F384158

General Info

Members Datasets Scaffolds Average Seq Length
281 160 562 159

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100023210|Ga0068853_1000232108
Length 184
Sequence MTVINTVIFIYGTGFRKLPAVKDCYMSIEKENFLRTKLVQYLQRLDPATPPRWGKMNVQQMVEHYAGDAVRNASGRLKIEKIITPPEALERMREFMMSEKPFKENTKNPLMGEEPTPLRYKTVQAAIGALQQELIYFFEAFEKDPQLITRNPFFGDLNFEQCVQLLYKHALHHLRQFGVEPLTT

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
129 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
130 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
131 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
132 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
133 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
134 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
135 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
136 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
137 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
138 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
139 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
140 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
153 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
159 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
160 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 0
Rhizoplane 2.14
Rhizosphere 93.59
Stem 0
Stem Tuber 0
Unclassified 16.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100023210 3300005539 Bacteria 5190
2 JGI24744J21845_10040363 3300002077 Bacteria 874
3 rootH2_10311920 3300003320 Bacteria 1858
4 rootL2_10051861 3300003322 Bacteria 1302
5 rootL2_10309718 3300003322 Bacteria 2289
6 Ga0065712_10017913 3300005290 Unclassified 2708
7 Ga0065715_10131423 3300005293 Bacteria 2008
8 Ga0070676_10103215 3300005328 Bacteria 1765
9 Ga0070676_11006582 3300005328 Bacteria 626
10 Ga0070683_100455042 3300005329 Bacteria 1221
11 Ga0070690_100067926 3300005330 Bacteria 2311
12 Ga0070690_100754358 3300005330 Bacteria 751
13 Ga0070670_100029758 3300005331 Bacteria 4704
14 Ga0070670_100123344 3300005331 Bacteria 2235
15 Ga0070670_100944059 3300005331 Unclassified 783
16 Ga0068869_100066213 3300005334 Unclassified 2661
17 Ga0068869_100171348 3300005334 Unclassified 1696
18 Ga0068869_100255285 3300005334 Bacteria 1402
19 Ga0068869_101205296 3300005334 Bacteria 665
20 Ga0070680_100119428 3300005336 Bacteria 2199
21 Ga0070682_100696113 3300005337 Bacteria 814
22 Ga0068868_100141948 3300005338 Unclassified 1972
23 Ga0068868_100462416 3300005338 Bacteria 1105
24 Ga0070689_101493074 3300005340 Unclassified 612
25 Ga0070687_100035571 3300005343 Unclassified 2474
26 Ga0070687_100048473 3300005343 Bacteria 2184
27 Ga0070687_100054536 3300005343 Bacteria 2083
28 Ga0070687_100453089 3300005343 Unclassified 854
29 Ga0070661_100478437 3300005344 Unclassified 994
30 Ga0070661_101046429 3300005344 Bacteria 678
31 Ga0070668_100009511 3300005347 Bacteria 7211
32 Ga0070668_100066280 3300005347 Bacteria 2802
33 Ga0070668_100248212 3300005347 Bacteria 1477
34 Ga0070669_100006379 3300005353 Bacteria 8494
35 Ga0070675_100016567 3300005354 Bacteria 5850
36 Ga0070674_100005144 3300005356 Bacteria 7522
37 Ga0070673_100004720 3300005364 Bacteria 8654
38 Ga0070673_101240390 3300005364 Unclassified 699
39 Ga0070673_101464678 3300005364 Unclassified 643
40 Ga0070688_100004858 3300005365 Bacteria 7030
41 Ga0070667_100144457 3300005367 Bacteria 2085
42 Ga0070667_101065099 3300005367 Bacteria 755
43 Ga0070711_100739816 3300005439 Bacteria 830
44 Ga0070700_100048791 3300005441 Bacteria 2625
45 Ga0070700_100742035 3300005441 Unclassified 785
46 Ga0070678_100440512 3300005456 Bacteria 1139
47 Ga0068867_100006143 3300005459 Bacteria 8502
48 Ga0068867_100043323 3300005459 Bacteria 3295
49 Ga0068867_100267562 3300005459 Bacteria 1396
50 Ga0070679_100402528 3300005530 Bacteria 1314
51 Ga0068853_100370725 3300005539 Bacteria 1335
52 Ga0068853_100414611 3300005539 Bacteria 1262
53 Ga0068853_101780632 3300005539 Bacteria 597
54 Ga0070672_100673820 3300005543 Bacteria 904
55 Ga0070695_100884740 3300005545 Bacteria 720
56 Ga0070665_100392750 3300005548 Unclassified 1395
57 Ga0068855_100299329 3300005563 Bacteria 1782
58 Ga0068857_100206192 3300005577 Bacteria 1793
59 Ga0068857_101117143 3300005577 Bacteria 761
60 Ga0068857_101347636 3300005577 Bacteria 693
61 Ga0068856_100272697 3300005614 Bacteria 1708
62 Ga0068852_100151864 3300005616 Bacteria 2155
63 Ga0068859_100186132 3300005617 Bacteria 2160
64 Ga0068859_100271131 3300005617 Bacteria 1789
65 Ga0068859_100344471 3300005617 Bacteria 1585
66 Ga0068859_100957366 3300005617 Bacteria 939
67 Ga0068859_101009157 3300005617 Bacteria 914
68 Ga0068864_100089876 3300005618 Bacteria 2707
69 Ga0068861_100030024 3300005719 Bacteria 3982
70 Ga0068861_100266975 3300005719 Bacteria 1468
71 Ga0068861_100274084 3300005719 Bacteria 1450
72 Ga0068870_10047869 3300005840 Bacteria 2249
73 Ga0068870_10288520 3300005840 Bacteria 1031
74 Ga0068863_100202381 3300005841 Bacteria 1910
75 Ga0068858_100314669 3300005842 Bacteria 1495
76 Ga0068860_100007403 3300005843 Bacteria 10982
77 Ga0068860_100046986 3300005843 Bacteria 4115
78 Ga0068860_100125781 3300005843 Unclassified 2457
79 Ga0068860_100580325 3300005843 Bacteria 1125
80 Ga0068862_100012024 3300005844 Bacteria 7152
81 Ga0068862_100015255 3300005844 Bacteria 6381
82 Ga0068862_100199455 3300005844 Bacteria 1804
83 Ga0068862_100707873 3300005844 Bacteria 976
84 Ga0068862_101302242 3300005844 Bacteria 728
85 Ga0075366_10224811 3300006195 Bacteria 1144
86 Ga0097621_100024909 3300006237 Bacteria 4678
87 Ga0097621_100329794 3300006237 Unclassified 1353
88 Ga0068871_100004728 3300006358 Bacteria 9526
89 Ga0075428_100056157 3300006844 Bacteria 4313
90 Ga0075430_100058698 3300006846 Bacteria 3235
91 Ga0075429_100007833 3300006880 Bacteria 9278
92 Ga0068865_100207677 3300006881 Bacteria 1524
93 Ga0068865_100481834 3300006881 Bacteria 1031
94 Ga0068865_101272521 3300006881 Bacteria 653
95 Ga0097620_100186128 3300006931 Bacteria 2160
96 Ga0097620_100271109 3300006931 Bacteria 1789
97 Ga0097620_100344479 3300006931 Bacteria 1585
98 Ga0097620_100957283 3300006931 Bacteria 939
99 Ga0097620_101009076 3300006931 Bacteria 914
100 Ga0105240_10415476 3300009093 Bacteria 1513
101 Ga0111539_10024931 3300009094 Bacteria 7332
102 Ga0111539_10148781 3300009094 Bacteria 2741
103 Ga0111539_11744241 3300009094 Bacteria 722
104 Ga0105247_10001441 3300009101 Bacteria 17229
105 Ga0114129_10083808 3300009147 Bacteria 4426
106 Ga0105243_10704001 3300009148 Bacteria 985
107 Ga0105241_10002042 3300009174 Bacteria 15268
108 Ga0105242_10106055 3300009176 Unclassified 2387
109 Ga0105242_10289706 3300009176 Unclassified 1490
110 Ga0105242_11272005 3300009176 Bacteria 758
111 Ga0105242_11560584 3300009176 Unclassified 693
112 Ga0105248_10089248 3300009177 Bacteria 3470
113 Ga0105237_10200200 3300009545 Bacteria 1997
114 Ga0105249_10000816 3300009553 Bacteria 28088
115 Ga0105249_10007888 3300009553 Bacteria 9277
116 Ga0105249_10011001 3300009553 Bacteria 7950
117 Ga0105249_10015813 3300009553 Bacteria 6686
118 Ga0105249_10197506 3300009553 Bacteria 1967
119 Ga0105249_10317277 3300009553 Unclassified 1569
120 Ga0105249_12269233 3300009553 Bacteria 615
121 Ga0105239_10106480 3300010375 Bacteria 3106
122 Ga0105239_10179423 3300010375 Bacteria 2369
123 Ga0105246_10580936 3300011119 Bacteria 965
124 Ga0157373_10063517 3300013100 Bacteria 2614
125 Ga0157371_10103225 3300013102 Bacteria 2023
126 Ga0157370_10005549 3300013104 Bacteria 14145
127 Ga0157369_10048639 3300013105 Bacteria 4601
128 Ga0157378_10353885 3300013297 Bacteria 1435
129 Ga0157378_10450569 3300013297 Unclassified 1277
130 Ga0157378_10549528 3300013297 Bacteria 1160
131 Ga0163162_10003143 3300013306 Bacteria 15770
132 Ga0163162_10008479 3300013306 Bacteria 10029
133 Ga0163162_10054675 3300013306 Bacteria 4016
134 Ga0163162_10213033 3300013306 Unclassified 2062
135 Ga0163162_10586465 3300013306 Bacteria 1241
136 Ga0163162_10903221 3300013306 Bacteria 996
137 Ga0163162_11421771 3300013306 Bacteria 789
138 Ga0157372_10815115 3300013307 Bacteria 1084
139 Ga0157375_10005625 3300013308 Bacteria 10911
140 Ga0157375_12290666 3300013308 Bacteria 644
141 Ga0163163_10001087 3300014325 Bacteria 23055
142 Ga0163163_10074899 3300014325 Bacteria 3378
143 Ga0163163_10157434 3300014325 Unclassified 2316
144 Ga0163163_10528251 3300014325 Bacteria 1242
145 Ga0157380_10014572 3300014326 Bacteria 5755
146 Ga0157377_10007096 3300014745 Bacteria 5385
147 Ga0157379_10008567 3300014968 Bacteria 8899
148 Ga0157379_10440007 3300014968 Bacteria 1202
149 Ga0157376_10920109 3300014969 Bacteria 893
150 Ga0163161_10022285 3300017792 Bacteria 4459
151 Ga0163161_10079823 3300017792 Bacteria 2407
152 Ga0163161_10305140 3300017792 Bacteria 1255
153 Ga0207697_10012652 3300025315 Bacteria 3533
154 Ga0207682_10199906 3300025893 Bacteria 919
155 Ga0207710_10000326 3300025900 Bacteria 36470
156 Ga0207645_10019622 3300025907 Bacteria 4431
157 Ga0207645_10083393 3300025907 Unclassified 2050
158 Ga0207645_10803787 3300025907 Bacteria 639
159 Ga0207643_10055382 3300025908 Unclassified 2255
160 Ga0207695_10321949 3300025913 Bacteria 1436
161 Ga0207671_10187204 3300025914 Bacteria 1613
162 Ga0207662_10159134 3300025918 Bacteria 1442
163 Ga0207652_10184201 3300025921 Bacteria 1877
164 Ga0207681_10065146 3300025923 Bacteria 2518
165 Ga0207681_10314281 3300025923 Unclassified 1243
166 Ga0207650_10077274 3300025925 Bacteria 2516
167 Ga0207650_10099479 3300025925 Bacteria 2236
168 Ga0207659_10024161 3300025926 Bacteria 4068
169 Ga0207644_11136433 3300025931 Bacteria 656
170 Ga0207706_10041716 3300025933 Bacteria 4067
171 Ga0207686_10030658 3300025934 Unclassified 3186
172 Ga0207686_10419415 3300025934 Bacteria 1023
173 Ga0207670_10252313 3300025936 Bacteria 1364
174 Ga0207669_10020947 3300025937 Unclassified 3440
175 Ga0207704_10062070 3300025938 Unclassified 2322
176 Ga0207704_10432593 3300025938 Bacteria 1046
177 Ga0207691_10047036 3300025940 Bacteria 3962
178 Ga0207691_11072408 3300025940 Bacteria 671
179 Ga0207689_10028252 3300025942 Bacteria 4692
180 Ga0207689_10130462 3300025942 Bacteria 2069
181 Ga0207689_10140615 3300025942 Unclassified 1988
182 Ga0207661_10409555 3300025944 Bacteria 1230
183 Ga0207667_10113880 3300025949 Bacteria 2788
184 Ga0207651_10020295 3300025960 Bacteria 4008
185 Ga0207651_10386644 3300025960 Bacteria 1187
186 Ga0207651_11570763 3300025960 Bacteria 593
187 Ga0207712_10000626 3300025961 Bacteria 27964
188 Ga0207712_10027326 3300025961 Unclassified 3809
189 Ga0207712_10040570 3300025961 Bacteria 3196
190 Ga0207712_10091571 3300025961 Bacteria 2240
191 Ga0207668_10047520 3300025972 Unclassified 2939
192 Ga0207668_10253995 3300025972 Unclassified 1429
193 Ga0207668_11539361 3300025972 Bacteria 600
194 Ga0207640_10066520 3300025981 Bacteria 2408
195 Ga0207640_10262984 3300025981 Bacteria 1346
196 Ga0207640_10896211 3300025981 Bacteria 774
197 Ga0207658_10226638 3300025986 Bacteria 1575
198 Ga0207658_10254376 3300025986 Bacteria 1494
199 Ga0207658_11014627 3300025986 Bacteria 757
200 Ga0207639_10331954 3300026041 Bacteria 1353
201 Ga0207639_10786960 3300026041 Bacteria 886
202 Ga0207678_11413905 3300026067 Unclassified 615
203 Ga0207708_10075985 3300026075 Bacteria 2576
204 Ga0207708_10113919 3300026075 Bacteria 2102
205 Ga0207708_10855153 3300026075 Unclassified 785
206 Ga0207702_10319050 3300026078 Bacteria 1479
207 Ga0207641_10048640 3300026088 Bacteria 3580
208 Ga0207648_10032732 3300026089 Bacteria 4587
209 Ga0207648_10037211 3300026089 Bacteria 4286
210 Ga0207648_10055001 3300026089 Bacteria 3475
211 Ga0207648_10189509 3300026089 Bacteria 1822
212 Ga0207676_10038271 3300026095 Bacteria 3659
213 Ga0207674_10011558 3300026116 Bacteria 9916
214 Ga0207674_10101186 3300026116 Unclassified 2863
215 Ga0207674_10107625 3300026116 Bacteria 2765
216 Ga0207674_10120784 3300026116 Bacteria 2588
217 Ga0207674_10321586 3300026116 Bacteria 1496
218 Ga0207675_100000971 3300026118 Bacteria 28493
219 Ga0207675_100005986 3300026118 Bacteria 11578
220 Ga0207675_100165688 3300026118 Bacteria 2110
221 Ga0207675_100193084 3300026118 Bacteria 1954
222 Ga0207675_101400418 3300026118 Bacteria 720
223 Ga0207683_10227300 3300026121 Bacteria 1701
224 Ga0207698_10479041 3300026142 Bacteria 1207
225 Ga0207428_10062418 3300027907 Bacteria 2946
226 Ga0207428_10170885 3300027907 Bacteria 1646
227 Ga0268266_10904009 3300028379 Bacteria 854
228 Ga0268265_10012647 3300028380 Bacteria 5725
229 Ga0268265_10078621 3300028380 Unclassified 2595
230 Ga0268265_10089265 3300028380 Unclassified 2458
231 Ga0268265_10130695 3300028380 Bacteria 2086
232 Ga0268265_10648099 3300028380 Bacteria 1015
233 Ga0268264_10077229 3300028381 Bacteria 2836
234 Ga0268264_10645259 3300028381 Bacteria 1047
235 Ga0268264_10687371 3300028381 Bacteria 1015
236 Ga0307516_10085925 3300031730 Bacteria 2983
237 Ga0307409_101423720 3300031995 Bacteria 720
238 Ga0307414_10876357 3300032004 Bacteria 822
239 Ga0395899_0836107 3300037312 Unclassified 566
240 Ga0395900_0137552 3300037418 Bacteria 2503
241 Ga0395898_1247597 3300037466 Unclassified 674
242 Ga0395901_0540532 3300038443 Bacteria 1182
243 Ga0439439_0014091 3300041406 Bacteria 1944
244 Ga0439453_0053464 3300041408 Bacteria 821
245 Ga0439465_0042844 3300041413 Bacteria 1468
246 Ga0451798_0012509 3300041458 Unclassified 2106
247 Ga0451849_1558981 3300041505 Bacteria 632
248 Ga0451843_0775004 3300041509 Bacteria 2079
249 Ga0439441_013234 3300042001 Bacteria 1429
250 Ga0450897_001202 3300042128 Bacteria 1706
251 Ga0450894_007145 3300042131 Bacteria 1440
252 Ga0450898_005998 3300042134 Bacteria 1854
253 Ga0450899_004045 3300042135 Bacteria 1570
254 Ga0439434_0018942 3300042435 Bacteria 2063
255 Ga0439444_0079457 3300042437 Bacteria 715
256 Ga0453684_0129872 3300044712 Bacteria 3025
257 Ga0453684_0206248 3300044712 Bacteria 2287
258 Ga0495638_0313719 3300046460 Bacteria 840
259 Ga0495638_0422909 3300046460 Unclassified 686
260 Ga0495633_0082925 3300046558 Bacteria 1492
261 Ga0495625_0027314 3300046660 Bacteria 4299
262 Ga0495636_0294087 3300047318 Bacteria 759
263 Ga0495672_0062244 3300047320 Bacteria 2147
264 Ga0495672_0323581 3300047320 Unclassified 723
265 Ga0495672_0487136 3300047320 Unclassified 550
266 Ga0496100_0636871 3300048903 Bacteria 829
267 Ga0496101_0472126 3300048904 Bacteria 990
268 Ga0496102_0233202 3300048905 Bacteria 1735
269 Ga0496104_0683886 3300048907 Bacteria 934
270 Ga0496110_0568391 3300048913 Bacteria 1030
271 Ga0501083_0331195 3300049744 Bacteria 990
272 nmdc:mga0k408_29953_c1 3300050493 Unclassified 3101
273 nmdc:mga0k408_50035_c1 3300050493 Bacteria 2419
274 nmdc:mga05p37_42575_c1 3300050507 Bacteria 5580
275 nmdc:mga09592_130837_c1 3300050508 Bacteria 2159
276 nmdc:mga09592_4183_c1 3300050508 Bacteria 11657
277 nmdc:mga0qj67_50886_c1 3300050509 Bacteria 3275
278 nmdc:mga08y16_6499_c1 3300050511 Bacteria 12256
279 Ga0500568_0000224 3300053139 Bacteria 48575
280 Ga0500588_0007438 3300053146 Unclassified 2526
281 Ga0500611_000001 3300053727 Bacteria 385744
282 Ga0068853_100023210
283 JGI24744J21845_10040363
284 rootH2_10311920
285 rootL2_10051861
286 rootL2_10309718
287 Ga0065712_10017913
288 Ga0065715_10131423
289 Ga0070676_10103215
290 Ga0070676_11006582
291 Ga0070683_100455042
292 Ga0070690_100067926
293 Ga0070690_100754358
294 Ga0070670_100029758
295 Ga0070670_100123344
296 Ga0070670_100944059
297 Ga0068869_100066213
298 Ga0068869_100171348
299 Ga0068869_100255285
300 Ga0068869_101205296
301 Ga0070680_100119428
302 Ga0070682_100696113
303 Ga0068868_100141948
304 Ga0068868_100462416
305 Ga0070689_101493074
306 Ga0070687_100035571
307 Ga0070687_100048473
308 Ga0070687_100054536
309 Ga0070687_100453089
310 Ga0070661_100478437
311 Ga0070661_101046429
312 Ga0070668_100009511
313 Ga0070668_100066280
314 Ga0070668_100248212
315 Ga0070669_100006379
316 Ga0070675_100016567
317 Ga0070674_100005144
318 Ga0070673_100004720
319 Ga0070673_101240390
320 Ga0070673_101464678
321 Ga0070688_100004858
322 Ga0070667_100144457
323 Ga0070667_101065099
324 Ga0070711_100739816
325 Ga0070700_100048791
326 Ga0070700_100742035
327 Ga0070678_100440512
328 Ga0068867_100006143
329 Ga0068867_100043323
330 Ga0068867_100267562
331 Ga0070679_100402528
332 Ga0068853_100370725
333 Ga0068853_100414611
334 Ga0068853_101780632
335 Ga0070672_100673820
336 Ga0070695_100884740
337 Ga0070665_100392750
338 Ga0068855_100299329
339 Ga0068857_100206192
340 Ga0068857_101117143
341 Ga0068857_101347636
342 Ga0068856_100272697
343 Ga0068852_100151864
344 Ga0068859_100186132
345 Ga0068859_100271131
346 Ga0068859_100344471
347 Ga0068859_100957366
348 Ga0068859_101009157
349 Ga0068864_100089876
350 Ga0068861_100030024
351 Ga0068861_100266975
352 Ga0068861_100274084
353 Ga0068870_10047869
354 Ga0068870_10288520
355 Ga0068863_100202381
356 Ga0068858_100314669
357 Ga0068860_100007403
358 Ga0068860_100046986
359 Ga0068860_100125781
360 Ga0068860_100580325
361 Ga0068862_100012024
362 Ga0068862_100015255
363 Ga0068862_100199455
364 Ga0068862_100707873
365 Ga0068862_101302242
366 Ga0075366_10224811
367 Ga0097621_100024909
368 Ga0097621_100329794
369 Ga0068871_100004728
370 Ga0075428_100056157
371 Ga0075430_100058698
372 Ga0075429_100007833
373 Ga0068865_100207677
374 Ga0068865_100481834
375 Ga0068865_101272521
376 Ga0097620_100186128
377 Ga0097620_100271109
378 Ga0097620_100344479
379 Ga0097620_100957283
380 Ga0097620_101009076
381 Ga0105240_10415476
382 Ga0111539_10024931
383 Ga0111539_10148781
384 Ga0111539_11744241
385 Ga0105247_10001441
386 Ga0114129_10083808
387 Ga0105243_10704001
388 Ga0105241_10002042
389 Ga0105242_10106055
390 Ga0105242_10289706
391 Ga0105242_11272005
392 Ga0105242_11560584
393 Ga0105248_10089248
394 Ga0105237_10200200
395 Ga0105249_10000816
396 Ga0105249_10007888
397 Ga0105249_10011001
398 Ga0105249_10015813
399 Ga0105249_10197506
400 Ga0105249_10317277
401 Ga0105249_12269233
402 Ga0105239_10106480
403 Ga0105239_10179423
404 Ga0105246_10580936
405 Ga0157373_10063517
406 Ga0157371_10103225
407 Ga0157370_10005549
408 Ga0157369_10048639
409 Ga0157378_10353885
410 Ga0157378_10450569
411 Ga0157378_10549528
412 Ga0163162_10003143
413 Ga0163162_10008479
414 Ga0163162_10054675
415 Ga0163162_10213033
416 Ga0163162_10586465
417 Ga0163162_10903221
418 Ga0163162_11421771
419 Ga0157372_10815115
420 Ga0157375_10005625
421 Ga0157375_12290666
422 Ga0163163_10001087
423 Ga0163163_10074899
424 Ga0163163_10157434
425 Ga0163163_10528251
426 Ga0157380_10014572
427 Ga0157377_10007096
428 Ga0157379_10008567
429 Ga0157379_10440007
430 Ga0157376_10920109
431 Ga0163161_10022285
432 Ga0163161_10079823
433 Ga0163161_10305140
434 Ga0207697_10012652
435 Ga0207682_10199906
436 Ga0207710_10000326
437 Ga0207645_10019622
438 Ga0207645_10083393
439 Ga0207645_10803787
440 Ga0207643_10055382
441 Ga0207695_10321949
442 Ga0207671_10187204
443 Ga0207662_10159134
444 Ga0207652_10184201
445 Ga0207681_10065146
446 Ga0207681_10314281
447 Ga0207650_10077274
448 Ga0207650_10099479
449 Ga0207659_10024161
450 Ga0207644_11136433
451 Ga0207706_10041716
452 Ga0207686_10030658
453 Ga0207686_10419415
454 Ga0207670_10252313
455 Ga0207669_10020947
456 Ga0207704_10062070
457 Ga0207704_10432593
458 Ga0207691_10047036
459 Ga0207691_11072408
460 Ga0207689_10028252
461 Ga0207689_10130462
462 Ga0207689_10140615
463 Ga0207661_10409555
464 Ga0207667_10113880
465 Ga0207651_10020295
466 Ga0207651_10386644
467 Ga0207651_11570763
468 Ga0207712_10000626
469 Ga0207712_10027326
470 Ga0207712_10040570
471 Ga0207712_10091571
472 Ga0207668_10047520
473 Ga0207668_10253995
474 Ga0207668_11539361
475 Ga0207640_10066520
476 Ga0207640_10262984
477 Ga0207640_10896211
478 Ga0207658_10226638
479 Ga0207658_10254376
480 Ga0207658_11014627
481 Ga0207639_10331954
482 Ga0207639_10786960
483 Ga0207678_11413905
484 Ga0207708_10075985
485 Ga0207708_10113919
486 Ga0207708_10855153
487 Ga0207702_10319050
488 Ga0207641_10048640
489 Ga0207648_10032732
490 Ga0207648_10037211
491 Ga0207648_10055001
492 Ga0207648_10189509
493 Ga0207676_10038271
494 Ga0207674_10011558
495 Ga0207674_10101186
496 Ga0207674_10107625
497 Ga0207674_10120784
498 Ga0207674_10321586
499 Ga0207675_100000971
500 Ga0207675_100005986
501 Ga0207675_100165688
502 Ga0207675_100193084
503 Ga0207675_101400418
504 Ga0207683_10227300
505 Ga0207698_10479041
506 Ga0207428_10062418
507 Ga0207428_10170885
508 Ga0268266_10904009
509 Ga0268265_10012647
510 Ga0268265_10078621
511 Ga0268265_10089265
512 Ga0268265_10130695
513 Ga0268265_10648099
514 Ga0268264_10077229
515 Ga0268264_10645259
516 Ga0268264_10687371
517 Ga0307516_10085925
518 Ga0307409_101423720
519 Ga0307414_10876357
520 Ga0395899_0836107
521 Ga0395900_0137552
522 Ga0395898_1247597
523 Ga0395901_0540532
524 Ga0439439_0014091
525 Ga0439453_0053464
526 Ga0439465_0042844
527 Ga0451798_0012509
528 Ga0451849_1558981
529 Ga0451843_0775004
530 Ga0439441_013234
531 Ga0450897_001202
532 Ga0450894_007145
533 Ga0450898_005998
534 Ga0450899_004045
535 Ga0439434_0018942
536 Ga0439444_0079457
537 Ga0453684_0129872
538 Ga0453684_0206248
539 Ga0495638_0313719
540 Ga0495638_0422909
541 Ga0495633_0082925
542 Ga0495625_0027314
543 Ga0495636_0294087
544 Ga0495672_0062244
545 Ga0495672_0323581
546 Ga0495672_0487136
547 Ga0496100_0636871
548 Ga0496101_0472126
549 Ga0496102_0233202
550 Ga0496104_0683886
551 Ga0496110_0568391
552 Ga0501083_0331195
553 nmdc:mga0k408_29953_c1
554 nmdc:mga0k408_50035_c1
555 nmdc:mga05p37_42575_c1
556 nmdc:mga09592_130837_c1
557 nmdc:mga09592_4183_c1
558 nmdc:mga0qj67_50886_c1
559 nmdc:mga08y16_6499_c1
560 Ga0500568_0000224
561 Ga0500588_0007438
562 Ga0500611_000001

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

35

177

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.6503 3 158
2f22-assembly1.cif.gz_A crystal structure of a putative dna damage-inducable (dinb) protein (bh3987) from bacillus halodurans at 1.42 a resolution 0.6284 1 152
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.6241 3 158
2hkv-assembly1.cif.gz_A-2 crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution 0.5956 3 152
2nsg-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase h52a mutant 0.5937 4 153
ID Description Score Start End Superfamily
af_P9WM91_7_150_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7004 4 152 1.20.120.450
af_P9WM91_7_150_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6707 4 152 1.20.120.450
af_O07256_17_140_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6651 6 153 1.20.120.450
af_O07256_17_140_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6567 6 153 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6503 3 158 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A1T4MGI7-F1-model_v4 DinB-like domain-containing protein 0.9842 1 154
AF-A0A3C1R6Z3-F1-model_v4 deleted 0.9819 1 156
AF-A0A3C1T5Z6-F1-model_v4 DUF1569 domain-containing protein 0.9818 1 154
AF-A0A4Q5V3S3-F1-model_v4 DUF1569 domain-containing protein 0.9793 3 156
AF-A0A537I2X6-F1-model_v4 DUF1569 domain-containing protein 0.9786 1 153

Map