F384165

General Info

Members Datasets Scaffolds Average Seq Length
281 172 552 318

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100000817|Ga0068855_10000081731
Length 378
Sequence MRTPLSGPEVCGASGEGQAVVGSVTGESILGSANFSGDFARADAVTLQATKSTNRMEELPMASRHLVDPDFLHLLDALPTFDLTAEALPQIRAGLAERAASLAPEPDDSVTVTEQVVPGRDGKPDVRVMVYRPADAVGELPAMLHLHPGGFIMGGPFMRDPRNRYLAKAVGCVIVSVVYRLAPEHPYPAALEDAYTALTWLHAEGATIGADTTRIAISGDSAGGGLAAALAQMAHDKGEVPILFQALTYPMLDNRSGATVDRGAFVGQYMWSADANRFAWQALLGENHHEQDQPPYAVPAHRADLAGLPPTFIAVGALDLFVEEDIDYARRLIHAGVPTELHVYPGAFHGFDSTPQAWSTENYVAQLVSSLKRALHPR

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
53 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
82 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
83 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
84 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
85 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
86 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
87 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
88 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
89 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
90 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
91 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
92 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
93 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
94 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
95 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
96 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
97 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
98 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
99 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
100 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
116 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
117 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
118 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
119 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
120 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
121 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
122 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
123 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
124 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
125 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
139 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
140 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
141 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
142 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
148 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
149 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
150 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
151 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
152 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
153 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
154 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
155 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
156 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
157 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
158 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
159 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
160 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
161 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
162 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
163 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
164 2558860280 Kutzneria sp. 744 Isolate Unclassified
165 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
166 2619618881 Frankia sp. ACN1ag Isolate Unclassified
167 2619619003 Frankia sp. CpI1-P Isolate Nodule
168 2626541554 Frankia sp. AvcI.1 Isolate Nodule
169 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
170 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
171 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
172 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.44
Metatranscriptomes 0
Isolates 3.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.39
Nodule 1.42
Rhizoplane 10.68
Rhizosphere 58.72
Stem 0
Stem Tuber 0
Unclassified 1.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100000817 3300005563 Bacteria 38486
2 SwRhRL2b_contig_234738 2162886007 Bacteria 74037
3 SwRhRL2b_contig_3367114 2162886007 Bacteria 9630
4 JGI24751J29686_10000187 3300002459 Bacteria 27852
5 JGI25165J46597_1000156 3300003214 Bacteria 109696
6 rootH2_10332287 3300003320 Bacteria 1186
7 rootL2_10213738 3300003322 Unclassified 1521
8 Ga0055530_10009530 3300003791 Bacteria 3716
9 Ga0065704_10000463 3300005289 Bacteria 20938
10 Ga0065704_10006773 3300005289 Bacteria 2650
11 Ga0065704_10070166 3300005289 Bacteria 176609
12 Ga0065707_10085431 3300005295 Bacteria 6158
13 Ga0070658_10268611 3300005327 Bacteria 1450
14 Ga0070690_100182562 3300005330 Bacteria 1450
15 Ga0070670_100077040 3300005331 Bacteria 2865
16 Ga0070670_100515011 3300005331 Bacteria 1065
17 Ga0070666_10069937 3300005335 Bacteria 2387
18 Ga0070689_100079093 3300005340 Bacteria 2578
19 Ga0070689_100247180 3300005340 Bacteria 1471
20 Ga0070668_100016713 3300005347 Bacteria 5484
21 Ga0070668_100166412 3300005347 Bacteria 1792
22 Ga0070668_100284109 3300005347 Bacteria 1383
23 Ga0070669_100081454 3300005353 Bacteria 2411
24 Ga0070669_100242217 3300005353 Bacteria 1433
25 Ga0070671_100000062 3300005355 Bacteria 73417
26 Ga0070671_100010782 3300005355 Bacteria 7332
27 Ga0070671_100029082 3300005355 Bacteria 4556
28 Ga0070671_100039242 3300005355 Bacteria 3930
29 Ga0070667_100050003 3300005367 Bacteria 3521
30 Ga0070713_100212312 3300005436 Bacteria 1753
31 Ga0070679_100105262 3300005530 Bacteria 2808
32 Ga0068853_100147278 3300005539 Bacteria 2117
33 Ga0070665_100065700 3300005548 Bacteria 3638
34 Ga0070665_100070755 3300005548 Bacteria 3495
35 Ga0068855_100000641 3300005563 Bacteria 42804
36 Ga0068855_100010641 3300005563 Bacteria 11095
37 Ga0068855_100011732 3300005563 Bacteria 10593
38 Ga0068855_100268613 3300005563 Bacteria 1897
39 Ga0068856_100095624 3300005614 Bacteria 2959
40 Ga0068852_100194111 3300005616 Bacteria 1918
41 Ga0068852_100215299 3300005616 Bacteria 1825
42 Ga0068864_100000038 3300005618 Bacteria 181005
43 Ga0068864_100019822 3300005618 Bacteria 5623
44 Ga0068863_100000026 3300005841 Bacteria 185590
45 Ga0068863_100059417 3300005841 Bacteria 3617
46 Ga0068863_100098737 3300005841 Bacteria 2773
47 Ga0068858_100000810 3300005842 Bacteria 32726
48 Ga0068858_100005132 3300005842 Bacteria 12834
49 Ga0068858_100027759 3300005842 Bacteria 5259
50 Ga0068858_100036171 3300005842 Bacteria 4578
51 Ga0068860_100051995 3300005843 Bacteria 3897
52 Ga0068862_100373689 3300005844 Bacteria 1328
53 Ga0081455_10000940 3300005937 Bacteria 37224
54 Ga0081455_10045432 3300005937 Bacteria 3821
55 Ga0081539_10068716 3300005985 Unclassified 1910
56 Ga0075365_10036281 3300006038 Bacteria 3194
57 Ga0075368_10000249 3300006042 Bacteria 15296
58 Ga0075363_100000182 3300006048 Bacteria 16597
59 Ga0075367_10000340 3300006178 Bacteria 16605
60 Ga0075367_10000393 3300006178 Bacteria 15951
61 Ga0075369_10022869 3300006186 Bacteria 2580
62 Ga0097621_100266543 3300006237 Bacteria 1504
63 Ga0075370_10007210 3300006353 Bacteria 5651
64 Ga0075370_10040023 3300006353 Bacteria 2643
65 Ga0105250_10000013 3300009092 Bacteria 271050
66 Ga0105240_10045833 3300009093 Bacteria 5545
67 Ga0105240_10090728 3300009093 Bacteria 3734
68 Ga0105247_10034056 3300009101 Bacteria 3102
69 Ga0105248_10002260 3300009177 Bacteria 21349
70 Ga0105248_10003031 3300009177 Bacteria 18634
71 Ga0105248_10147746 3300009177 Bacteria 2652
72 Ga0105248_10300851 3300009177 Bacteria 1806
73 Ga0105238_10011940 3300009551 Bacteria 8752
74 Ga0105249_10029794 3300009553 Bacteria 4931
75 Ga0105148_100205 3300009978 Bacteria 8684
76 Ga0105239_10050474 3300010375 Bacteria 4563
77 Ga0163162_10072546 3300013306 Bacteria 3498
78 Ga0157380_10054402 3300014326 Bacteria 3176
79 Ga0157380_10133899 3300014326 Bacteria 2118
80 Ga0157379_10001585 3300014968 Bacteria 18743
81 Ga0163161_10001170 3300017792 Bacteria 19695
82 Ga0163161_10111447 3300017792 Bacteria 2046
83 Ga0213875_10000135 3300021388 Bacteria 82147
84 Ga0209233_1000213 3300025261 Bacteria 109881
85 Ga0209050_1000504 3300025298 Bacteria 66436
86 Ga0207426_1000662 3300025302 Bacteria 42226
87 Ga0207696_1000072 3300025711 Bacteria 224214
88 Ga0207710_10061345 3300025900 Bacteria 1706
89 Ga0207695_10007037 3300025913 Bacteria 14434
90 Ga0207695_10032422 3300025913 Bacteria 5716
91 Ga0207652_10118164 3300025921 Bacteria 2356
92 Ga0207681_10000536 3300025923 Bacteria 26182
93 Ga0207650_10061349 3300025925 Bacteria 2807
94 Ga0207650_10243520 3300025925 Bacteria 1454
95 Ga0207644_10000005 3300025931 Bacteria 441948
96 Ga0207670_10195781 3300025936 Bacteria 1532
97 Ga0207711_10005039 3300025941 Bacteria 11200
98 Ga0207711_10014022 3300025941 Bacteria 6658
99 Ga0207711_10329591 3300025941 Bacteria 1412
100 Ga0207667_10005169 3300025949 Bacteria 15940
101 Ga0207667_10010733 3300025949 Bacteria 10684
102 Ga0207667_10023972 3300025949 Bacteria 6712
103 Ga0207667_10061578 3300025949 Unclassified 3925
104 Ga0207667_10138130 3300025949 Bacteria 2510
105 Ga0207668_10093632 3300025972 Bacteria 2214
106 Ga0207658_10026751 3300025986 Bacteria 4048
107 Ga0207703_10000716 3300026035 Bacteria 32692
108 Ga0207703_10002633 3300026035 Bacteria 15470
109 Ga0207703_10026177 3300026035 Bacteria 4590
110 Ga0207703_10041481 3300026035 Bacteria 3687
111 Ga0207639_10092888 3300026041 Bacteria 2419
112 Ga0207641_10000005 3300026088 Bacteria 470841
113 Ga0207676_10000049 3300026095 Bacteria 133695
114 Ga0207676_10051897 3300026095 Bacteria 3204
115 Ga0207676_10112038 3300026095 Bacteria 2285
116 Ga0207698_10399858 3300026142 Bacteria 1312
117 Ga0209813_10000010 3300027866 Bacteria 97592
118 Ga0268266_10104399 3300028379 Bacteria 2502
119 Ga0268266_10349593 3300028379 Bacteria 1389
120 Ga0307515_10077088 3300028794 Bacteria 4408
121 Ga0265338_10043148 3300028800 Bacteria 4188
122 Ga0265320_10105423 3300031240 Bacteria 1296
123 Ga0265327_10056034 3300031251 Bacteria 2033
124 Ga0307513_10063950 3300031456 Bacteria 3881
125 Ga0307413_10014037 3300031824 Bacteria 4052
126 Ga0307415_100288159 3300032126 Bacteria 1354
127 Ga0307510_10032242 3300033180 Bacteria 5904
128 Ga0373956_0004876 3300035119 Bacteria 5372
129 Ga0373931_0000027 3300035691 Bacteria 123672
130 Ga0436364_0567527 3300037853 Bacteria 8075
131 Ga0436364_1211536 3300037853 Bacteria 67143
132 Ga0400483_160331 3300039062 Bacteria 13915
133 Ga0495638_0091590 3300046460 Bacteria 1831
134 Ga0495650_0000163 3300046471 Bacteria 148569
135 Ga0495583_0000333 3300046506 Bacteria 74698
136 Ga0495583_0021131 3300046506 Bacteria 3353
137 Ga0495610_0021165 3300046512 Bacteria 3583
138 Ga0495654_0034413 3300046530 Bacteria 2556
139 Ga0495633_0048417 3300046558 Bacteria 2007
140 Ga0495668_0018295 3300046616 Bacteria 4049
141 Ga0495625_0011794 3300046660 Bacteria 7100
142 Ga0495588_0198947 3300046674 Bacteria 1058
143 Ga0495600_0010175 3300046809 Bacteria 5828
144 Ga0495675_0016538 3300047444 Bacteria 4666
145 Ga0495677_0003835 3300047445 Bacteria 5819
146 Ga0495677_0007508 3300047445 Bacteria 4070
147 Ga0495686_0044355 3300047472 Bacteria 2816
148 Ga0496100_0129876 3300048903 Bacteria 1773
149 Ga0496101_0018259 3300048904 Bacteria 4767
150 Ga0496102_0000178 3300048905 Bacteria 86174
151 Ga0496103_0000119 3300048906 Bacteria 86194
152 Ga0496103_0040875 3300048906 Bacteria 2850
153 Ga0496104_0004286 3300048907 Bacteria 12405
154 Ga0496105_0059230 3300048908 Bacteria 3160
155 Ga0496105_0070685 3300048908 Bacteria 2885
156 Ga0496106_0003563 3300048909 Bacteria 11595
157 Ga0496107_0013029 3300048910 Bacteria 5808
158 Ga0496108_0004245 3300048911 Bacteria 11539
159 Ga0496108_0029161 3300048911 Bacteria 4569
160 Ga0496108_0224600 3300048911 Bacteria 1632
161 Ga0496108_0302879 3300048911 Bacteria 1392
162 Ga0496109_0036486 3300048912 Bacteria 4437
163 Ga0496109_0200628 3300048912 Bacteria 1875
164 Ga0496110_0007686 3300048913 Bacteria 8626
165 Ga0496110_0041772 3300048913 Bacteria 4002
166 Ga0496110_0111835 3300048913 Bacteria 2455
167 Ga0496110_0313509 3300048913 Bacteria 1428
168 Ga0496111_0008169 3300048914 Bacteria 6917
169 Ga0496111_0051398 3300048914 Bacteria 2975
170 Ga0496111_0094780 3300048914 Bacteria 2189
171 Ga0496112_0171992 3300048915 Bacteria 2131
172 Ga0496113_0001455 3300048916 Bacteria 13176
173 Ga0496113_0050349 3300048916 Bacteria 3105
174 Ga0496114_0006234 3300048917 Bacteria 9386
175 Ga0496114_0095000 3300048917 Bacteria 2536
176 Ga0496115_0000740 3300048918 Bacteria 24162
177 Ga0496116_0019188 3300048919 Bacteria 5242
178 Ga0496116_0033723 3300048919 Bacteria 3627
179 Ga0496116_0084807 3300048919 Bacteria 1950
180 Ga0496117_0000318 3300048920 Bacteria 84351
181 Ga0496117_0005453 3300048920 Bacteria 13347
182 Ga0496117_0174822 3300048920 Bacteria 1242
183 Ga0496118_0000186 3300048921 Bacteria 108940
184 Ga0496118_0028402 3300048921 Bacteria 4711
185 Ga0496119_0000399 3300048922 Bacteria 59637
186 Ga0496119_0055946 3300048922 Bacteria 2393
187 Ga0496120_0000074 3300048923 Bacteria 164098
188 Ga0496120_0044122 3300048923 Bacteria 2592
189 Ga0496121_0001102 3300048924 Bacteria 47573
190 Ga0496121_0018638 3300048924 Bacteria 6987
191 Ga0496121_0031716 3300048924 Bacteria 4821
192 Ga0496122_0003669 3300048925 Bacteria 19924
193 Ga0496122_0013754 3300048925 Bacteria 7890
194 Ga0496122_0051456 3300048925 Bacteria 3129
195 Ga0496122_0085235 3300048925 Bacteria 2181
196 Ga0496122_0152790 3300048925 Bacteria 1422
197 Ga0496123_0002385 3300048926 Bacteria 23545
198 Ga0496123_0008795 3300048926 Bacteria 9207
199 Ga0496124_0000324 3300048927 Bacteria 88327
200 Ga0496124_0001086 3300048927 Bacteria 42885
201 Ga0496124_0013882 3300048927 Bacteria 7832
202 Ga0496124_0039358 3300048927 Bacteria 4099
203 Ga0496125_0001890 3300048928 Bacteria 28768
204 Ga0496125_0006075 3300048928 Bacteria 13184
205 Ga0496125_0008335 3300048928 Bacteria 10874
206 Ga0496125_0031545 3300048928 Bacteria 4721
207 Ga0496125_0040990 3300048928 Bacteria 3964
208 Ga0496126_0000452 3300048929 Bacteria 81928
209 Ga0496126_0001180 3300048929 Bacteria 42930
210 Ga0496126_0003102 3300048929 Bacteria 21478
211 Ga0496126_0016407 3300048929 Bacteria 7408
212 Ga0496126_0026416 3300048929 Bacteria 5568
213 Ga0496126_0039241 3300048929 Bacteria 4396
214 Ga0501032_0004258 3300049569 Bacteria 10810
215 Ga0501032_0024560 3300049569 Bacteria 4159
216 Ga0501033_0050063 3300049570 Bacteria 3100
217 Ga0501034_0075082 3300049571 Bacteria 3388
218 Ga0501036_0004817 3300049572 Bacteria 10909
219 Ga0501036_0389430 3300049572 Bacteria 1163
220 Ga0501037_0053035 3300049573 Bacteria 2965
221 Ga0501038_0121215 3300049574 Bacteria 2156
222 Ga0501039_0131489 3300049575 Bacteria 1964
223 Ga0501043_0030086 3300049579 Bacteria 4265
224 Ga0501047_0004550 3300049581 Bacteria 13042
225 Ga0501047_0052601 3300049581 Bacteria 3936
226 Ga0501047_0062301 3300049581 Bacteria 3598
227 Ga0501070_0011365 3300049586 Bacteria 7524
228 Ga0501070_0038855 3300049586 Bacteria 3971
229 Ga0501070_0086596 3300049586 Bacteria 2593
230 Ga0501073_0160112 3300049589 Bacteria 1560
231 Ga0501074_0084724 3300049590 Bacteria 2272
232 Ga0501223_000024 3300049663 Bacteria 59339
233 Ga0501223_000031 3300049663 Bacteria 51024
234 Ga0501224_000001 3300049664 Bacteria 308131
235 Ga0501233_000788 3300049668 Bacteria 5299
236 Ga0501235_000599 3300049669 Bacteria 7271
237 Ga0501235_000931 3300049669 Bacteria 6044
238 Ga0501225_0000093 3300049705 Bacteria 28572
239 Ga0501225_0000504 3300049705 Bacteria 12155
240 Ga0501225_0006237 3300049705 Bacteria 3484
241 Ga0501080_0070930 3300049742 Bacteria 3240
242 Ga0501035_0003631 3300049822 Bacteria 14718
243 Ga0501035_0027264 3300049822 Bacteria 5221
244 Ga0501044_0006132 3300049823 Bacteria 13272
245 Ga0501044_0006969 3300049823 Bacteria 12433
246 Ga0501044_0049082 3300049823 Bacteria 4356
247 Ga0501045_0082533 3300049824 Bacteria 2370
248 Ga0501226_000029 3300049853 Bacteria 82723
249 nmdc:mga03n38_1453_c1 3300050490 Bacteria 6800
250 nmdc:mga0yw44_9309_c1 3300050492 Bacteria 4955
251 nmdc:mga06z11_68_c1 3300050494 Bacteria 42759
252 nmdc:mga06z11_83528_c1 3300050494 Bacteria 1719
253 nmdc:mga04h51_36_c1 3300050495 Bacteria 45993
254 nmdc:mga07m45_3125_c1 3300050496 Bacteria 7932
255 nmdc:mga07m45_37867_c1 3300050496 Bacteria 2691
256 nmdc:mga0sz30_64861_c1 3300050516 Bacteria 1565
257 Ga0500643_002234 3300053087 Bacteria 10215
258 Ga0500569_053894 3300053109 Bacteria 1222
259 Ga0500592_000002 3300053116 Bacteria 141670
260 Ga0500595_000774 3300053119 Bacteria 18727
261 Ga0500559_0011051 3300053136 Bacteria 3866
262 Ga0500559_0056066 3300053136 Bacteria 1749
263 Ga0500616_0090193 3300053153 Bacteria 1520
264 Ga0500619_011232 3300053154 Bacteria 2296
265 Ga0500627_0000026 3300053158 Bacteria 100362
266 Ga0500636_0000577 3300053177 Bacteria 20072
267 2512644871 2512564014 Bacteria 4639632
268 2559431055 2558860280 Bacteria 11429938
269 2579856765 2579778521 Bacteria 7624758
270 2619857719 2619618881 Bacteria 7521104
271 2620352078 2619619003 Bacteria 7619552
272 2626639683 2626541554 Bacteria 7741902
273 2644038359 2643221605 Bacteria 4772303
274 2863068507 2863067949 Bacteria 8541735
275 8054919842 8054913762 Bacteria 7713009
276 8054923191 8054920844 Bacteria 7068637
277 Ga0068855_100000817
278 SwRhRL2b_contig_234738
279 SwRhRL2b_contig_3367114
280 JGI24751J29686_10000187
281 JGI25165J46597_1000156
282 rootH2_10332287
283 rootL2_10213738
284 Ga0055530_10009530
285 Ga0065704_10000463
286 Ga0065704_10006773
287 Ga0065704_10070166
288 Ga0065707_10085431
289 Ga0070658_10268611
290 Ga0070690_100182562
291 Ga0070670_100077040
292 Ga0070670_100515011
293 Ga0070666_10069937
294 Ga0070689_100079093
295 Ga0070689_100247180
296 Ga0070668_100016713
297 Ga0070668_100166412
298 Ga0070668_100284109
299 Ga0070669_100081454
300 Ga0070669_100242217
301 Ga0070671_100000062
302 Ga0070671_100010782
303 Ga0070671_100029082
304 Ga0070671_100039242
305 Ga0070667_100050003
306 Ga0070713_100212312
307 Ga0070679_100105262
308 Ga0068853_100147278
309 Ga0070665_100065700
310 Ga0070665_100070755
311 Ga0068855_100000641
312 Ga0068855_100010641
313 Ga0068855_100011732
314 Ga0068855_100268613
315 Ga0068856_100095624
316 Ga0068852_100194111
317 Ga0068852_100215299
318 Ga0068864_100000038
319 Ga0068864_100019822
320 Ga0068863_100000026
321 Ga0068863_100059417
322 Ga0068863_100098737
323 Ga0068858_100000810
324 Ga0068858_100005132
325 Ga0068858_100027759
326 Ga0068858_100036171
327 Ga0068860_100051995
328 Ga0068862_100373689
329 Ga0081455_10000940
330 Ga0081455_10045432
331 Ga0081539_10068716
332 Ga0075365_10036281
333 Ga0075368_10000249
334 Ga0075363_100000182
335 Ga0075367_10000340
336 Ga0075367_10000393
337 Ga0075369_10022869
338 Ga0097621_100266543
339 Ga0075370_10007210
340 Ga0075370_10040023
341 Ga0105250_10000013
342 Ga0105240_10045833
343 Ga0105240_10090728
344 Ga0105247_10034056
345 Ga0105248_10002260
346 Ga0105248_10003031
347 Ga0105248_10147746
348 Ga0105248_10300851
349 Ga0105238_10011940
350 Ga0105249_10029794
351 Ga0105148_100205
352 Ga0105239_10050474
353 Ga0163162_10072546
354 Ga0157380_10054402
355 Ga0157380_10133899
356 Ga0157379_10001585
357 Ga0163161_10001170
358 Ga0163161_10111447
359 Ga0213875_10000135
360 Ga0209233_1000213
361 Ga0209050_1000504
362 Ga0207426_1000662
363 Ga0207696_1000072
364 Ga0207710_10061345
365 Ga0207695_10007037
366 Ga0207695_10032422
367 Ga0207652_10118164
368 Ga0207681_10000536
369 Ga0207650_10061349
370 Ga0207650_10243520
371 Ga0207644_10000005
372 Ga0207670_10195781
373 Ga0207711_10005039
374 Ga0207711_10014022
375 Ga0207711_10329591
376 Ga0207667_10005169
377 Ga0207667_10010733
378 Ga0207667_10023972
379 Ga0207667_10061578
380 Ga0207667_10138130
381 Ga0207668_10093632
382 Ga0207658_10026751
383 Ga0207703_10000716
384 Ga0207703_10002633
385 Ga0207703_10026177
386 Ga0207703_10041481
387 Ga0207639_10092888
388 Ga0207641_10000005
389 Ga0207676_10000049
390 Ga0207676_10051897
391 Ga0207676_10112038
392 Ga0207698_10399858
393 Ga0209813_10000010
394 Ga0268266_10104399
395 Ga0268266_10349593
396 Ga0307515_10077088
397 Ga0265338_10043148
398 Ga0265320_10105423
399 Ga0265327_10056034
400 Ga0307513_10063950
401 Ga0307413_10014037
402 Ga0307415_100288159
403 Ga0307510_10032242
404 Ga0373956_0004876
405 Ga0373931_0000027
406 Ga0436364_0567527
407 Ga0436364_1211536
408 Ga0400483_160331
409 Ga0495638_0091590
410 Ga0495650_0000163
411 Ga0495583_0000333
412 Ga0495583_0021131
413 Ga0495610_0021165
414 Ga0495654_0034413
415 Ga0495633_0048417
416 Ga0495668_0018295
417 Ga0495625_0011794
418 Ga0495588_0198947
419 Ga0495600_0010175
420 Ga0495675_0016538
421 Ga0495677_0003835
422 Ga0495677_0007508
423 Ga0495686_0044355
424 Ga0496100_0129876
425 Ga0496101_0018259
426 Ga0496102_0000178
427 Ga0496103_0000119
428 Ga0496103_0040875
429 Ga0496104_0004286
430 Ga0496105_0059230
431 Ga0496105_0070685
432 Ga0496106_0003563
433 Ga0496107_0013029
434 Ga0496108_0004245
435 Ga0496108_0029161
436 Ga0496108_0224600
437 Ga0496108_0302879
438 Ga0496109_0036486
439 Ga0496109_0200628
440 Ga0496110_0007686
441 Ga0496110_0041772
442 Ga0496110_0111835
443 Ga0496110_0313509
444 Ga0496111_0008169
445 Ga0496111_0051398
446 Ga0496111_0094780
447 Ga0496112_0171992
448 Ga0496113_0001455
449 Ga0496113_0050349
450 Ga0496114_0006234
451 Ga0496114_0095000
452 Ga0496115_0000740
453 Ga0496116_0019188
454 Ga0496116_0033723
455 Ga0496116_0084807
456 Ga0496117_0000318
457 Ga0496117_0005453
458 Ga0496117_0174822
459 Ga0496118_0000186
460 Ga0496118_0028402
461 Ga0496119_0000399
462 Ga0496119_0055946
463 Ga0496120_0000074
464 Ga0496120_0044122
465 Ga0496121_0001102
466 Ga0496121_0018638
467 Ga0496121_0031716
468 Ga0496122_0003669
469 Ga0496122_0013754
470 Ga0496122_0051456
471 Ga0496122_0085235
472 Ga0496122_0152790
473 Ga0496123_0002385
474 Ga0496123_0008795
475 Ga0496124_0000324
476 Ga0496124_0001086
477 Ga0496124_0013882
478 Ga0496124_0039358
479 Ga0496125_0001890
480 Ga0496125_0006075
481 Ga0496125_0008335
482 Ga0496125_0031545
483 Ga0496125_0040990
484 Ga0496126_0000452
485 Ga0496126_0001180
486 Ga0496126_0003102
487 Ga0496126_0016407
488 Ga0496126_0026416
489 Ga0496126_0039241
490 Ga0501032_0004258
491 Ga0501032_0024560
492 Ga0501033_0050063
493 Ga0501034_0075082
494 Ga0501036_0004817
495 Ga0501036_0389430
496 Ga0501037_0053035
497 Ga0501038_0121215
498 Ga0501039_0131489
499 Ga0501043_0030086
500 Ga0501047_0004550
501 Ga0501047_0052601
502 Ga0501047_0062301
503 Ga0501070_0011365
504 Ga0501070_0038855
505 Ga0501070_0086596
506 Ga0501073_0160112
507 Ga0501074_0084724
508 Ga0501223_000024
509 Ga0501223_000031
510 Ga0501224_000001
511 Ga0501233_000788
512 Ga0501235_000599
513 Ga0501235_000931
514 Ga0501225_0000093
515 Ga0501225_0000504
516 Ga0501225_0006237
517 Ga0501080_0070930
518 Ga0501035_0003631
519 Ga0501035_0027264
520 Ga0501044_0006132
521 Ga0501044_0006969
522 Ga0501044_0049082
523 Ga0501045_0082533
524 Ga0501226_000029
525 nmdc:mga03n38_1453_c1
526 nmdc:mga0yw44_9309_c1
527 nmdc:mga06z11_68_c1
528 nmdc:mga06z11_83528_c1
529 nmdc:mga04h51_36_c1
530 nmdc:mga07m45_3125_c1
531 nmdc:mga07m45_37867_c1
532 nmdc:mga0sz30_64861_c1
533 Ga0500643_002234
534 Ga0500569_053894
535 Ga0500592_000002
536 Ga0500595_000774
537 Ga0500559_0011051
538 Ga0500559_0056066
539 Ga0500616_0090193
540 Ga0500619_011232
541 Ga0500627_0000026
542 Ga0500636_0000577
543 2512644871
544 2559431055
545 2579856765
546 2619857719
547 2620352078
548 2626639683
549 2644038359
550 2863068507
551 8054919842
552 8054923191

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

143

353

0.92

PF00135

COesterase

Carboxylesterase family

126

247

0.88

PF00326

Peptidase_S9

Prolyl oligopeptidase family

188

366

0.75

PF20434

BD-FAE

BD-FAE

128

326

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b4q-assembly1.cif.gz_B structure of a cold active hsl family esterase reveals mechanisms of low temperature adaptation and substrate specificity 0.9447 1 313
7b4q-assembly1.cif.gz_B structure of a cold active hsl family esterase reveals mechanisms of low temperature adaptation and substrate specificity 0.9417 1 313
7wol-assembly1.cif.gz_B crystal structure of lipase trlipb from thermomocrobium roseum 0.9333 2 313
7wol-assembly1.cif.gz_A crystal structure of lipase trlipb from thermomocrobium roseum 0.9315 2 313
7wol-assembly1.cif.gz_B crystal structure of lipase trlipb from thermomocrobium roseum 0.9275 2 313
ID Description Score Start End Superfamily
af_P96399_42_298_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9274 40 313 3.40.50.1820
af_P96399_42_298_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9239 40 313 3.40.50.1820
1lzlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9169 3 313 3.40.50.1820
3qh4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9148 2 313 3.40.50.1820
1lzlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9084 3 313 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A0N1BWL3-F1-model_v4 Alpha/beta hydrolase fold-3 domain-containing protein 0.9706 2 313 GO:0016787
AF-A0A376WC37-F1-model_v4 Lipase (EC 3.1.1.-) 0.9631 65 190 GO:0016787
AF-A0A0N1BWL3-F1-model_v4 Alpha/beta hydrolase fold-3 domain-containing protein 0.9582 2 313 GO:0016787
AF-A0A1R3UP43-F1-model_v4 Esterase LipW 0.9535 4 311 GO:0016787
AF-A0A254R087-F1-model_v4 Alpha/beta hydrolase fold-3 domain-containing protein 0.9516 21 311 GO:0016787

Map