F384166

General Info

Members Datasets Scaffolds Average Seq Length
281 170 562 279

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100047687|Ga0068855_1000476877
Length 332
Sequence MGLAHPSGMRRRSIGDCRPGLKSHDVPADKNETSITVVSDAMNTTTTPATPSPALDFQPLRSPLPSLDAWTAHFFKAEIPILADTAANLEAMRAHEDDMDANLIGEMVADDPLMTLKILAYSATHRSERRVTDVETVTAAVVVLGISPFFSAFGPEQPVVEDRLAQVEGAPQGLADVLRRAHRAARFAFAFAVHRMDLDAAVIHEAALLHDFAEMLLWCHAPTLALQVRQALEATPGLRSSAAQQGVLGIQLPDLQQALMRAWRLPDLLIRITDDSHADHPSVRNVVLAIRLARHSSHGWENPAIPDDIEELAALLNLSRQATLELVRKVDI

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
97 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
102 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
109 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
116 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
124 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
133 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
134 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
135 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
148 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
149 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
150 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
151 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
152 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
156 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
157 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
158 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
159 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
160 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
161 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
162 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
163 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
164 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
165 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
167 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
168 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
169 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
170 2643221654 Rhizobacter sp. Root404 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 0
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.52
Nodule 0
Rhizoplane 1.07
Rhizosphere 73.31
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100047687 3300005563 Bacteria 5061
2 rootH2_10200810 3300003320 Bacteria 1798
3 rootL2_10276934 3300003322 Bacteria 3506
4 Ga0055524_1000177 3300003775 Bacteria 72445
5 Ga0070658_10104881 3300005327 Bacteria 2339
6 Ga0070676_10004416 3300005328 Bacteria 7397
7 Ga0070690_100010771 3300005330 Bacteria 5332
8 Ga0070670_100015843 3300005331 Bacteria 6469
9 Ga0070670_100109396 3300005331 Bacteria 2381
10 Ga0070670_100241212 3300005331 Bacteria 1574
11 Ga0070670_100319028 3300005331 Bacteria 1361
12 Ga0070677_10033434 3300005333 Bacteria 1980
13 Ga0070677_10089543 3300005333 Bacteria 1335
14 Ga0068869_100004127 3300005334 Bacteria 9008
15 Ga0070666_10040034 3300005335 Bacteria 3126
16 Ga0068868_100069276 3300005338 Bacteria 2811
17 Ga0068868_100174278 3300005338 Bacteria 1782
18 Ga0070687_100039509 3300005343 Bacteria 2371
19 Ga0070668_100006518 3300005347 Bacteria 8653
20 Ga0070669_100016694 3300005353 Bacteria 5240
21 Ga0070675_100020218 3300005354 Bacteria 5312
22 Ga0070675_100037488 3300005354 Bacteria 3949
23 Ga0070675_100048285 3300005354 Bacteria 3489
24 Ga0070675_100096256 3300005354 Bacteria 2487
25 Ga0070675_100121806 3300005354 Bacteria 2216
26 Ga0070675_100236334 3300005354 Bacteria 1596
27 Ga0070671_100020884 3300005355 Bacteria 5342
28 Ga0070674_100014252 3300005356 Bacteria 4939
29 Ga0070674_100030364 3300005356 Bacteria 3570
30 Ga0070674_100170913 3300005356 Bacteria 1657
31 Ga0070673_100120817 3300005364 Bacteria 2185
32 Ga0070673_100264851 3300005364 Bacteria 1503
33 Ga0070673_100673808 3300005364 Bacteria 948
34 Ga0070667_100000975 3300005367 Bacteria 26309
35 Ga0070667_100004171 3300005367 Bacteria 12205
36 Ga0070667_100044133 3300005367 Bacteria 3743
37 Ga0070667_100091689 3300005367 Bacteria 2613
38 Ga0070667_100350093 3300005367 Bacteria 1337
39 Ga0070663_100068571 3300005455 Bacteria 2575
40 Ga0070663_100282445 3300005455 Bacteria 1323
41 Ga0070678_100032118 3300005456 Bacteria 3630
42 Ga0070678_100045618 3300005456 Bacteria 3137
43 Ga0070678_100171815 3300005456 Bacteria 1766
44 Ga0070662_100036590 3300005457 Bacteria 3473
45 Ga0070662_100072231 3300005457 Bacteria 2547
46 Ga0070662_100097745 3300005457 Bacteria 2216
47 Ga0068867_100001985 3300005459 Bacteria 14269
48 Ga0068867_100039424 3300005459 Bacteria 3444
49 Ga0070706_100044257 3300005467 Bacteria 4112
50 Ga0068853_100105748 3300005539 Bacteria 2493
51 Ga0070672_100029210 3300005543 Bacteria 4133
52 Ga0070672_100052960 3300005543 Bacteria 3171
53 Ga0070672_100107415 3300005543 Bacteria 2271
54 Ga0070672_100421461 3300005543 Bacteria 1146
55 Ga0070686_100046209 3300005544 Bacteria 2746
56 Ga0070665_100005903 3300005548 Bacteria 12544
57 Ga0068857_100021440 3300005577 Bacteria 5687
58 Ga0068852_100068908 3300005616 Bacteria 3098
59 Ga0068852_100073982 3300005616 Bacteria 2999
60 Ga0068859_100073069 3300005617 Bacteria 3467
61 Ga0068864_100002874 3300005618 Bacteria 14233
62 Ga0068866_10009957 3300005718 Bacteria 4057
63 Ga0068863_100076295 3300005841 Bacteria 3171
64 Ga0068858_100015233 3300005842 Bacteria 7232
65 Ga0068860_100003706 3300005843 Bacteria 15722
66 Ga0068860_100081664 3300005843 Bacteria 3074
67 Ga0075362_10016699 3300006177 Bacteria 3010
68 Ga0075362_10017426 3300006177 Bacteria 2959
69 Ga0075367_10005112 3300006178 Bacteria 6474
70 Ga0075366_10007365 3300006195 Bacteria 6075
71 Ga0075366_10008687 3300006195 Bacteria 5657
72 Ga0075366_10076449 3300006195 Bacteria 1998
73 Ga0075366_10087911 3300006195 Bacteria 1861
74 Ga0075366_10120264 3300006195 Bacteria 1583
75 Ga0075366_10239416 3300006195 Bacteria 1106
76 Ga0075366_10246066 3300006195 Bacteria 1090
77 Ga0075370_10011071 3300006353 Bacteria 4730
78 Ga0075370_10012199 3300006353 Bacteria 4535
79 Ga0075370_10060422 3300006353 Bacteria 2159
80 Ga0075429_100005450 3300006880 Bacteria 10959
81 Ga0068865_100040344 3300006881 Bacteria 3171
82 Ga0097620_100073059 3300006931 Bacteria 3467
83 Ga0105245_10085840 3300009098 Bacteria 2886
84 Ga0114129_10038970 3300009147 Bacteria 6699
85 Ga0105243_10006936 3300009148 Bacteria 8723
86 Ga0105243_10044534 3300009148 Bacteria 3482
87 Ga0105242_10426001 3300009176 Bacteria 1245
88 Ga0105248_10094328 3300009177 Bacteria 3370
89 Ga0105248_10371048 3300009177 Bacteria 1611
90 Ga0105249_10038415 3300009553 Bacteria 4344
91 Ga0105246_10371369 3300011119 Bacteria 1179
92 Ga0163162_10036592 3300013306 Bacteria 4894
93 Ga0157375_10007862 3300013308 Bacteria 9332
94 Ga0157375_10087254 3300013308 Bacteria 3172
95 Ga0157375_10393605 3300013308 Bacteria 1552
96 Ga0157380_10002399 3300014326 Bacteria 12601
97 Ga0157377_10000021 3300014745 Bacteria 147105
98 Ga0157379_10037880 3300014968 Bacteria 4301
99 Ga0157376_10860723 3300014969 Bacteria 922
100 Ga0163161_10020214 3300017792 Bacteria 4671
101 Ga0209675_1024798 3300025291 Bacteria 1525
102 Ga0207682_10005552 3300025893 Bacteria 5134
103 Ga0207642_10004712 3300025899 Bacteria 4407
104 Ga0207680_10048205 3300025903 Bacteria 2529
105 Ga0207645_10014853 3300025907 Bacteria 5196
106 Ga0207645_10045289 3300025907 Bacteria 2812
107 Ga0207645_10090254 3300025907 Bacteria 1970
108 Ga0207645_10113123 3300025907 Bacteria 1758
109 Ga0207705_10212149 3300025909 Bacteria 1469
110 Ga0207684_10033416 3300025910 Bacteria 4374
111 Ga0207662_10065583 3300025918 Bacteria 2186
112 Ga0207681_10008284 3300025923 Bacteria 6356
113 Ga0207681_10287720 3300025923 Bacteria 1296
114 Ga0207650_10003035 3300025925 Bacteria 11563
115 Ga0207650_10084728 3300025925 Bacteria 2410
116 Ga0207650_10105535 3300025925 Bacteria 2175
117 Ga0207659_10016769 3300025926 Bacteria 4774
118 Ga0207659_10021453 3300025926 Bacteria 4287
119 Ga0207659_10066675 3300025926 Bacteria 2613
120 Ga0207659_10143457 3300025926 Bacteria 1856
121 Ga0207659_10319213 3300025926 Bacteria 1281
122 Ga0207644_10114821 3300025931 Bacteria 2041
123 Ga0207706_10037340 3300025933 Bacteria 4314
124 Ga0207706_10301338 3300025933 Bacteria 1396
125 Ga0207709_10002256 3300025935 Bacteria 12257
126 Ga0207709_10030306 3300025935 Bacteria 3146
127 Ga0207669_10041683 3300025937 Bacteria 2674
128 Ga0207691_10004162 3300025940 Bacteria 14056
129 Ga0207691_10071435 3300025940 Bacteria 3132
130 Ga0207691_10074458 3300025940 Bacteria 3062
131 Ga0207691_10137810 3300025940 Bacteria 2152
132 Ga0207711_10225300 3300025941 Bacteria 1716
133 Ga0207689_10024283 3300025942 Bacteria 5087
134 Ga0207679_10291196 3300025945 Bacteria 1404
135 Ga0207651_10020525 3300025960 Bacteria 3990
136 Ga0207712_10027752 3300025961 Bacteria 3782
137 Ga0207668_10010018 3300025972 Bacteria 5704
138 Ga0207640_10276983 3300025981 Bacteria 1316
139 Ga0207658_10004344 3300025986 Bacteria 9860
140 Ga0207658_10069660 3300025986 Bacteria 2658
141 Ga0207677_10018601 3300026023 Bacteria 4173
142 Ga0207677_10065032 3300026023 Bacteria 2543
143 Ga0207677_10184347 3300026023 Bacteria 1645
144 Ga0207703_10005289 3300026035 Bacteria 10407
145 Ga0207678_10035571 3300026067 Bacteria 4336
146 Ga0207641_10011024 3300026088 Bacteria 7413
147 Ga0207648_10002131 3300026089 Bacteria 21529
148 Ga0207648_10007595 3300026089 Bacteria 10633
149 Ga0207648_10066618 3300026089 Bacteria 3141
150 Ga0207676_10078901 3300026095 Bacteria 2668
151 Ga0207674_10015349 3300026116 Bacteria 8417
152 Ga0207683_10025332 3300026121 Bacteria 5117
153 Ga0207683_10071748 3300026121 Bacteria 3062
154 Ga0207683_10089419 3300026121 Bacteria 2741
155 Ga0207683_10101861 3300026121 Bacteria 2564
156 Ga0209974_10001465 3300027876 Bacteria 8559
157 Ga0268266_10032674 3300028379 Bacteria 4421
158 Ga0268264_10009546 3300028381 Bacteria 8038
159 Ga0307517_10006619 3300028786 Bacteria 17080
160 Ga0307515_10002435 3300028794 Bacteria 40544
161 Ga0307515_10003433 3300028794 Bacteria 33339
162 Ga0307515_10007780 3300028794 Bacteria 21086
163 Ga0307515_10022234 3300028794 Bacteria 11185
164 Ga0307515_10117256 3300028794 Bacteria 3049
165 Ga0307515_10220504 3300028794 Bacteria 1716
166 Ga0307515_10231039 3300028794 Bacteria 1642
167 Ga0307512_10009073 3300030522 Bacteria 9621
168 Ga0307512_10026236 3300030522 Bacteria 5148
169 Ga0265332_10000006 3300031238 Bacteria 327963
170 Ga0307513_10008816 3300031456 Bacteria 12841
171 Ga0307513_10009449 3300031456 Bacteria 12333
172 Ga0307513_10010890 3300031456 Bacteria 11357
173 Ga0307513_10132515 3300031456 Bacteria 2435
174 Ga0307509_10006623 3300031507 Bacteria 15481
175 Ga0307509_10010275 3300031507 Bacteria 11503
176 Ga0307509_10024131 3300031507 Bacteria 6815
177 Ga0307509_10119111 3300031507 Bacteria 2622
178 Ga0307408_100090608 3300031548 Bacteria 2308
179 Ga0307508_10000296 3300031616 Bacteria 60826
180 Ga0307508_10001204 3300031616 Bacteria 29689
181 Ga0307508_10061029 3300031616 Bacteria 3332
182 Ga0307514_10024322 3300031649 Bacteria 4906
183 Ga0307514_10058742 3300031649 Bacteria 2941
184 Ga0307516_10001808 3300031730 Bacteria 29384
185 Ga0307516_10005185 3300031730 Bacteria 15701
186 Ga0307405_10252045 3300031731 Bacteria 1314
187 Ga0307410_10127505 3300031852 Bacteria 1865
188 Ga0307412_10114159 3300031911 Bacteria 1934
189 Ga0307412_10377934 3300031911 Bacteria 1146
190 Ga0307411_10374632 3300032005 Bacteria 1169
191 Ga0307507_10024690 3300033179 Bacteria 6540
192 Ga0307507_10070098 3300033179 Bacteria 3183
193 Ga0307510_10020555 3300033180 Bacteria 7713
194 Ga0307510_10047358 3300033180 Bacteria 4608
195 Ga0307510_10113493 3300033180 Bacteria 2443
196 Ga0373937_0271958 3300036401 Bacteria 1599
197 Ga0395900_0001686 3300037418 Bacteria 25712
198 Ga0395898_0002642 3300037466 Bacteria 20848
199 Ga0451787_015381 3300041441 Bacteria 1026
200 Ga0451853_4053387 3300041512 Bacteria 1396
201 Ga0466969_0002962 3300044656 Bacteria 9066
202 Ga0466969_0016300 3300044656 Bacteria 3892
203 Ga0466969_0045932 3300044656 Bacteria 2166
204 Ga0466972_0049068 3300044658 Bacteria 2039
205 Ga0466965_0139751 3300044683 Bacteria 1260
206 Ga0466966_0028110 3300044684 Bacteria 3664
207 Ga0466966_0032885 3300044684 Bacteria 3357
208 Ga0466966_0123574 3300044684 Bacteria 1588
209 Ga0466961_0016026 3300044693 Bacteria 4811
210 Ga0466961_0024950 3300044693 Bacteria 3846
211 Ga0466963_0005488 3300044694 Bacteria 7424
212 Ga0466964_0022430 3300044706 Bacteria 2449
213 Ga0453684_0009499 3300044712 Bacteria 17005
214 Ga0466971_0013249 3300044719 Bacteria 3618
215 Ga0466971_0048965 3300044719 Bacteria 1900
216 Ga0466971_0101331 3300044719 Bacteria 1324
217 Ga0466970_0039370 3300044765 Bacteria 2508
218 Ga0466970_0052008 3300044765 Bacteria 2187
219 Ga0466970_0149075 3300044765 Bacteria 1291
220 Ga0466957_0056678 3300044842 Bacteria 2396
221 Ga0466960_0059170 3300044901 Bacteria 1873
222 Ga0466959_0001418 3300045049 Bacteria 14666
223 Ga0466959_0043459 3300045049 Bacteria 3312
224 Ga0466959_0144435 3300045049 Bacteria 1679
225 Ga0451576_0165387 3300045051 Bacteria 2308
226 Ga0451576_0271505 3300045051 Bacteria 1773
227 Ga0466958_0155240 3300045836 Bacteria 1444
228 Ga0466967_0056175 3300045976 Bacteria 3470
229 Ga0466967_0327806 3300045976 Bacteria 1478
230 Ga0495592_0002694 3300046454 Bacteria 12565
231 Ga0495610_0018904 3300046512 Bacteria 3874
232 Ga0495610_0044852 3300046512 Bacteria 2192
233 Ga0495620_0088415 3300046515 Bacteria 1245
234 Ga0495632_0040420 3300046519 Bacteria 2349
235 Ga0495643_0026737 3300046522 Bacteria 3251
236 Ga0495625_0014620 3300046660 Bacteria 6254
237 Ga0495647_0012684 3300046681 Bacteria 2907
238 Ga0495658_0053960 3300046683 Bacteria 2285
239 Ga0495658_0105704 3300046683 Bacteria 1686
240 Ga0495686_0009871 3300047472 Bacteria 6840
241 Ga0496106_0111760 3300048909 Bacteria 2128
242 Ga0496112_0323349 3300048915 Bacteria 1487
243 Ga0501298_028408 3300049521 Bacteria 1085
244 Ga0501043_0000572 3300049579 Bacteria 32900
245 Ga0501046_0000843 3300049580 Bacteria 29885
246 Ga0501047_0000906 3300049581 Bacteria 30269
247 Ga0501048_0001003 3300049582 Bacteria 21059
248 Ga0501265_001463 3300049762 Bacteria 2661
249 Ga0501045_0007135 3300049824 Bacteria 7752
250 nmdc:mga03683_194992_c1 3300050489 Bacteria 928
251 nmdc:mga0k408_117900_c1 3300050493 Bacteria 1571
252 nmdc:mga0k408_183836_c1 3300050493 Bacteria 1247
253 nmdc:mga0k408_20983_c1 3300050493 Bacteria 3666
254 nmdc:mga0k408_233_c1 3300050493 Bacteria 29837
255 nmdc:mga0k408_27439_c1 3300050493 Bacteria 3234
256 nmdc:mga0k408_7434_c1 3300050493 Bacteria 1861
257 nmdc:mga06z11_226840_c1 3300050494 Bacteria 1093
258 nmdc:mga07m45_22415_c1 3300050496 Bacteria 3448
259 nmdc:mga07m45_36911_c1 3300050496 Bacteria 2724
260 nmdc:mga07m45_56109_c1 3300050496 Bacteria 2226
261 nmdc:mga05p37_96190_c1 3300050507 Bacteria 3648
262 nmdc:mga09592_8600_c1 3300050508 Bacteria 8305
263 Ga0495612_0109575 3300053078 Bacteria 1181
264 Ga0500644_0003125 3300053088 Bacteria 4099
265 Ga0500651_0078854 3300053093 Bacteria 2042
266 Ga0500593_000589 3300053117 Bacteria 13970
267 Ga0500607_051038 3300053121 Bacteria 2201
268 Ga0500559_0000176 3300053136 Bacteria 50699
269 Ga0500559_0127854 3300053136 Unclassified 1186
270 Ga0500619_000342 3300053154 Bacteria 8851
271 Ga0500622_0003533 3300053156 Bacteria 10355
272 Ga0500636_0032308 3300053177 Bacteria 3098
273 Ga0500645_019513 3300053730 Bacteria 2108
274 Ga0500587_001383 3300053739 Bacteria 3423
275 Ga0500587_008478 3300053739 Bacteria 1321
276 Ga0466962_0003825 3300061719 Bacteria 7195
277 Ga0466962_0017795 3300061719 Bacteria 3420
278 2587727973 2585428057 Bacteria 6737412
279 2587731036 2585428058 Bacteria 6853932
280 2587758901 2585428062 Bacteria 6842168
281 2644303463 2643221654 Bacteria 5273570
282 Ga0068855_100047687
283 rootH2_10200810
284 rootL2_10276934
285 Ga0055524_1000177
286 Ga0070658_10104881
287 Ga0070676_10004416
288 Ga0070690_100010771
289 Ga0070670_100015843
290 Ga0070670_100109396
291 Ga0070670_100241212
292 Ga0070670_100319028
293 Ga0070677_10033434
294 Ga0070677_10089543
295 Ga0068869_100004127
296 Ga0070666_10040034
297 Ga0068868_100069276
298 Ga0068868_100174278
299 Ga0070687_100039509
300 Ga0070668_100006518
301 Ga0070669_100016694
302 Ga0070675_100020218
303 Ga0070675_100037488
304 Ga0070675_100048285
305 Ga0070675_100096256
306 Ga0070675_100121806
307 Ga0070675_100236334
308 Ga0070671_100020884
309 Ga0070674_100014252
310 Ga0070674_100030364
311 Ga0070674_100170913
312 Ga0070673_100120817
313 Ga0070673_100264851
314 Ga0070673_100673808
315 Ga0070667_100000975
316 Ga0070667_100004171
317 Ga0070667_100044133
318 Ga0070667_100091689
319 Ga0070667_100350093
320 Ga0070663_100068571
321 Ga0070663_100282445
322 Ga0070678_100032118
323 Ga0070678_100045618
324 Ga0070678_100171815
325 Ga0070662_100036590
326 Ga0070662_100072231
327 Ga0070662_100097745
328 Ga0068867_100001985
329 Ga0068867_100039424
330 Ga0070706_100044257
331 Ga0068853_100105748
332 Ga0070672_100029210
333 Ga0070672_100052960
334 Ga0070672_100107415
335 Ga0070672_100421461
336 Ga0070686_100046209
337 Ga0070665_100005903
338 Ga0068857_100021440
339 Ga0068852_100068908
340 Ga0068852_100073982
341 Ga0068859_100073069
342 Ga0068864_100002874
343 Ga0068866_10009957
344 Ga0068863_100076295
345 Ga0068858_100015233
346 Ga0068860_100003706
347 Ga0068860_100081664
348 Ga0075362_10016699
349 Ga0075362_10017426
350 Ga0075367_10005112
351 Ga0075366_10007365
352 Ga0075366_10008687
353 Ga0075366_10076449
354 Ga0075366_10087911
355 Ga0075366_10120264
356 Ga0075366_10239416
357 Ga0075366_10246066
358 Ga0075370_10011071
359 Ga0075370_10012199
360 Ga0075370_10060422
361 Ga0075429_100005450
362 Ga0068865_100040344
363 Ga0097620_100073059
364 Ga0105245_10085840
365 Ga0114129_10038970
366 Ga0105243_10006936
367 Ga0105243_10044534
368 Ga0105242_10426001
369 Ga0105248_10094328
370 Ga0105248_10371048
371 Ga0105249_10038415
372 Ga0105246_10371369
373 Ga0163162_10036592
374 Ga0157375_10007862
375 Ga0157375_10087254
376 Ga0157375_10393605
377 Ga0157380_10002399
378 Ga0157377_10000021
379 Ga0157379_10037880
380 Ga0157376_10860723
381 Ga0163161_10020214
382 Ga0209675_1024798
383 Ga0207682_10005552
384 Ga0207642_10004712
385 Ga0207680_10048205
386 Ga0207645_10014853
387 Ga0207645_10045289
388 Ga0207645_10090254
389 Ga0207645_10113123
390 Ga0207705_10212149
391 Ga0207684_10033416
392 Ga0207662_10065583
393 Ga0207681_10008284
394 Ga0207681_10287720
395 Ga0207650_10003035
396 Ga0207650_10084728
397 Ga0207650_10105535
398 Ga0207659_10016769
399 Ga0207659_10021453
400 Ga0207659_10066675
401 Ga0207659_10143457
402 Ga0207659_10319213
403 Ga0207644_10114821
404 Ga0207706_10037340
405 Ga0207706_10301338
406 Ga0207709_10002256
407 Ga0207709_10030306
408 Ga0207669_10041683
409 Ga0207691_10004162
410 Ga0207691_10071435
411 Ga0207691_10074458
412 Ga0207691_10137810
413 Ga0207711_10225300
414 Ga0207689_10024283
415 Ga0207679_10291196
416 Ga0207651_10020525
417 Ga0207712_10027752
418 Ga0207668_10010018
419 Ga0207640_10276983
420 Ga0207658_10004344
421 Ga0207658_10069660
422 Ga0207677_10018601
423 Ga0207677_10065032
424 Ga0207677_10184347
425 Ga0207703_10005289
426 Ga0207678_10035571
427 Ga0207641_10011024
428 Ga0207648_10002131
429 Ga0207648_10007595
430 Ga0207648_10066618
431 Ga0207676_10078901
432 Ga0207674_10015349
433 Ga0207683_10025332
434 Ga0207683_10071748
435 Ga0207683_10089419
436 Ga0207683_10101861
437 Ga0209974_10001465
438 Ga0268266_10032674
439 Ga0268264_10009546
440 Ga0307517_10006619
441 Ga0307515_10002435
442 Ga0307515_10003433
443 Ga0307515_10007780
444 Ga0307515_10022234
445 Ga0307515_10117256
446 Ga0307515_10220504
447 Ga0307515_10231039
448 Ga0307512_10009073
449 Ga0307512_10026236
450 Ga0265332_10000006
451 Ga0307513_10008816
452 Ga0307513_10009449
453 Ga0307513_10010890
454 Ga0307513_10132515
455 Ga0307509_10006623
456 Ga0307509_10010275
457 Ga0307509_10024131
458 Ga0307509_10119111
459 Ga0307408_100090608
460 Ga0307508_10000296
461 Ga0307508_10001204
462 Ga0307508_10061029
463 Ga0307514_10024322
464 Ga0307514_10058742
465 Ga0307516_10001808
466 Ga0307516_10005185
467 Ga0307405_10252045
468 Ga0307410_10127505
469 Ga0307412_10114159
470 Ga0307412_10377934
471 Ga0307411_10374632
472 Ga0307507_10024690
473 Ga0307507_10070098
474 Ga0307510_10020555
475 Ga0307510_10047358
476 Ga0307510_10113493
477 Ga0373937_0271958
478 Ga0395900_0001686
479 Ga0395898_0002642
480 Ga0451787_015381
481 Ga0451853_4053387
482 Ga0466969_0002962
483 Ga0466969_0016300
484 Ga0466969_0045932
485 Ga0466972_0049068
486 Ga0466965_0139751
487 Ga0466966_0028110
488 Ga0466966_0032885
489 Ga0466966_0123574
490 Ga0466961_0016026
491 Ga0466961_0024950
492 Ga0466963_0005488
493 Ga0466964_0022430
494 Ga0453684_0009499
495 Ga0466971_0013249
496 Ga0466971_0048965
497 Ga0466971_0101331
498 Ga0466970_0039370
499 Ga0466970_0052008
500 Ga0466970_0149075
501 Ga0466957_0056678
502 Ga0466960_0059170
503 Ga0466959_0001418
504 Ga0466959_0043459
505 Ga0466959_0144435
506 Ga0451576_0165387
507 Ga0451576_0271505
508 Ga0466958_0155240
509 Ga0466967_0056175
510 Ga0466967_0327806
511 Ga0495592_0002694
512 Ga0495610_0018904
513 Ga0495610_0044852
514 Ga0495620_0088415
515 Ga0495632_0040420
516 Ga0495643_0026737
517 Ga0495625_0014620
518 Ga0495647_0012684
519 Ga0495658_0053960
520 Ga0495658_0105704
521 Ga0495686_0009871
522 Ga0496106_0111760
523 Ga0496112_0323349
524 Ga0501298_028408
525 Ga0501043_0000572
526 Ga0501046_0000843
527 Ga0501047_0000906
528 Ga0501048_0001003
529 Ga0501265_001463
530 Ga0501045_0007135
531 nmdc:mga03683_194992_c1
532 nmdc:mga0k408_117900_c1
533 nmdc:mga0k408_183836_c1
534 nmdc:mga0k408_20983_c1
535 nmdc:mga0k408_233_c1
536 nmdc:mga0k408_27439_c1
537 nmdc:mga0k408_7434_c1
538 nmdc:mga06z11_226840_c1
539 nmdc:mga07m45_22415_c1
540 nmdc:mga07m45_36911_c1
541 nmdc:mga07m45_56109_c1
542 nmdc:mga05p37_96190_c1
543 nmdc:mga09592_8600_c1
544 Ga0495612_0109575
545 Ga0500644_0003125
546 Ga0500651_0078854
547 Ga0500593_000589
548 Ga0500607_051038
549 Ga0500559_0000176
550 Ga0500559_0127854
551 Ga0500619_000342
552 Ga0500622_0003533
553 Ga0500636_0032308
554 Ga0500645_019513
555 Ga0500587_001383
556 Ga0500587_008478
557 Ga0466962_0003825
558 Ga0466962_0017795
559 2587727973
560 2587731036
561 2587758901
562 2644303463

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08668

HDOD

HDOD domain

79

279

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p3q-assembly3.cif.gz_A crystal structure of mmoq response regulator from methylococcus capsulatus str. bath at the resolution 2.4a, northeast structural genomics consortium target mcr175m 0.7302 28 276
3p3q-assembly3.cif.gz_A crystal structure of mmoq response regulator from methylococcus capsulatus str. bath at the resolution 2.4a, northeast structural genomics consortium target mcr175m 0.7117 28 276
3p3q-assembly3.cif.gz_B crystal structure of mmoq response regulator from methylococcus capsulatus str. bath at the resolution 2.4a, northeast structural genomics consortium target mcr175m 0.7115 25 276
3p3q-assembly3.cif.gz_B crystal structure of mmoq response regulator from methylococcus capsulatus str. bath at the resolution 2.4a, northeast structural genomics consortium target mcr175m 0.7019 25 276
3ljx-assembly1.cif.gz_A crystal structure of mmoq response regulator (fragment 20-298) from methylococcus capsulatus str. bath, northeast structural genomics consortium target mcr175g 0.7012 28 268
ID Description Score Start End Superfamily
3ljvB00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7328 28 268 1.10.3210.10
3p3qA00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7292 28 276 1.10.3210.10
3p3qA00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7131 28 276 1.10.3210.10
3ljvB00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7069 28 268 1.10.3210.10
1vqrD00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6241 19 266 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A1G8ZIK5-F1-model_v4 HD-like signal output (HDOD) domain, no enzymatic activity 0.9686 17 277
AF-A0A1R1I1L7-F1-model_v4 HDOD domain-containing protein 0.9676 10 277
AF-A0A5C7JYG3-F1-model_v4 HDOD domain-containing protein 0.9652 10 277
AF-A0A3D1WFR5-F1-model_v4 Histidine kinase 0.9646 7 280 GO:0016301
AF-A0A1G3HQ63-F1-model_v4 HDOD domain-containing protein 0.9642 10 276

Map