118_0000503 3300048921 Bacteria 64696
224 Ga0496118_0041517 3300048921 Bacteria 3641
225 Ga0496119_0264768 3300048922 Bacteria 861
226 Ga0496120_0072972 3300048923 Bacteria 1879
227 Ga0496121_0000192 3300048924 Bacteria 136529
228 Ga0496121_0003141 3300048924 Bacteria 23839
229 Ga0496122_0002550 3300048925 Bacteria 25608
230 Ga0496123_0006776 3300048926 Bacteria 11011
231 Ga0496124_0000534 3300048927 Bacteria 64668
232 Ga0496124_0176620 3300048927 Bacteria 1648
233 Ga0496124_0352956 3300048927 Bacteria 1040
234 Ga0496125_0036666 3300048928 Bacteria 4276
235 Ga0496126_0010223 3300048929 Bacteria 9866
236 Ga0496126_0096590 3300048929 Bacteria 2590
237 Ga0495682_0087963 3300049460 Bacteria 1116
238 Ga0501037_0247331 3300049573 Bacteria 1249
239 Ga0501039_0614490 3300049575 Bacteria 852
240 Ga0501047_0343398 3300049581 Unclassified 1330
241 Ga0501211_000998 3300049658 Bacteria 2974
242 Ga0501223_000022 3300049663 Bacteria 65110
243 Ga0501235_002718 3300049669 Bacteria 3802
244 Ga0501225_0000151 3300049705 Bacteria 21256
245 Ga0501225_0000872 3300049705 Bacteria 9370
246 Ga0501225_0079880 3300049705 Bacteria 938
247 Ga0501241_008647 3300049758 Bacteria 1857
248 Ga0501283_000125 3300049779 Bacteria 9435
249 Ga0501044_0025894 3300049823 Bacteria 6218
250 nmdc:mga00v17_91_c1 3300050491 Bacteria 53223
251 nmdc:mga0yw44_50073_c1 3300050492 Bacteria 2524
252 nmdc:mga0k408_219141_c1 3300050493 Unclassified 1136
253 nmdc:mga06z11_192_c1 3300050494 Bacteria 24606
254 nmdc:mga04h51_11036_c1 3300050495 Bacteria 2498
255 nmdc:mga0sz30_181_c1 3300050516 Bacteria 23478
256 Ga0500643_001379 3300053087 Bacteria 14069
257 Ga0500555_000924 3300053103 Bacteria 10289
258 Ga0500556_0000057 3300053104 Bacteria 115093
259 Ga0500556_0264288 3300053104 Bacteria 676
260 Ga0500572_058741 3300053111 Bacteria 1165
261 Ga0500618_034654 3300053125 Bacteria 1174
262 Ga0500642_0000014 3300053130 Bacteria 182110
263 Ga0500559_0000007 3300053136 Bacteria 226236
264 Ga0500564_093960 3300053138 Bacteria 1332
265 Ga0500590_005119 3300053148 Bacteria 6281
266 Ga0500622_0147613 3300053156 Bacteria 1115
267 Ga0500624_000031 3300053157 Bacteria 104703
268 Ga0500552_010538 3300053733 Bacteria 1142

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003758 Ga0055532_1006745 Ga0055532_10067452 121
2 3300005339 Ga0070660_100939383 Ga0070660_1009393831 121
3 3300009093 Ga0105240_10084656 Ga0105240_100846564 121
4 3300009551 Ga0105238_10005648 Ga0105238_100056484 121
5 3300025229 Ga0209147_100193 Ga0209147_10019354 121
6 3300025913 Ga0207695_10048345 Ga0207695_100483456 121
7 3300025949 Ga0207667_10002930 Ga0207667_1000293011 121
8 3300048929 Ga0496126_0096590 Ga0496126_0096590_1218_1619 123
9 3300048905 Ga0496102_0145163 Ga0496102_0145163_668_1108 126
10 3300048906 Ga0496103_0296017 Ga0496103_0296017_528_968 126
11 3300048906 Ga0496103_0819153 Ga0496103_0819153_13_426 127
12 3300006195 Ga0075366_10335919 Ga0075366_103359192 128
13 3300050493 nmdc:mga0k408_219141_c1 nmdc:mga0k408_219141_c1_437_877 128
14 3300006946 Ga0079104_1033237 Ga0079104_10332372 129
15 iso_pu_bacteria 2512564014 2512644128 130
16 3300003911 JGI25405J52794_10044927 JGI25405J52794_100449272 131
17 3300005330 Ga0070690_100423852 Ga0070690_1004238522 131
18 3300005335 Ga0070666_10001913 Ga0070666_100019135 131
19 3300005340 Ga0070689_100314405 Ga0070689_1003144052 131
20 3300005353 Ga0070669_100002513 Ga0070669_10000251311 131
21 3300005355 Ga0070671_100000005 Ga0070671_100000005147 131
22 3300005544 Ga0070686_100116593 Ga0070686_1001165932 131
23 3300005617 Ga0068859_100259777 Ga0068859_1002597773 131
24 3300005618 Ga0068864_100248210 Ga0068864_1002482102 131
25 3300005841 Ga0068863_100069578 Ga0068863_1000695782 131
26 3300005842 Ga0068858_100284137 Ga0068858_1002841372 131
27 3300005844 Ga0068862_100224820 Ga0068862_1002248203 131
28 3300005937 Ga0081455_10000280 Ga0081455_1000028022 131
29 3300006931 Ga0097620_100259767 Ga0097620_1002597673 131
30 3300009177 Ga0105248_10747458 Ga0105248_107474582 131
31 3300013306 Ga0163162_10012470 Ga0163162_100124708 131
32 3300014325 Ga0163163_10892265 Ga0163163_108922652 131
33 3300025315 Ga0207697_10047528 Ga0207697_100475283 131
34 3300025923 Ga0207681_10000096 Ga0207681_1000009657 131
35 3300025925 Ga0207650_10823253 Ga0207650_108232532 131
36 3300025931 Ga0207644_10000008 Ga0207644_10000008178 131
37 3300026035 Ga0207703_10378379 Ga0207703_103783792 131
38 3300026088 Ga0207641_10047704 Ga0207641_100477045 131
39 3300028380 Ga0268265_10218445 Ga0268265_102184452 131
40 3300048903 Ga0496100_0037001 Ga0496100_0037001_314_751 131
41 3300048904 Ga0496101_0075005 Ga0496101_0075005_531_968 131
42 3300048905 Ga0496102_0181146 Ga0496102_0181146_1272_1709 131
43 3300048907 Ga0496104_0611848 Ga0496104_0611848_393_830 131
44 3300048908 Ga0496105_0114306 Ga0496105_0114306_1091_1528 131
45 3300048909 Ga0496106_0000498 Ga0496106_0000498_8777_9214 131
46 3300048910 Ga0496107_0000243 Ga0496107_0000243_21708_22145 131
47 3300048911 Ga0496108_0083888 Ga0496108_0083888_1256_1693 131
48 3300048911 Ga0496108_0110238 Ga0496108_0110238_168_605 131
49 3300048915 Ga0496112_0045712 Ga0496112_0045712_2697_3134 131
50 3300048916 Ga0496113_0004077 Ga0496113_0004077_5877_6314 131
51 iso_pu_bacteria 2919709256 2919709658 131
52 2162886007 SwRhRL2b_contig_965153 SwRhRL2b_0310.00003990 132
53 3300005289 Ga0065704_10004641 Ga0065704_100046417 132
54 3300005335 Ga0070666_10102421 Ga0070666_101024212 132
55 3300005353 Ga0070669_100046226 Ga0070669_1000462263 132
56 3300005353 Ga0070669_100253887 Ga0070669_1002538872 132
57 3300005353 Ga0070669_100295137 Ga0070669_1002951372 132
58 3300005355 Ga0070671_100181951 Ga0070671_1001819512 132
59 3300005367 Ga0070667_101170826 Ga0070667_1011708261 132
60 3300005578 Ga0068854_100019877 Ga0068854_1000198774 132
61 3300005614 Ga0068856_100514503 Ga0068856_1005145031 132
62 3300005617 Ga0068859_100121478 Ga0068859_1001214784 132
63 3300005617 Ga0068859_100757792 Ga0068859_1007577922 132
64 3300005841 Ga0068863_100000058 Ga0068863_100000058109 132
65 3300005841 Ga0068863_100000073 Ga0068863_10000007367 132
66 3300005843 Ga0068860_100002024 Ga0068860_10000202415 132
67 3300005844 Ga0068862_100009665 Ga0068862_1000096654 132
68 3300005844 Ga0068862_100060987 Ga0068862_1000609873 132
69 3300006038 Ga0075365_10035210 Ga0075365_100352105 132
70 3300006042 Ga0075368_10014844 Ga0075368_100148442 132
71 3300006048 Ga0075363_100005446 Ga0075363_1000054463 132
72 3300006051 Ga0075364_10000022 Ga0075364_1000002244 132
73 3300006178 Ga0075367_10002696 Ga0075367_100026966 132
74 3300006186 Ga0075369_10000245 Ga0075369_100002457 132
75 3300006353 Ga0075370_10055585 Ga0075370_100555854 132
76 3300006353 Ga0075370_10059401 Ga0075370_100594012 132
77 3300006931 Ga0097620_100121474 Ga0097620_1001214743 132
78 3300006931 Ga0097620_100757850 Ga0097620_1007578502 132
79 3300009011 Ga0105251_10000296 Ga0105251_100002964 132
80 3300009101 Ga0105247_10012618 Ga0105247_100126185 132
81 3300009174 Ga0105241_10098537 Ga0105241_100985372 132
82 3300009177 Ga0105248_10028117 Ga0105248_100281174 132
83 3300009177 Ga0105248_10122307 Ga0105248_101223073 132
84 3300009545 Ga0105237_10169809 Ga0105237_101698094 132
85 3300009545 Ga0105237_10368980 Ga0105237_103689802 132
86 3300009551 Ga0105238_10092182 Ga0105238_100921823 132
87 3300009553 Ga0105249_10000045 Ga0105249_1000004583 132
88 3300009553 Ga0105249_10413141 Ga0105249_104131413 132
89 3300009978 Ga0105148_100037 Ga0105148_10003715 132
90 3300013105 Ga0157369_11652833 Ga0157369_116528332 132
91 3300013306 Ga0163162_10381072 Ga0163162_103810723 132
92 3300014325 Ga0163163_10909119 Ga0163163_109091192 132
93 3300014326 Ga0157380_10099180 Ga0157380_100991803 132
94 3300014326 Ga0157380_10299278 Ga0157380_102992782 132
95 3300025304 Ga0209257_1020267 Ga0209257_10202675 132
96 3300025315 Ga0207697_10057347 Ga0207697_100573473 132
97 3300025735 Ga0207713_1005804 Ga0207713_10058044 132
98 3300025900 Ga0207710_10006339 Ga0207710_100063394 132
99 3300025903 Ga0207680_10072407 Ga0207680_100724073 132
100 3300025911 Ga0207654_10147929 Ga0207654_101479294 132
101 3300025923 Ga0207681_10256529 Ga0207681_102565292 132
102 3300025924 Ga0207694_10204251 Ga0207694_102042514 132
103 3300025941 Ga0207711_10078961 Ga0207711_100789612 132
104 3300025941 Ga0207711_11376414 Ga0207711_113764142 132
105 3300025961 Ga0207712_10000078 Ga0207712_1000007819 132
106 3300025981 Ga0207640_10167360 Ga0207640_101673604 132
107 3300026088 Ga0207641_10000018 Ga0207641_1000001849 132
108 3300026088 Ga0207641_10001231 Ga0207641_1000123122 132
109 3300026088 Ga0207641_10001337 Ga0207641_100013374 132
110 3300026095 Ga0207676_10273201 Ga0207676_102732012 132
111 3300026116 Ga0207674_10063880 Ga0207674_100638806 132
112 3300027665 Ga0209983_1081157 Ga0209983_10811572 132
113 3300027866 Ga0209813_10000023 Ga0209813_1000002353 132
114 3300027866 Ga0209813_10000185 Ga0209813_1000018511 132
115 3300028380 Ga0268265_10000097 Ga0268265_1000009765 132
116 3300028380 Ga0268265_10067011 Ga0268265_100670113 132
117 3300028381 Ga0268264_10000440 Ga0268264_1000044056 132
118 3300031731 Ga0307405_10035269 Ga0307405_100352694 132
119 3300031911 Ga0307412_11680349 Ga0307412_116803492 132
120 3300031995 Ga0307409_100618977 Ga0307409_1006189772 132
121 3300041406 Ga0439439_0017791 Ga0439439_0017791_210_647 132
122 3300041410 Ga0439461_0003341 Ga0439461_0003341_232_669 132
123 3300041411 Ga0439466_0030318 Ga0439466_0030318_501_938 132
124 3300041413 Ga0439465_0005582 Ga0439465_0005582_1978_2415 132
125 3300041997 Ga0439431_0164294 Ga0439431_0164294_117_554 132
126 3300042002 Ga0439442_055620 Ga0439442_055620_378_815 132
127 3300042004 Ga0439445_0021134 Ga0439445_0021134_491_928 132
128 3300042006 Ga0439432_071969 Ga0439432_071969_558_995 132
129 3300042015 Ga0439462_0000203 Ga0439462_0000203_3449_3886 132
130 3300042147 Ga0450910_015387 Ga0450910_015387_561_998 132
131 3300042185 Ga0450909_036627 Ga0450909_036627_54_491 132
132 3300042438 Ga0439459_0095422 Ga0439459_0095422_92_529 132
133 3300042531 Ga0450918_025723 Ga0450918_025723_570_1007 132
134 3300045051 Ga0451576_1640559 Ga0451576_1640559_187_627 132
135 3300046452 Ga0495617_004500 Ga0495617_004500_1958_2395 132
136 3300046453 Ga0495627_000127 Ga0495627_000127_31995_32432 132
137 3300046453 Ga0495627_001785 Ga0495627_001785_4109_4546 132
138 3300046453 Ga0495627_023804 Ga0495627_023804_1078_1518 132
139 3300046460 Ga0495638_0028118 Ga0495638_0028118_2513_2953 132
140 3300046460 Ga0495638_0478506 Ga0495638_0478506_56_490 132
141 3300046506 Ga0495583_0000030 Ga0495583_0000030_83225_83665 132
142 3300046512 Ga0495610_0003896 Ga0495610_0003896_6058_6495 132
143 3300046518 Ga0495631_0411408 Ga0495631_0411408_91_528 132
144 3300046519 Ga0495632_0061414 Ga0495632_0061414_750_1187 132
145 3300046520 Ga0495637_0004422 Ga0495637_0004422_1001_1438 132
146 3300046524 Ga0495648_0005047 Ga0495648_0005047_8959_9396 132
147 3300046542 Ga0495597_0191424 Ga0495597_0191424_343_786 132
148 3300046558 Ga0495633_0010649 Ga0495633_0010649_4217_4657 132
149 3300046558 Ga0495633_0051192 Ga0495633_0051192_319_756 132
150 3300046616 Ga0495668_0120792 Ga0495668_0120792_573_1016 132
151 3300046648 Ga0495611_0055701 Ga0495611_0055701_580_1020 132
152 3300046648 Ga0495611_0284829 Ga0495611_0284829_298_735 132
153 3300046660 Ga0495625_0109614 Ga0495625_0109614_577_1020 132
154 3300046665 Ga0495661_0015247 Ga0495661_0015247_4043_4483 132
155 3300046665 Ga0495661_0022825 Ga0495661_0022825_825_1262 132
156 3300046691 Ga0495670_0140333 Ga0495670_0140333_166_606 132
157 3300046691 Ga0495670_0304243 Ga0495670_0304243_293_733 132
158 3300047320 Ga0495672_0340372 Ga0495672_0340372_97_534 132
159 3300047323 Ga0495683_0104437 Ga0495683_0104437_67_504 132
160 3300047469 Ga0495673_0056051 Ga0495673_0056051_843_1280 132
161 3300047470 Ga0495681_0000022 Ga0495681_0000022_45567_46004 132
162 3300047472 Ga0495686_0001389 Ga0495686_0001389_16564_17001 132
163 3300047472 Ga0495686_0066428 Ga0495686_0066428_850_1290 132
164 3300048905 Ga0496102_0000284 Ga0496102_0000284_43800_44234 132
165 3300048906 Ga0496103_0000176 Ga0496103_0000176_20442_20876 132
166 3300048907 Ga0496104_0006895 Ga0496104_0006895_1570_2013 132
167 3300048907 Ga0496104_0798962 Ga0496104_0798962_16_450 132
168 3300048908 Ga0496105_0010248 Ga0496105_0010248_2083_2526 132
169 3300048908 Ga0496105_0495794 Ga0496105_0495794_362_802 132
170 3300048919 Ga0496116_0002314 Ga0496116_0002314_17412_17846 132
171 3300048920 Ga0496117_0000501 Ga0496117_0000501_20463_20897 132
172 3300048920 Ga0496117_0018797 Ga0496117_0018797_4827_5270 132
173 3300048921 Ga0496118_0000503 Ga0496118_0000503_43800_44234 132
174 3300048921 Ga0496118_0041517 Ga0496118_0041517_1706_2149 132
175 3300048922 Ga0496119_0264768 Ga0496119_0264768_346_789 132
176 3300048923 Ga0496120_0072972 Ga0496120_0072972_1013_1447 132
177 3300048924 Ga0496121_0003141 Ga0496121_0003141_12305_12748 132
178 3300048927 Ga0496124_0000534 Ga0496124_0000534_43800_44234 132
179 3300048927 Ga0496124_0176620 Ga0496124_0176620_477_917 132
180 3300048927 Ga0496124_0352956 Ga0496124_0352956_491_931 132
181 3300049460 Ga0495682_0087963 Ga0495682_0087963_652_1092 132
182 3300049573 Ga0501037_0247331 Ga0501037_0247331_255_698 132
183 3300049575 Ga0501039_0614490 Ga0501039_0614490_372_812 132
184 3300049581 Ga0501047_0343398 Ga0501047_0343398_309_752 132
185 3300049658 Ga0501211_000998 Ga0501211_000998_16_459 132
186 3300049663 Ga0501223_000022 Ga0501223_000022_29270_29710 132
187 3300049669 Ga0501235_002718 Ga0501235_002718_1174_1617 132
188 3300049705 Ga0501225_0000151 Ga0501225_0000151_103_543 132
189 3300049705 Ga0501225_0000872 Ga0501225_0000872_8154_8594 132
190 3300049705 Ga0501225_0079880 Ga0501225_0079880_447_890 132
191 3300049758 Ga0501241_008647 Ga0501241_008647_151_594 132
192 3300049779 Ga0501283_000125 Ga0501283_000125_3223_3663 132
193 3300049823 Ga0501044_0025894 Ga0501044_0025894_1006_1446 132
194 3300050491 nmdc:mga00v17_91_c1 nmdc:mga00v17_91_c1_7340_7780 132
195 3300050492 nmdc:mga0yw44_50073_c1 nmdc:mga0yw44_50073_c1_2004_2444 132
196 3300050494 nmdc:mga06z11_192_c1 nmdc:mga06z11_192_c1_1392_1826 132
197 3300050495 nmdc:mga04h51_11036_c1 nmdc:mga04h51_11036_c1_400_834 132
198 3300050516 nmdc:mga0sz30_181_c1 nmdc:mga0sz30_181_c1_7200_7640 132
199 3300053087 Ga0500643_001379 Ga0500643_001379_1824_2264 132
200 3300053103 Ga0500555_000924 Ga0500555_000924_550_990 132
201 3300053104 Ga0500556_0000057 Ga0500556_0000057_92672_93115 132
202 3300053104 Ga0500556_0264288 Ga0500556_0264288_122_562 132
203 3300053111 Ga0500572_058741 Ga0500572_058741_380_817 132
204 3300053125 Ga0500618_034654 Ga0500618_034654_709_1149 132
205 3300053130 Ga0500642_0000014 Ga0500642_0000014_66731_67174 132
206 3300053136 Ga0500559_0000007 Ga0500559_0000007_210246_210683 132
207 3300053138 Ga0500564_093960 Ga0500564_093960_805_1245 132
208 3300053148 Ga0500590_005119 Ga0500590_005119_2797_3237 132
209 3300053156 Ga0500622_0147613 Ga0500622_0147613_621_1058 132
210 3300053157 Ga0500624_000031 Ga0500624_000031_81113_81553 132
211 3300053733 Ga0500552_010538 Ga0500552_010538_319_759 132
212 iso_pu_bacteria 2510917021 2511129365 132
213 iso_pu_bacteria 2643221605 2644041003 132
214 iso_pu_bacteria 2739367664 2739652448 132
215 iso_pu_bacteria 2739367865 2740030921 132
216 iso_pu_bacteria 2775507255 2778126307 132
217 iso_pu_bacteria 2808606401 2809064145 132
218 iso_pu_bacteria 2808606404 2809080113 132
219 iso_pu_bacteria 2808606405 2809084534 132
220 iso_pu_bacteria 2880518877 2880523075 132
221 iso_pu_bacteria 8057101203 8057101375 132
222 3300002459 JGI24751J29686_10000201 JGI24751J29686_1000020123 133
223 3300005327 Ga0070658_10916845 Ga0070658_109168452 133
224 3300005353 Ga0070669_100654903 Ga0070669_1006549031 133
225 3300005563 Ga0068855_100009420 Ga0068855_1000094206 133
226 3300005563 Ga0068855_100105538 Ga0068855_1001055386 133
227 3300005616 Ga0068852_100069917 Ga0068852_1000699173 133
228 3300005616 Ga0068852_100147665 Ga0068852_1001476653 133
229 3300025909 Ga0207705_10897984 Ga0207705_108979841 133
230 3300025949 Ga0207667_10011422 Ga0207667_100114224 133
231 3300025949 Ga0207667_10108114 Ga0207667_101081144 133
232 3300026142 Ga0207698_10097380 Ga0207698_100973804 133
233 3300026142 Ga0207698_10727950 Ga0207698_107279502 133
234 3300032004 Ga0307414_10005594 Ga0307414_100055945 133
235 3300045051 Ga0451576_0514687 Ga0451576_0514687_216_659 133
236 iso_pu_bacteria 2919138771 2919140026 133
237 3300046524 Ga0495648_0052482 Ga0495648_0052482_411_857 134
238 3300046491 Ga0495584_0042748 Ga0495584_0042748_1321_1767 135
239 3300046519 Ga0495632_0000038 Ga0495632_0000038_110872_111318 135
240 3300046520 Ga0495637_0000061 Ga0495637_0000061_12294_12740 135
241 3300046522 Ga0495643_0000088 Ga0495643_0000088_44000_44446 135
242 3300046525 Ga0495663_0000013 Ga0495663_0000013_44319_44765 135
243 3300046558 Ga0495633_0000166 Ga0495633_0000166_13058_13504 135
244 3300046558 Ga0495633_0000212 Ga0495633_0000212_44446_44892 135
245 3300046660 Ga0495625_0066094 Ga0495625_0066094_1172_1618 135
246 3300046692 Ga0495671_0000048 Ga0495671_0000048_44127_44573 135
247 3300047470 Ga0495681_0000451 Ga0495681_0000451_12924_13370 135
248 3300047472 Ga0495686_0194038 Ga0495686_0194038_15_461 135
249 3300047472 Ga0495686_0411173 Ga0495686_0411173_193_639 135
250 2162886007 SwRhRL2b_contig_2231187 SwRhRL2b_0181.00004960 137
251 3300001915 JGI24741J21665_1000129 JGI24741J21665_100012914 137
252 3300001990 JGI24737J22298_10026263 JGI24737J22298_100262632 137
253 3300002067 JGI24735J21928_10008890 JGI24735J21928_100088904 137
254 3300002075 JGI24738J21930_10021291 JGI24738J21930_100212913 137
255 3300005289 Ga0065704_10077680 Ga0065704_100776803 137
256 3300005339 Ga0070660_100120826 Ga0070660_1001208263 137
257 3300005344 Ga0070661_100112559 Ga0070661_1001125593 137
258 3300005347 Ga0070668_100057660 Ga0070668_1000576603 137
259 3300005455 Ga0070663_100043895 Ga0070663_1000438952 137
260 3300005539 Ga0068853_100306838 Ga0068853_1003068381 137
261 3300005578 Ga0068854_100234067 Ga0068854_1002340672 137
262 3300009093 Ga0105240_10035093 Ga0105240_100350933 137
263 3300009174 Ga0105241_10012841 Ga0105241_100128412 137
264 3300009553 Ga0105249_10149590 Ga0105249_101495904 137
265 3300010375 Ga0105239_10169070 Ga0105239_101690703 137
266 3300017792 Ga0163161_10068296 Ga0163161_100682962 137
267 3300025735 Ga0207713_1025569 Ga0207713_10255692 137
268 3300025949 Ga0207667_10440224 Ga0207667_104402242 137
269 3300025972 Ga0207668_10114335 Ga0207668_101143353 137
270 3300026041 Ga0207639_10003713 Ga0207639_100037138 137
271 3300031548 Ga0307408_100243761 Ga0307408_1002437612 137
272 3300031731 Ga0307405_10014497 Ga0307405_100144972 137
273 3300031852 Ga0307410_10135028 Ga0307410_101350283 137
274 3300048911 Ga0496108_0001246 Ga0496108_0001246_5274_5717 137
275 3300048913 Ga0496110_0111478 Ga0496110_0111478_1947_2390 137
276 3300048920 Ga0496117_0171093 Ga0496117_0171093_268_711 137
277 3300048924 Ga0496121_0000192 Ga0496121_0000192_114664_115107 137
278 3300048925 Ga0496122_0002550 Ga0496122_0002550_24783_25226 137
279 3300048926 Ga0496123_0006776 Ga0496123_0006776_6225_6668 137
280 3300048928 Ga0496125_0036666 Ga0496125_0036666_3678_4121 137
281 3300048929 Ga0496126_0010223 Ga0496126_0010223_300_743 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13801

Metal_resist

Heavy-metal resistance

21

154

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5io8-assembly1.cif.gz_A salmonella typhimurium virg-like (stv) protein at 2.19 angstrom resolution solved by iodine sad. 0.735 41 125
5ihf-assembly1.cif.gz_A salmonella typhimurium virg-like (stv) protein 0.7331 41 125
5io8-assembly1.cif.gz_B salmonella typhimurium virg-like (stv) protein at 2.19 angstrom resolution solved by iodine sad. 0.7326 43 125
3kh1-assembly1.cif.gz_B crystal structure of predicted metal-dependent phosphohydrolase (zp_00055740.2) from magnetospirillum magnetotacticum ms-1 at 1.37 a resolution 0.692 97 133
6owy-assembly1.cif.gz_B spy h96l:im7 k20pi-phe complex; multiple anomalous datasets contained herein for element identification 0.6885 42 125
ID Description Score Start End Superfamily
3layA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8042 45 110 1.20.120.1490
af_A0A1D6LAI6_120_354_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7206 102 131 1.25.10.10
2y3dA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7108 31 127 1.20.120.1490
af_K7M272_140_268_1.20.120.1490 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6955 31 127 1.20.120.1490
3kh1B00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.692 97 133 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A7Z0VJ46-F1-model_v4 Signaling pathway modulator ZraP (Zinc resistance-associated protein) 0.8419 42 131
AF-A0A5S5AVX3-F1-model_v4 deleted 0.7876 31 127
AF-A0A4Z0C0E8-F1-model_v4 Periplasmic heavy metal sensor 0.7865 37 124
AF-F6IDK6-F1-model_v4 Heavy metal resistance protein 0.7842 31 130
AF-A0A258BI86-F1-model_v4 Nickel-cobalt-cadmium resistance protein nccX 0.7774 36 131

Feature Viewer

pLDDT pTM Quality
77.51 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map