F384144

General Info

Members Datasets Scaffolds Average Seq Length
281 175 281 311

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100023166|Ga0070707_1000231661
Length 364
Sequence VSNELSVLGCRVSIEFSSGRDFIVAAGNHCGWPRAGNYSHPALKCDMLCAYVEKHYVDVREVRRPRRREGFALIRLLTGGICRTDIELVRGYSGFSGTPGHEFVGEVIETDDARLLGRRVVGEINLACRKCEWCLRGLSRHCPKRTVLGIVRHPGAFAEFLTLPQNNLHVVPDSISNEEAVFVEPIAAACEILDQAKIPDGAEVAVLGDGKLGLLVAQVLNAHRLDVHLYGRHKEKLRIAELAGVQTILAKGRLPVAAYDWVVEATGSLAGLRQAIPMTRPRGSVFMKSTIHGTVRLDTAPAIVNEITLIGSRCGRFEPALELLRSRQVNVLDMISTTLPLSHARRAFQKAAQRGVLKVLLNAD

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
111 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
112 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.71
Rhizosphere 97.86
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10002655 3300005327 Bacteria 14879
2 Ga0070690_100013937 3300005330 Unclassified 4765
3 Ga0070690_100054110 3300005330 Bacteria 2569
4 Ga0070670_100001263 3300005331 Bacteria 20155
5 Ga0070670_100131147 3300005331 Bacteria 2164
6 Ga0070666_10000593 3300005335 Bacteria 21829
7 Ga0070666_10014799 3300005335 Bacteria 4972
8 Ga0068868_100001834 3300005338 Bacteria 14605
9 Ga0070660_100135880 3300005339 Unclassified 1970
10 Ga0070689_100011630 3300005340 Bacteria 6311
11 Ga0070689_100028816 3300005340 Unclassified 4200
12 Ga0070689_100194867 3300005340 Unclassified 1651
13 Ga0070661_100133640 3300005344 Unclassified 1865
14 Ga0070669_100040603 3300005353 Bacteria 3382
15 Ga0070675_100000075 3300005354 Bacteria 57232
16 Ga0070675_100003284 3300005354 Bacteria 12267
17 Ga0070675_100229833 3300005354 Unclassified 1618
18 Ga0070671_100002885 3300005355 Bacteria 13382
19 Ga0070671_100040234 3300005355 Bacteria 3882
20 Ga0070674_100145976 3300005356 Bacteria 1781
21 Ga0070673_100008695 3300005364 Bacteria 6771
22 Ga0070673_100030054 3300005364 Bacteria 4060
23 Ga0070688_100036171 3300005365 Unclassified 3002
24 Ga0070688_100099325 3300005365 Bacteria 1916
25 Ga0070667_100004926 3300005367 Bacteria 11191
26 Ga0070667_100130686 3300005367 Unclassified 2191
27 Ga0070701_10045466 3300005438 Unclassified 2253
28 Ga0070711_100046577 3300005439 Unclassified 2955
29 Ga0070708_100007120 3300005445 Bacteria 8924
30 Ga0070708_100010227 3300005445 Bacteria 7596
31 Ga0070662_100262031 3300005457 Unclassified 1393
32 Ga0070681_10010209 3300005458 Bacteria 9263
33 Ga0070681_10011633 3300005458 Bacteria 8712
34 Ga0070706_100005338 3300005467 Bacteria 12243
35 Ga0070706_100005889 3300005467 Bacteria 11619
36 Ga0070707_100023166 3300005468 Bacteria 5874
37 Ga0070698_100000123 3300005471 Bacteria 67024
38 Ga0070698_100204063 3300005471 Unclassified 1912
39 Ga0070679_100069715 3300005530 Bacteria 3507
40 Ga0070697_100000623 3300005536 Bacteria 26909
41 Ga0070697_100209320 3300005536 Unclassified 1660
42 Ga0070672_100000676 3300005543 Bacteria 20037
43 Ga0070672_100001193 3300005543 Bacteria 15889
44 Ga0070672_100358977 3300005543 Unclassified 1243
45 Ga0070686_100007076 3300005544 Bacteria 6256
46 Ga0070696_100003740 3300005546 Bacteria 10162
47 Ga0070696_100039442 3300005546 Bacteria 3261
48 Ga0070696_100046978 3300005546 Bacteria 2995
49 Ga0070693_100062144 3300005547 Bacteria 2173
50 Ga0068855_100055021 3300005563 Bacteria 4675
51 Ga0068855_100171304 3300005563 Unclassified 2459
52 Ga0070664_100000206 3300005564 Bacteria 42263
53 Ga0070664_100378499 3300005564 Bacteria 1292
54 Ga0068856_100014189 3300005614 Bacteria 7701
55 Ga0068859_100000021 3300005617 Bacteria 236322
56 Ga0068859_100000510 3300005617 Bacteria 38352
57 Ga0068859_100013886 3300005617 Bacteria 8078
58 Ga0068864_100000210 3300005618 Bacteria 52449
59 Ga0068863_100002490 3300005841 Bacteria 18314
60 Ga0068863_100023750 3300005841 Bacteria 5849
61 Ga0068863_100054680 3300005841 Bacteria 3782
62 Ga0068860_100002284 3300005843 Bacteria 20139
63 Ga0070717_10188563 3300006028 Bacteria 1801
64 Ga0070716_100254983 3300006173 Bacteria 1197
65 Ga0097621_100014876 3300006237 Bacteria 5838
66 Ga0097621_100032087 3300006237 Bacteria 4173
67 Ga0097621_100076562 3300006237 Bacteria 2775
68 Ga0097621_100220419 3300006237 Unclassified 1653
69 Ga0068871_100002571 3300006358 Bacteria 12399
70 Ga0068871_100003208 3300006358 Bacteria 11219
71 Ga0068871_100384740 3300006358 Bacteria 1247
72 Ga0075428_100087817 3300006844 Bacteria 3392
73 Ga0075428_100553146 3300006844 Unclassified 1230
74 Ga0075430_100260519 3300006846 Unclassified 1436
75 Ga0075431_100043651 3300006847 Bacteria 4624
76 Ga0075431_100061488 3300006847 Bacteria 3875
77 Ga0075431_100181838 3300006847 Bacteria 2158
78 Ga0075433_10008813 3300006852 Bacteria 8050
79 Ga0075434_100003200 3300006871 Bacteria 14597
80 Ga0075434_100003487 3300006871 Bacteria 14068
81 Ga0075434_100101249 3300006871 Unclassified 2887
82 Ga0075434_100125806 3300006871 Bacteria 2580
83 Ga0075434_100175759 3300006871 Unclassified 2161
84 Ga0075429_100132735 3300006880 Bacteria 2178
85 Ga0075436_100008191 3300006914 Bacteria 7152
86 Ga0097620_100000021 3300006931 Bacteria 236322
87 Ga0097620_100000510 3300006931 Bacteria 38352
88 Ga0097620_100013886 3300006931 Bacteria 8078
89 Ga0075435_100138365 3300007076 Bacteria 2041
90 Ga0099795_10040480 3300007788 Bacteria 1655
91 Ga0105240_10078383 3300009093 Bacteria 4068
92 Ga0111539_10063392 3300009094 Unclassified 4374
93 Ga0111539_10202510 3300009094 Unclassified 2314
94 Ga0111539_10481756 3300009094 Bacteria 1445
95 Ga0114129_10002319 3300009147 Bacteria 26420
96 Ga0114129_10061037 3300009147 Bacteria 5270
97 Ga0114129_10080125 3300009147 Bacteria 4539
98 Ga0105241_10530054 3300009174 Bacteria 1054
99 Ga0105242_10122052 3300009176 Bacteria 2238
100 Ga0105248_10007754 3300009177 Bacteria 11784
101 Ga0105248_10014847 3300009177 Bacteria 8578
102 Ga0105248_10444634 3300009177 Bacteria 1460
103 Ga0105248_10532544 3300009177 Bacteria 1325
104 Ga0105237_10133896 3300009545 Bacteria 2473
105 Ga0157373_10107217 3300013100 Bacteria 1964
106 Ga0157371_10025339 3300013102 Bacteria 4324
107 Ga0157369_10020976 3300013105 Bacteria 7304
108 Ga0157374_10001836 3300013296 Bacteria 17880
109 Ga0157374_10056789 3300013296 Bacteria 3655
110 Ga0157378_10496692 3300013297 Bacteria 1218
111 Ga0163162_10000271 3300013306 Bacteria 47094
112 Ga0157372_10099738 3300013307 Bacteria 3313
113 Ga0157372_10183907 3300013307 Unclassified 2420
114 Ga0157375_10000197 3300013308 Bacteria 56238
115 Ga0157375_10001846 3300013308 Bacteria 18211
116 Ga0157375_10141491 3300013308 Bacteria 2533
117 Ga0157375_10279740 3300013308 Bacteria 1832
118 Ga0163163_10001339 3300014325 Bacteria 20779
119 Ga0163163_10016536 3300014325 Bacteria 6859
120 Ga0163163_10077174 3300014325 Bacteria 3327
121 Ga0163163_10443339 3300014325 Bacteria 1358
122 Ga0157380_10062314 3300014326 Bacteria 2987
123 Ga0157380_10331274 3300014326 Bacteria 1416
124 Ga0157379_10000050 3300014968 Bacteria 74545
125 Ga0157379_10012783 3300014968 Bacteria 7342
126 Ga0157376_10323320 3300014969 Bacteria 1467
127 Ga0228598_1008796 3300024227 Bacteria 2031
128 Ga0207680_10299049 3300025903 Unclassified 1121
129 Ga0207684_10004758 3300025910 Bacteria 12715
130 Ga0207684_10251891 3300025910 Bacteria 1523
131 Ga0207707_10004290 3300025912 Bacteria 12622
132 Ga0207707_10115421 3300025912 Viruses 2346
133 Ga0207695_10088019 3300025913 Bacteria 3127
134 Ga0207671_10128970 3300025914 Bacteria 1940
135 Ga0207663_10065798 3300025916 Unclassified 2318
136 Ga0207649_10096000 3300025920 Unclassified 1952
137 Ga0207652_10426164 3300025921 Viruses 1196
138 Ga0207646_10024479 3300025922 Bacteria 5530
139 Ga0207681_10038476 3300025923 Bacteria 3170
140 Ga0207650_10123048 3300025925 Bacteria 2022
141 Ga0207659_10000318 3300025926 Bacteria 29165
142 Ga0207659_10004626 3300025926 Bacteria 8331
143 Ga0207690_10041755 3300025932 Bacteria 3008
144 Ga0207706_10244854 3300025933 Unclassified 1567
145 Ga0207686_10322388 3300025934 Bacteria 1155
146 Ga0207670_10132517 3300025936 Bacteria 1828
147 Ga0207691_10006967 3300025940 Bacteria 10905
148 Ga0207691_10019232 3300025940 Bacteria 6465
149 Ga0207691_10353037 3300025940 Unclassified 1258
150 Ga0207711_10002540 3300025941 Bacteria 16249
151 Ga0207711_10019460 3300025941 Bacteria 5651
152 Ga0207679_10007833 3300025945 Bacteria 6786
153 Ga0207667_10248016 3300025949 Unclassified 1822
154 Ga0207651_10044482 3300025960 Bacteria 2972
155 Ga0207651_10060494 3300025960 Bacteria 2630
156 Ga0207658_10012602 3300025986 Bacteria 5773
157 Ga0207658_10080162 3300025986 Unclassified 2500
158 Ga0207677_10009542 3300026023 Bacteria 5463
159 Ga0207703_10371430 3300026035 Unclassified 1321
160 Ga0207639_10018303 3300026041 Bacteria 4978
161 Ga0207702_10006062 3300026078 Bacteria 10486
162 Ga0207641_10008229 3300026088 Bacteria 8619
163 Ga0207641_10018959 3300026088 Bacteria 5644
164 Ga0207641_10020408 3300026088 Bacteria 5442
165 Ga0207641_10104919 3300026088 Unclassified 2496
166 Ga0207676_10002252 3300026095 Bacteria 13852
167 Ga0207674_10528659 3300026116 Bacteria 1139
168 Ga0207428_10030719 3300027907 Bacteria 4439
169 Ga0268264_10020611 3300028381 Bacteria 5386
170 Ga0265338_10211560 3300028800 Viruses 1455
171 Ga0265314_10003050 3300031711 Bacteria 16520
172 Ga0307413_10000387 3300031824 Bacteria 14022
173 Ga0307410_10004273 3300031852 Bacteria 7356
174 Ga0307406_10033362 3300031901 Bacteria 3151
175 Ga0307407_10002441 3300031903 Bacteria 7275
176 Ga0307407_10024995 3300031903 Bacteria 3142
177 Ga0307411_10017199 3300032005 Bacteria 4111
178 Ga0307415_100022383 3300032126 Bacteria 3899
179 Ga0373926_0088438 3300035083 Bacteria 1150
180 Ga0373934_0005346 3300035086 Bacteria 4756
181 Ga0373951_0000534 3300035091 Bacteria 10720
182 Ga0373954_0008372 3300035118 Bacteria 4537
183 Ga0373943_0216860 3300035170 Bacteria 1064
184 Ga0373935_0064099 3300035692 Unclassified 2356
185 Ga0373935_0521428 3300035692 Bacteria 864
186 Ga0373927_0004107 3300035695 Bacteria 10256
187 Ga0373927_0018817 3300035695 Bacteria 4532
188 Ga0373927_0042965 3300035695 Bacteria 2928
189 Ga0373927_0064065 3300035695 Unclassified 2378
190 Ga0373933_0110022 3300035724 Unclassified 1718
191 Ga0373947_0006973 3300035725 Bacteria 6544
192 Ga0373947_0015711 3300035725 Unclassified 4348
193 Ga0373937_0076359 3300036401 Bacteria 3094
194 Ga0373937_0080877 3300036401 Bacteria 3006
195 Ga0373937_0081399 3300036401 Bacteria 2995
196 Ga0373925_0017733 3300037068 Bacteria 5166
197 Ga0373925_0031561 3300037068 Unclassified 3894
198 Ga0373925_0238320 3300037068 Bacteria 1456
199 Ga0436364_0464825 3300037853 Unclassified 2143
200 Ga0436365_0578263 3300039437 Bacteria 2351
201 Ga0436363_1142438 3300039450 Bacteria 1854
202 Ga0436363_1387679 3300039450 Bacteria 4767
203 Ga0451577_0001713 3300042876 Bacteria 28264
204 Ga0453684_0021944 3300044712 Bacteria 9502
205 Ga0495592_0006011 3300046454 Bacteria 9023
206 Ga0495629_0125630 3300046459 Unclassified 1787
207 Ga0495653_0237796 3300046463 Unclassified 1216
208 Ga0495580_0001116 3300046472 Bacteria 23612
209 Ga0495580_0002833 3300046472 Bacteria 14914
210 Ga0495580_0134521 3300046472 Unclassified 1714
211 Ga0495618_0060485 3300046514 Bacteria 2402
212 Ga0495628_0219778 3300046516 Unclassified 1427
213 Ga0495630_0018673 3300046517 Bacteria 5094
214 Ga0495586_0027354 3300046535 Bacteria 3052
215 Ga0495667_0012261 3300046559 Bacteria 5810
216 Ga0495635_0218880 3300046663 Bacteria 1288
217 Ga0495657_0002074 3300046675 Bacteria 17020
218 Ga0495599_0116727 3300046678 Unclassified 1660
219 Ga0495647_0012545 3300046681 Unclassified 2920
220 Ga0495647_0075710 3300046681 Unclassified 1355
221 Ga0495647_0081375 3300046681 Bacteria 1314
222 Ga0495658_0016930 3300046683 Bacteria 3757
223 Ga0495658_0260749 3300046683 Unclassified 1091
224 Ga0495674_0081445 3300047319 Bacteria 2777
225 Ga0495674_0116469 3300047319 Bacteria 2260
226 Ga0495674_0236656 3300047319 Bacteria 1506
227 Ga0495674_0386196 3300047319 Bacteria 1132
228 Ga0495675_0178706 3300047444 Unclassified 1300
229 Ga0495675_0306703 3300047444 Unclassified 941
230 Ga0495684_0051292 3300047471 Bacteria 3149
231 Ga0495602_0095239 3300048088 Bacteria 2458
232 Ga0496112_0040473 3300048915 Bacteria 4557
233 Ga0496115_0005168 3300048918 Bacteria 9496
234 Ga0501031_0011498 3300049568 Bacteria 5769
235 Ga0501032_0000623 3300049569 Bacteria 28778
236 Ga0501034_0005689 3300049571 Bacteria 13550
237 Ga0501036_0000641 3300049572 Bacteria 25541
238 Ga0501038_0016482 3300049574 Bacteria 6696
239 Ga0501038_0020149 3300049574 Bacteria 6001
240 Ga0501039_0026239 3300049575 Unclassified 4478
241 Ga0501043_0094458 3300049579 Bacteria 2351
242 Ga0501046_0005767 3300049580 Bacteria 11055
243 Ga0501046_0344486 3300049580 Unclassified 1083
244 Ga0501047_0032011 3300049581 Bacteria 5074
245 Ga0501047_0152097 3300049581 Bacteria 2190
246 Ga0501048_0079915 3300049582 Bacteria 2307
247 Ga0501067_0000960 3300049583 Bacteria 15436
248 Ga0501067_0003345 3300049583 Bacteria 8810
249 Ga0501068_0000526 3300049584 Bacteria 19398
250 Ga0501068_0004718 3300049584 Bacteria 7412
251 Ga0501068_0178486 3300049584 Bacteria 1342
252 Ga0501069_0000364 3300049585 Bacteria 20387
253 Ga0501069_0003255 3300049585 Bacteria 8329
254 Ga0501070_0010292 3300049586 Bacteria 7906
255 Ga0501072_0000028 3300049588 Bacteria 136173
256 Ga0501072_0000479 3300049588 Bacteria 28715
257 Ga0501072_0020613 3300049588 Bacteria 5109
258 Ga0501073_0000613 3300049589 Bacteria 25120
259 Ga0501073_0006791 3300049589 Bacteria 8511
260 Ga0501074_0011666 3300049590 Bacteria 6387
261 Ga0501076_0035988 3300049592 Bacteria 3877
262 Ga0501076_0071875 3300049592 Unclassified 2768
263 Ga0501077_0001787 3300049593 Bacteria 12998
264 Ga0501083_0003095 3300049744 Bacteria 11566
265 Ga0501044_0017026 3300049823 Bacteria 7799
266 nmdc:mga05p37_1833_c1 3300050507 Bacteria 24787
267 nmdc:mga05p37_24120_c1 3300050507 Bacteria 7389
268 nmdc:mga05p37_47547_c1 3300050507 Bacteria 5276
269 nmdc:mga05p37_57738_c1 3300050507 Bacteria 4780
270 nmdc:mga09592_3592_c1 3300050508 Bacteria 12512
271 nmdc:mga09592_37251_c1 3300050508 Bacteria 4080
272 nmdc:mga06r32_48562_c1 3300050510 Unclassified 4057
273 nmdc:mga08y16_30641_c1 3300050511 Bacteria 5659
274 nmdc:mga08y16_552242_c1 3300050511 Bacteria 1165
275 nmdc:mga0n895_2102_c1 3300050512 Bacteria 15352
276 nmdc:mga0rr50_248879_c1 3300050513 Bacteria 1475
277 nmdc:mga0a205_30823_c1 3300050515 Bacteria 5136
278 nmdc:mga0a205_3490_c1 3300050515 Bacteria 14041
279 Ga0501084_0000056 3300054114 Bacteria 89249
280 Ga0501084_0001465 3300054114 Bacteria 18734
281 Ga0530510_0084206 3300061734 Bacteria 2316

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035083 Ga0373926_0088438 Ga0373926_0088438_56_829 255
2 3300035170 Ga0373943_0216860 Ga0373943_0216860_27_809 259
3 3300035692 Ga0373935_0521428 Ga0373935_0521428_55_837 259
4 3300005445 Ga0070708_100010227 Ga0070708_1000102276 272
5 3300005467 Ga0070706_100005338 Ga0070706_10000533811 272
6 3300005467 Ga0070706_100005889 Ga0070706_10000588910 272
7 3300005471 Ga0070698_100000123 Ga0070698_1000001233 272
8 3300005471 Ga0070698_100204063 Ga0070698_1002040631 272
9 3300005536 Ga0070697_100000623 Ga0070697_10000062326 272
10 3300025910 Ga0207684_10004758 Ga0207684_1000475811 272
11 3300047319 Ga0495674_0386196 Ga0495674_0386196_211_1071 286
12 3300049823 Ga0501044_0017026 Ga0501044_0017026_12_875 286
13 3300025910 Ga0207684_10251891 Ga0207684_102518912 287
14 3300039437 Ga0436365_0578263 Ga0436365_0578263_1225_2094 288
15 3300005543 Ga0070672_100000676 Ga0070672_1000006762 291
16 3300005841 Ga0068863_100002490 Ga0068863_1000024907 291
17 3300005843 Ga0068860_100002284 Ga0068860_1000022848 291
18 3300006237 Ga0097621_100014876 Ga0097621_1000148765 291
19 3300006358 Ga0068871_100002571 Ga0068871_10000257115 291
20 3300009094 Ga0111539_10202510 Ga0111539_102025102 291
21 3300009147 Ga0114129_10002319 Ga0114129_100023196 291
22 3300025923 Ga0207681_10038476 Ga0207681_100384764 291
23 3300025934 Ga0207686_10322388 Ga0207686_103223882 291
24 3300025940 Ga0207691_10019232 Ga0207691_100192322 291
25 3300025941 Ga0207711_10002540 Ga0207711_1000254013 291
26 3300025986 Ga0207658_10012602 Ga0207658_100126025 291
27 3300026088 Ga0207641_10008229 Ga0207641_100082294 291
28 3300028381 Ga0268264_10020611 Ga0268264_100206115 291
29 3300031824 Ga0307413_10000387 Ga0307413_100003874 291
30 3300031852 Ga0307410_10004273 Ga0307410_100042733 291
31 3300031903 Ga0307407_10002441 Ga0307407_100024415 291
32 3300032005 Ga0307411_10017199 Ga0307411_100171991 291
33 3300032126 Ga0307415_100022383 Ga0307415_1000223832 291
34 3300047444 Ga0495675_0306703 Ga0495675_0306703_13_891 291
35 3300050507 nmdc:mga05p37_1833_c1 nmdc:mga05p37_1833_c1_21498_22376 291
36 3300050512 nmdc:mga0n895_2102_c1 nmdc:mga0n895_2102_c1_2035_2913 291
37 3300050513 nmdc:mga0rr50_248879_c1 nmdc:mga0rr50_248879_c1_452_1330 291
38 3300050515 nmdc:mga0a205_3490_c1 nmdc:mga0a205_3490_c1_1665_2543 291
39 3300005339 Ga0070660_100135880 Ga0070660_1001358803 292
40 3300005344 Ga0070661_100133640 Ga0070661_1001336402 292
41 3300005563 Ga0068855_100055021 Ga0068855_1000550216 292
42 3300005614 Ga0068856_100014189 Ga0068856_1000141897 292
43 3300013105 Ga0157369_10020976 Ga0157369_100209765 292
44 3300013296 Ga0157374_10001836 Ga0157374_1000183622 292
45 3300013307 Ga0157372_10183907 Ga0157372_101839072 292
46 3300026041 Ga0207639_10018303 Ga0207639_100183034 292
47 3300026078 Ga0207702_10006062 Ga0207702_1000606210 292
48 3300048918 Ga0496115_0005168 Ga0496115_0005168_4457_5335 292
49 3300005617 Ga0068859_100000021 Ga0068859_10000002190 293
50 3300006931 Ga0097620_100000021 Ga0097620_10000002190 293
51 3300006237 Ga0097621_100032087 Ga0097621_1000320873 296
52 3300009177 Ga0105248_10532544 Ga0105248_105325441 296
53 3300013100 Ga0157373_10107217 Ga0157373_101072173 296
54 3300013102 Ga0157371_10025339 Ga0157371_100253393 296
55 3300013296 Ga0157374_10056789 Ga0157374_100567893 296
56 3300013308 Ga0157375_10279740 Ga0157375_102797401 296
57 3300025932 Ga0207690_10041755 Ga0207690_100417553 296
58 3300048915 Ga0496112_0040473 Ga0496112_0040473_594_1484 296
59 3300049584 Ga0501068_0178486 Ga0501068_0178486_423_1316 296
60 3300013308 Ga0157375_10141491 Ga0157375_101414912 297
61 3300037068 Ga0373925_0017733 Ga0373925_0017733_4138_5037 298
62 3300046681 Ga0495647_0012545 Ga0495647_0012545_139_1038 298
63 3300005445 Ga0070708_100007120 Ga0070708_1000071206 299
64 3300005546 Ga0070696_100046978 Ga0070696_1000469782 299
65 3300006173 Ga0070716_100254983 Ga0070716_1002549832 299
66 3300006871 Ga0075434_100175759 Ga0075434_1001757594 299
67 3300046472 Ga0495580_0002833 Ga0495580_0002833_12547_13464 299
68 3300046681 Ga0495647_0081375 Ga0495647_0081375_130_1038 299
69 3300046683 Ga0495658_0016930 Ga0495658_0016930_2711_3619 299
70 3300049580 Ga0501046_0344486 Ga0501046_0344486_48_992 299
71 3300050515 nmdc:mga0a205_30823_c1 nmdc:mga0a205_30823_c1_2813_3739 299
72 3300037853 Ga0436364_0464825 Ga0436364_0464825_765_1667 300
73 3300009177 Ga0105248_10014847 Ga0105248_100148476 302
74 3300013308 Ga0157375_10000197 Ga0157375_1000019718 302
75 3300014968 Ga0157379_10000050 Ga0157379_1000005034 302
76 3300006914 Ga0075436_100008191 Ga0075436_1000081916 303
77 3300031903 Ga0307407_10024995 Ga0307407_100249952 303
78 3300035091 Ga0373951_0000534 Ga0373951_0000534_6708_7643 303
79 3300005543 Ga0070672_100358977 Ga0070672_1003589771 305
80 3300014325 Ga0163163_10077174 Ga0163163_100771742 305
81 3300025940 Ga0207691_10353037 Ga0207691_103530371 305
82 3300025949 Ga0207667_10248016 Ga0207667_102480163 307
83 3300005530 Ga0070679_100069715 Ga0070679_1000697152 308
84 3300025912 Ga0207707_10115421 Ga0207707_101154212 308
85 3300025921 Ga0207652_10426164 Ga0207652_104261641 308
86 3300025960 Ga0207651_10060494 Ga0207651_100604943 308
87 3300028800 Ga0265338_10211560 Ga0265338_102115602 308
88 3300005547 Ga0070693_100062144 Ga0070693_1000621442 309
89 3300009174 Ga0105241_10530054 Ga0105241_105300541 310
90 3300006847 Ga0075431_100181838 Ga0075431_1001818382 312
91 3300050508 nmdc:mga09592_3592_c1 nmdc:mga09592_3592_c1_8847_9818 312
92 3300013297 Ga0157378_10496692 Ga0157378_104966921 313
93 3300014968 Ga0157379_10012783 Ga0157379_100127835 314
94 3300005439 Ga0070711_100046577 Ga0070711_1000465773 315
95 3300005458 Ga0070681_10011633 Ga0070681_100116336 315
96 3300005536 Ga0070697_100209320 Ga0070697_1002093201 315
97 3300006028 Ga0070717_10188563 Ga0070717_101885633 315
98 3300007788 Ga0099795_10040480 Ga0099795_100404802 315
99 3300014969 Ga0157376_10323320 Ga0157376_103233202 315
100 3300025912 Ga0207707_10004290 Ga0207707_100042906 315
101 3300025913 Ga0207695_10088019 Ga0207695_100880195 315
102 3300025916 Ga0207663_10065798 Ga0207663_100657982 315
103 3300031901 Ga0307406_10033362 Ga0307406_100333622 315
104 3300035695 Ga0373927_0018817 Ga0373927_0018817_2798_3748 315
105 3300036401 Ga0373937_0080877 Ga0373937_0080877_1473_2423 315
106 3300039450 Ga0436363_1387679 Ga0436363_1387679_3066_4019 315
107 3300046472 Ga0495580_0134521 Ga0495580_0134521_179_1129 315
108 3300049588 Ga0501072_0020613 Ga0501072_0020613_3739_4695 315
109 3300005331 Ga0070670_100131147 Ga0070670_1001311472 316
110 3300005546 Ga0070696_100003740 Ga0070696_1000037402 316
111 3300006846 Ga0075430_100260519 Ga0075430_1002605192 316
112 3300006847 Ga0075431_100043651 Ga0075431_1000436512 316
113 3300006847 Ga0075431_100061488 Ga0075431_1000614884 316
114 3300006871 Ga0075434_100101249 Ga0075434_1001012493 316
115 3300006880 Ga0075429_100132735 Ga0075429_1001327352 316
116 3300009147 Ga0114129_10080125 Ga0114129_100801256 316
117 3300024227 Ga0228598_1008796 Ga0228598_10087962 316
118 3300025925 Ga0207650_10123048 Ga0207650_101230482 316
119 3300035086 Ga0373934_0005346 Ga0373934_0005346_629_1585 316
120 3300035118 Ga0373954_0008372 Ga0373954_0008372_353_1309 316
121 3300035692 Ga0373935_0064099 Ga0373935_0064099_785_1741 316
122 3300035695 Ga0373927_0004107 Ga0373927_0004107_646_1602 316
123 3300035695 Ga0373927_0042965 Ga0373927_0042965_800_1750 316
124 3300035695 Ga0373927_0064065 Ga0373927_0064065_1065_2021 316
125 3300035724 Ga0373933_0110022 Ga0373933_0110022_616_1572 316
126 3300035725 Ga0373947_0006973 Ga0373947_0006973_2616_3572 316
127 3300035725 Ga0373947_0015711 Ga0373947_0015711_1980_2936 316
128 3300037068 Ga0373925_0031561 Ga0373925_0031561_1199_2155 316
129 3300037068 Ga0373925_0238320 Ga0373925_0238320_289_1245 316
130 3300042876 Ga0451577_0001713 Ga0451577_0001713_14554_15504 316
131 3300044712 Ga0453684_0021944 Ga0453684_0021944_7747_8697 316
132 3300046463 Ga0495653_0237796 Ga0495653_0237796_155_1111 316
133 3300046472 Ga0495580_0001116 Ga0495580_0001116_13533_14489 316
134 3300046517 Ga0495630_0018673 Ga0495630_0018673_2535_3497 316
135 3300046663 Ga0495635_0218880 Ga0495635_0218880_76_1032 316
136 3300047319 Ga0495674_0081445 Ga0495674_0081445_35_991 316
137 3300047319 Ga0495674_0236656 Ga0495674_0236656_69_1025 316
138 3300047444 Ga0495675_0178706 Ga0495675_0178706_106_1068 316
139 3300048088 Ga0495602_0095239 Ga0495602_0095239_1454_2404 316
140 3300050507 nmdc:mga05p37_24120_c1 nmdc:mga05p37_24120_c1_3448_4401 316
141 3300050507 nmdc:mga05p37_57738_c1 nmdc:mga05p37_57738_c1_3689_4642 316
142 3300050508 nmdc:mga09592_37251_c1 nmdc:mga09592_37251_c1_2671_3624 316
143 3300005327 Ga0070658_10002655 Ga0070658_1000265512 317
144 3300005330 Ga0070690_100013937 Ga0070690_1000139375 317
145 3300005330 Ga0070690_100054110 Ga0070690_1000541103 317
146 3300005331 Ga0070670_100001263 Ga0070670_10000126312 317
147 3300005335 Ga0070666_10000593 Ga0070666_1000059313 317
148 3300005335 Ga0070666_10014799 Ga0070666_100147993 317
149 3300005338 Ga0068868_100001834 Ga0068868_10000183410 317
150 3300005340 Ga0070689_100011630 Ga0070689_1000116306 317
151 3300005340 Ga0070689_100028816 Ga0070689_1000288163 317
152 3300005340 Ga0070689_100194867 Ga0070689_1001948672 317
153 3300005353 Ga0070669_100040603 Ga0070669_1000406032 317
154 3300005354 Ga0070675_100000075 Ga0070675_1000000756 317
155 3300005354 Ga0070675_100003284 Ga0070675_1000032843 317
156 3300005354 Ga0070675_100229833 Ga0070675_1002298331 317
157 3300005355 Ga0070671_100002885 Ga0070671_1000028858 317
158 3300005355 Ga0070671_100040234 Ga0070671_1000402342 317
159 3300005356 Ga0070674_100145976 Ga0070674_1001459761 317
160 3300005364 Ga0070673_100008695 Ga0070673_1000086954 317
161 3300005364 Ga0070673_100030054 Ga0070673_1000300543 317
162 3300005365 Ga0070688_100036171 Ga0070688_1000361713 317
163 3300005365 Ga0070688_100099325 Ga0070688_1000993252 317
164 3300005367 Ga0070667_100004926 Ga0070667_1000049264 317
165 3300005367 Ga0070667_100130686 Ga0070667_1001306861 317
166 3300005438 Ga0070701_10045466 Ga0070701_100454661 317
167 3300005457 Ga0070662_100262031 Ga0070662_1002620311 317
168 3300005458 Ga0070681_10010209 Ga0070681_1001020911 317
169 3300005468 Ga0070707_100023166 Ga0070707_1000231661 317
170 3300005543 Ga0070672_100001193 Ga0070672_10000119313 317
171 3300005544 Ga0070686_100007076 Ga0070686_1000070763 317
172 3300005546 Ga0070696_100039442 Ga0070696_1000394422 317
173 3300005563 Ga0068855_100171304 Ga0068855_1001713042 317
174 3300005564 Ga0070664_100000206 Ga0070664_10000020634 317
175 3300005564 Ga0070664_100378499 Ga0070664_1003784992 317
176 3300005617 Ga0068859_100000510 Ga0068859_10000051017 317
177 3300005617 Ga0068859_100013886 Ga0068859_1000138864 317
178 3300005618 Ga0068864_100000210 Ga0068864_10000021010 317
179 3300005841 Ga0068863_100023750 Ga0068863_1000237505 317
180 3300005841 Ga0068863_100054680 Ga0068863_1000546803 317
181 3300006237 Ga0097621_100076562 Ga0097621_1000765622 317
182 3300006237 Ga0097621_100220419 Ga0097621_1002204192 317
183 3300006358 Ga0068871_100003208 Ga0068871_10000320813 317
184 3300006358 Ga0068871_100384740 Ga0068871_1003847401 317
185 3300006844 Ga0075428_100087817 Ga0075428_1000878172 317
186 3300006844 Ga0075428_100553146 Ga0075428_1005531462 317
187 3300006852 Ga0075433_10008813 Ga0075433_100088138 317
188 3300006871 Ga0075434_100003200 Ga0075434_1000032003 317
189 3300006871 Ga0075434_100003487 Ga0075434_10000348714 317
190 3300006871 Ga0075434_100125806 Ga0075434_1001258064 317
191 3300006931 Ga0097620_100000510 Ga0097620_10000051025 317
192 3300006931 Ga0097620_100013886 Ga0097620_1000138864 317
193 3300007076 Ga0075435_100138365 Ga0075435_1001383652 317
194 3300009093 Ga0105240_10078383 Ga0105240_100783835 317
195 3300009094 Ga0111539_10063392 Ga0111539_100633924 317
196 3300009094 Ga0111539_10481756 Ga0111539_104817562 317
197 3300009147 Ga0114129_10061037 Ga0114129_100610375 317
198 3300009176 Ga0105242_10122052 Ga0105242_101220522 317
199 3300009177 Ga0105248_10007754 Ga0105248_100077548 317
200 3300009177 Ga0105248_10444634 Ga0105248_104446341 317
201 3300009545 Ga0105237_10133896 Ga0105237_101338962 317
202 3300013306 Ga0163162_10000271 Ga0163162_1000027139 317
203 3300013307 Ga0157372_10099738 Ga0157372_100997383 317
204 3300013308 Ga0157375_10001846 Ga0157375_100018468 317
205 3300014325 Ga0163163_10001339 Ga0163163_1000133913 317
206 3300014325 Ga0163163_10016536 Ga0163163_100165364 317
207 3300014325 Ga0163163_10443339 Ga0163163_104433391 317
208 3300014326 Ga0157380_10062314 Ga0157380_100623142 317
209 3300014326 Ga0157380_10331274 Ga0157380_103312741 317
210 3300025903 Ga0207680_10299049 Ga0207680_102990491 317
211 3300025914 Ga0207671_10128970 Ga0207671_101289702 317
212 3300025920 Ga0207649_10096000 Ga0207649_100960002 317
213 3300025922 Ga0207646_10024479 Ga0207646_100244793 317
214 3300025926 Ga0207659_10000318 Ga0207659_1000031826 317
215 3300025926 Ga0207659_10004626 Ga0207659_100046264 317
216 3300025933 Ga0207706_10244854 Ga0207706_102448542 317
217 3300025936 Ga0207670_10132517 Ga0207670_101325172 317
218 3300025940 Ga0207691_10006967 Ga0207691_100069678 317
219 3300025941 Ga0207711_10019460 Ga0207711_100194606 317
220 3300025945 Ga0207679_10007833 Ga0207679_100078338 317
221 3300025960 Ga0207651_10044482 Ga0207651_100444822 317
222 3300025986 Ga0207658_10080162 Ga0207658_100801622 317
223 3300026023 Ga0207677_10009542 Ga0207677_100095426 317
224 3300026035 Ga0207703_10371430 Ga0207703_103714302 317
225 3300026088 Ga0207641_10018959 Ga0207641_100189594 317
226 3300026088 Ga0207641_10020408 Ga0207641_100204084 317
227 3300026088 Ga0207641_10104919 Ga0207641_101049193 317
228 3300026095 Ga0207676_10002252 Ga0207676_1000225211 317
229 3300026116 Ga0207674_10528659 Ga0207674_105286592 317
230 3300027907 Ga0207428_10030719 Ga0207428_100307192 317
231 3300031711 Ga0265314_10003050 Ga0265314_1000305016 317
232 3300036401 Ga0373937_0076359 Ga0373937_0076359_1218_2174 317
233 3300036401 Ga0373937_0081399 Ga0373937_0081399_19_975 317
234 3300039450 Ga0436363_1142438 Ga0436363_1142438_676_1629 317
235 3300046454 Ga0495592_0006011 Ga0495592_0006011_6702_7658 317
236 3300046459 Ga0495629_0125630 Ga0495629_0125630_190_1146 317
237 3300046514 Ga0495618_0060485 Ga0495618_0060485_93_1049 317
238 3300046516 Ga0495628_0219778 Ga0495628_0219778_431_1387 317
239 3300046535 Ga0495586_0027354 Ga0495586_0027354_1065_2021 317
240 3300046559 Ga0495667_0012261 Ga0495667_0012261_492_1448 317
241 3300046675 Ga0495657_0002074 Ga0495657_0002074_6685_7641 317
242 3300046678 Ga0495599_0116727 Ga0495599_0116727_11_967 317
243 3300046681 Ga0495647_0075710 Ga0495647_0075710_283_1239 317
244 3300046683 Ga0495658_0260749 Ga0495658_0260749_76_1032 317
245 3300047319 Ga0495674_0116469 Ga0495674_0116469_1036_1992 317
246 3300047471 Ga0495684_0051292 Ga0495684_0051292_427_1383 317
247 3300049568 Ga0501031_0011498 Ga0501031_0011498_2004_2966 317
248 3300049569 Ga0501032_0000623 Ga0501032_0000623_11894_12856 317
249 3300049571 Ga0501034_0005689 Ga0501034_0005689_11148_12110 317
250 3300049572 Ga0501036_0000641 Ga0501036_0000641_3791_4753 317
251 3300049574 Ga0501038_0016482 Ga0501038_0016482_1934_2896 317
252 3300049574 Ga0501038_0020149 Ga0501038_0020149_269_1225 317
253 3300049575 Ga0501039_0026239 Ga0501039_0026239_1948_2910 317
254 3300049579 Ga0501043_0094458 Ga0501043_0094458_715_1671 317
255 3300049580 Ga0501046_0005767 Ga0501046_0005767_6575_7537 317
256 3300049581 Ga0501047_0032011 Ga0501047_0032011_619_1575 317
257 3300049581 Ga0501047_0152097 Ga0501047_0152097_752_1705 317
258 3300049582 Ga0501048_0079915 Ga0501048_0079915_986_1948 317
259 3300049583 Ga0501067_0000960 Ga0501067_0000960_10983_11945 317
260 3300049583 Ga0501067_0003345 Ga0501067_0003345_1460_2416 317
261 3300049584 Ga0501068_0000526 Ga0501068_0000526_10203_11165 317
262 3300049584 Ga0501068_0004718 Ga0501068_0004718_547_1503 317
263 3300049585 Ga0501069_0000364 Ga0501069_0000364_11521_12483 317
264 3300049585 Ga0501069_0003255 Ga0501069_0003255_769_1725 317
265 3300049586 Ga0501070_0010292 Ga0501070_0010292_4183_5145 317
266 3300049588 Ga0501072_0000028 Ga0501072_0000028_128942_129898 317
267 3300049588 Ga0501072_0000479 Ga0501072_0000479_19806_20768 317
268 3300049589 Ga0501073_0000613 Ga0501073_0000613_8140_9102 317
269 3300049589 Ga0501073_0006791 Ga0501073_0006791_2533_3489 317
270 3300049590 Ga0501074_0011666 Ga0501074_0011666_3492_4454 317
271 3300049592 Ga0501076_0035988 Ga0501076_0035988_2747_3703 317
272 3300049592 Ga0501076_0071875 Ga0501076_0071875_693_1655 317
273 3300049593 Ga0501077_0001787 Ga0501077_0001787_3928_4890 317
274 3300049744 Ga0501083_0003095 Ga0501083_0003095_6301_7257 317
275 3300050507 nmdc:mga05p37_47547_c1 nmdc:mga05p37_47547_c1_222_1178 317
276 3300050510 nmdc:mga06r32_48562_c1 nmdc:mga06r32_48562_c1_327_1286 317
277 3300050511 nmdc:mga08y16_30641_c1 nmdc:mga08y16_30641_c1_646_1650 317
278 3300050511 nmdc:mga08y16_552242_c1 nmdc:mga08y16_552242_c1_15_974 317
279 3300054114 Ga0501084_0000056 Ga0501084_0000056_6417_7373 317
280 3300054114 Ga0501084_0001465 Ga0501084_0001465_9871_10833 317
281 3300061734 Ga0530510_0084206 Ga0530510_0084206_275_1231 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

68

173

0.92

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

212

326

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ilk-assembly1.cif.gz_A crystal structure of short chain alcohol dehydrogenase (rspb) from e. coli cft073 (efi target efi-506413) complexed with cofactor nadh 0.932 1 315
4ilk-assembly1.cif.gz_B crystal structure of short chain alcohol dehydrogenase (rspb) from e. coli cft073 (efi target efi-506413) complexed with cofactor nadh 0.9283 1 315
1pl6-assembly1.cif.gz_A human sdh/nadh/inhibitor complex 0.9283 2 317
4ilk-assembly1.cif.gz_A crystal structure of short chain alcohol dehydrogenase (rspb) from e. coli cft073 (efi target efi-506413) complexed with cofactor nadh 0.9236 1 315
4uej-assembly1.cif.gz_A closed state of galactitol-1-phosphate 5-dehydrogenase from e. coli in complex with glycerol. 0.923 1 315
ID Description Score Start End Superfamily
af_A4HWA7_1_176_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9992 156 185 3.50.50.60
af_Q54H99_9_164_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9553 155 187 3.50.50.60
af_P38105_1_147_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9424 1 139 3.90.180.10
af_O96299_6_149_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9362 2 134 3.90.180.10
af_Q4DRR6_1_276_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9327 157 188 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7R8GG73-F1-model_v4 deleted 0.9915 1 317
AF-A0A7R8GG73-F1-model_v4 deleted 0.9884 1 317
AF-A0A2V8TQH0-F1-model_v4 Alcohol dehydrogenase 0.9845 1 302
AF-A0A1D2PF11-F1-model_v4 deleted 0.9804 1 317
AF-A0A1X4G6N6-F1-model_v4 Alcohol dehydrogenase 0.9802 1 317

Feature Viewer

pLDDT pTM Quality
95.53 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map