F384168

General Info

Members Datasets Scaffolds Average Seq Length
281 182 562 132

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100276101|Ga0070664_1002761012
Length 145
Sequence LFVRKISYLHFMKASKKKAAEKKVEPTKSELEILQVLWQYGASTVRFVNDKLNEQTRQVQYTSTLKLMQIMNDKGMLKRDDTNMKHVYAPAEEEHKTKNYLLERFVNSMYHGSASSLVMELLGNKKTSKKELKIIKEMLDKLDTE

Samples

Sample ID Description Type Environment
1 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
77 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
131 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
132 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
133 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
139 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
140 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
150 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
159 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
160 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
164 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
165 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
166 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
167 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
168 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
169 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
170 2738541283 Pedobacter sp. OK701 Isolate Unclassified
171 2738541302 Pedobacter sp. CF074 Isolate Unclassified
172 2739367651 Pedobacter sp. OK291 Isolate Unclassified
173 2739367656 Pedobacter sp. CF523 Isolate Unclassified
174 2739367663 Pedobacter sp. YR510 Isolate Unclassified
175 2818991437 Pedobacter terrae 518 Isolate Unclassified
176 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
177 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
178 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
179 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
180 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
181 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
182 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.02
Metatranscriptomes 0
Isolates 4.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.19
Nodule 0
Rhizoplane 0.36
Rhizosphere 83.99
Stem 0
Stem Tuber 0
Unclassified 11.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070664_100276101 3300005564 Bacteria 1515
2 SwRhRL2b_contig_466296 2162886007 Bacteria 30659
3 JGI24736J21556_1008683 3300001904 Unclassified 1685
4 JGI24740J21852_10117974 3300001979 Bacteria 666
5 JGI24737J22298_10013116 3300001990 Bacteria 2700
6 JGI24743J22301_10072368 3300001991 Bacteria 720
7 JGI24735J21928_10053770 3300002067 Unclassified 1161
8 JGI25157J39369_1011791 3300002741 Bacteria 1124
9 JGI25152J39213_1000173 3300002773 Bacteria 43619
10 JGI25150J39212_1000015 3300002774 Bacteria 170613
11 JGI25151J46595_10000043 3300003187 Bacteria 170613
12 JGI25165J46597_1020301 3300003214 Bacteria 871
13 JGI25153J46596_10000009 3300003215 Bacteria 340925
14 rootH1_10014992 3300003323 Bacteria 23843
15 Ga0055536_1000036 3300003781 Bacteria 141730
16 Ga0055530_10001821 3300003791 Bacteria 14730
17 Ga0065714_10001936 3300005288 Bacteria 75145
18 Ga0065714_10006768 3300005288 Bacteria 4682
19 Ga0065714_10064423 3300005288 Bacteria 257266
20 Ga0065714_10467403 3300005288 Unclassified 543
21 Ga0065704_10000199 3300005289 Bacteria 297176
22 Ga0065704_10403147 3300005289 Unclassified 750
23 Ga0065704_10588764 3300005289 Bacteria 613
24 Ga0070658_11677983 3300005327 Unclassified 550
25 Ga0070676_10220612 3300005328 Bacteria 1252
26 Ga0070683_100024627 3300005329 Bacteria 5394
27 Ga0070670_100368330 3300005331 Bacteria 1264
28 Ga0068869_100232080 3300005334 Bacteria 1467
29 Ga0070680_100444405 3300005336 Bacteria 1107
30 Ga0070682_101585268 3300005337 Bacteria 565
31 Ga0070660_100533536 3300005339 Bacteria 978
32 Ga0070692_10220290 3300005345 Bacteria 1121
33 Ga0070668_100776106 3300005347 Bacteria 850
34 Ga0070669_100308008 3300005353 Bacteria 1276
35 Ga0070669_100528897 3300005353 Bacteria 981
36 Ga0070674_100556313 3300005356 Unclassified 963
37 Ga0070673_100291141 3300005364 Bacteria 1435
38 Ga0070667_100241610 3300005367 Bacteria 1613
39 Ga0070667_100764733 3300005367 Bacteria 896
40 Ga0070667_100934448 3300005367 Bacteria 808
41 Ga0070700_101148219 3300005441 Unclassified 646
42 Ga0068867_100014084 3300005459 Bacteria 5665
43 Ga0068867_100624218 3300005459 Bacteria 943
44 Ga0070685_10312220 3300005466 Bacteria 1063
45 Ga0070679_100001653 3300005530 Bacteria 20083
46 Ga0070684_100303154 3300005535 Bacteria 1466
47 Ga0070684_102097736 3300005535 Bacteria 533
48 Ga0068853_100133506 3300005539 Unclassified 2224
49 Ga0068853_100293555 3300005539 Unclassified 1501
50 Ga0068853_101157893 3300005539 Bacteria 746
51 Ga0070672_102025005 3300005543 Bacteria 519
52 Ga0070696_100721012 3300005546 Bacteria 814
53 Ga0070665_100000034 3300005548 Bacteria 324289
54 Ga0068855_100191597 3300005563 Bacteria 2306
55 Ga0068855_101059904 3300005563 Bacteria 849
56 Ga0068857_100013296 3300005577 Bacteria 7170
57 Ga0068857_100348907 3300005577 Bacteria 1370
58 Ga0068857_100575001 3300005577 Bacteria 1063
59 Ga0068864_100157057 3300005618 Bacteria 2065
60 Ga0068864_100552130 3300005618 Bacteria 1113
61 Ga0068864_100849686 3300005618 Bacteria 899
62 Ga0068864_101025000 3300005618 Bacteria 819
63 Ga0068861_100631061 3300005719 Bacteria 987
64 Ga0068870_10008604 3300005840 Bacteria 4599
65 Ga0068860_100001563 3300005843 Bacteria 24660
66 Ga0075370_10576214 3300006353 Unclassified 681
67 Ga0068871_100100060 3300006358 Bacteria 2428
68 Ga0068865_100647340 3300006881 Unclassified 898
69 Ga0068865_100759888 3300006881 Bacteria 833
70 Ga0105244_10116194 3300009036 Bacteria 1299
71 Ga0105240_10000646 3300009093 Bacteria 64342
72 Ga0105240_10000699 3300009093 Bacteria 61665
73 Ga0105240_10376301 3300009093 Bacteria 1604
74 Ga0105240_10666977 3300009093 Bacteria 1138
75 Ga0105245_10251792 3300009098 Bacteria 1716
76 Ga0105241_10123903 3300009174 Bacteria 2085
77 Ga0105241_10477423 3300009174 Bacteria 1108
78 Ga0105241_10634676 3300009174 Bacteria 968
79 Ga0105241_11509755 3300009174 Bacteria 647
80 Ga0105242_10584352 3300009176 Bacteria 1076
81 Ga0105242_10796331 3300009176 Bacteria 935
82 Ga0105242_11037804 3300009176 Unclassified 830
83 Ga0105242_11680659 3300009176 Bacteria 671
84 Ga0105248_11383764 3300009177 Bacteria 796
85 Ga0105237_10003260 3300009545 Bacteria 19399
86 Ga0105237_10043472 3300009545 Bacteria 4525
87 Ga0105237_10122379 3300009545 Unclassified 2596
88 Ga0105237_12370712 3300009545 Bacteria 541
89 Ga0105249_10715620 3300009553 Bacteria 1062
90 Ga0105239_10001040 3300010375 Bacteria 38650
91 Ga0105239_10032361 3300010375 Bacteria 5748
92 Ga0105239_10967707 3300010375 Unclassified 978
93 Ga0105239_11208249 3300010375 Bacteria 871
94 Ga0157373_10000015 3300013100 Bacteria 183381
95 Ga0157373_10001198 3300013100 Bacteria 19836
96 Ga0157373_10038328 3300013100 Bacteria 3435
97 Ga0157373_11272508 3300013100 Bacteria 556
98 Ga0157371_10000172 3300013102 Bacteria 94447
99 Ga0157371_10000684 3300013102 Bacteria 40124
100 Ga0157371_10003100 3300013102 Bacteria 15401
101 Ga0157371_10032074 3300013102 Bacteria 3781
102 Ga0157371_10149901 3300013102 Bacteria 1663
103 Ga0157370_10003635 3300013104 Bacteria 18022
104 Ga0157370_10003924 3300013104 Bacteria 17317
105 Ga0157370_10036622 3300013104 Bacteria 4759
106 Ga0157370_10243374 3300013104 Bacteria 1664
107 Ga0157370_10600280 3300013104 Bacteria 1008
108 Ga0157369_10000007 3300013105 Bacteria 402562
109 Ga0157369_10022526 3300013105 Bacteria 7027
110 Ga0157369_10140055 3300013105 Bacteria 2560
111 Ga0157369_11245639 3300013105 Bacteria 759
112 Ga0157369_11435794 3300013105 Unclassified 702
113 Ga0157374_10197486 3300013296 Bacteria 1969
114 Ga0157374_10273812 3300013296 Bacteria 1665
115 Ga0157374_10418448 3300013296 Bacteria 1338
116 Ga0157374_10808749 3300013296 Bacteria 953
117 Ga0157378_10006889 3300013297 Bacteria 9917
118 Ga0157378_10146489 3300013297 Bacteria 2197
119 Ga0157378_10276748 3300013297 Bacteria 1616
120 Ga0163162_10000063 3300013306 Bacteria 104222
121 Ga0163162_10002489 3300013306 Bacteria 17409
122 Ga0163162_10203785 3300013306 Unclassified 2107
123 Ga0163162_10650028 3300013306 Bacteria 1178
124 Ga0163162_10957137 3300013306 Unclassified 967
125 Ga0163162_13328367 3300013306 Unclassified 514
126 Ga0157372_10002387 3300013307 Bacteria 20334
127 Ga0157372_10032422 3300013307 Bacteria 5729
128 Ga0157372_10084218 3300013307 Bacteria 3603
129 Ga0157372_10254398 3300013307 Bacteria 2039
130 Ga0157372_10720186 3300013307 Bacteria 1161
131 Ga0157372_11058949 3300013307 Unclassified 939
132 Ga0157372_11341200 3300013307 Bacteria 825
133 Ga0157375_10418671 3300013308 Bacteria 1506
134 Ga0163163_10064038 3300014325 Bacteria 3648
135 Ga0157380_12396416 3300014326 Bacteria 593
136 Ga0182008_10000771 3300014497 Bacteria 22454
137 Ga0182008_10007012 3300014497 Bacteria 6247
138 Ga0157377_10692314 3300014745 Bacteria 739
139 Ga0157377_10866766 3300014745 Bacteria 672
140 Ga0157376_10137676 3300014969 Bacteria 2187
141 Ga0157376_11564570 3300014969 Bacteria 693
142 Ga0182006_1000130 3300015261 Bacteria 80841
143 Ga0182006_1000581 3300015261 Bacteria 26955
144 Ga0182006_1002737 3300015261 Bacteria 9445
145 Ga0182006_1033637 3300015261 Bacteria 2054
146 Ga0182007_10000007 3300015262 Bacteria 376596
147 Ga0182005_1196032 3300015265 Archaea 605
148 Ga0183373_1001 3300015682 Bacteria 1410374
149 Ga0163161_10000045 3300017792 Bacteria 130284
150 Ga0163161_10003812 3300017792 Bacteria 10569
151 Ga0163161_10034054 3300017792 Bacteria 3642
152 Ga0163161_10808554 3300017792 Bacteria 788
153 Ga0163161_11280815 3300017792 Bacteria 637
154 Ga0213876_10002036 3300021384 Bacteria 12014
155 Ga0213876_10641728 3300021384 Unclassified 565
156 Ga0207425_1000023 3300025245 Bacteria 341339
157 Ga0209026_1002310 3300025250 Bacteria 7262
158 Ga0209129_1000032 3300025258 Bacteria 341150
159 Ga0209233_1002529 3300025261 Bacteria 6678
160 Ga0209676_1000008 3300025292 Bacteria 991778
161 Ga0209025_1000047 3300025294 Bacteria 341150
162 Ga0209758_1000144 3300025297 Bacteria 170724
163 Ga0209050_1000180 3300025298 Bacteria 142987
164 Ga0207647_10000159 3300025904 Bacteria 53276
165 Ga0207647_10378204 3300025904 Bacteria 800
166 Ga0207643_10424090 3300025908 Bacteria 843
167 Ga0207705_10012360 3300025909 Bacteria 6169
168 Ga0207705_11374676 3300025909 Unclassified 537
169 Ga0207654_10238340 3300025911 Bacteria 1214
170 Ga0207695_10000170 3300025913 Bacteria 192469
171 Ga0207695_10000682 3300025913 Bacteria 66574
172 Ga0207695_10022847 3300025913 Bacteria 7085
173 Ga0207671_10005263 3300025914 Bacteria 12003
174 Ga0207671_10026620 3300025914 Bacteria 4331
175 Ga0207671_10116417 3300025914 Bacteria 2039
176 Ga0207671_10245196 3300025914 Bacteria 1408
177 Ga0207652_10000739 3300025921 Bacteria 31538
178 Ga0207681_10299419 3300025923 Bacteria 1272
179 Ga0207687_10442569 3300025927 Bacteria 1076
180 Ga0207644_10686612 3300025931 Unclassified 853
181 Ga0207686_10142466 3300025934 Bacteria 1659
182 Ga0207669_10453116 3300025937 Unclassified 1017
183 Ga0207704_10711117 3300025938 Bacteria 833
184 Ga0207691_10163012 3300025940 Bacteria 1955
185 Ga0207689_10083793 3300025942 Bacteria 2621
186 Ga0207667_10110505 3300025949 Bacteria 2835
187 Ga0207667_10935686 3300025949 Bacteria 857
188 Ga0207667_10935970 3300025949 Bacteria 857
189 Ga0207712_10673242 3300025961 Bacteria 901
190 Ga0207668_11441241 3300025972 Bacteria 621
191 Ga0207658_10949028 3300025986 Bacteria 784
192 Ga0207658_11046925 3300025986 Bacteria 745
193 Ga0207677_10284488 3300026023 Bacteria 1359
194 Ga0207639_11124460 3300026041 Unclassified 737
195 Ga0207708_11499717 3300026075 Bacteria 592
196 Ga0207702_10006458 3300026078 Bacteria 10109
197 Ga0207641_11337522 3300026088 Unclassified 717
198 Ga0207648_10019430 3300026089 Bacteria 6132
199 Ga0207648_10094745 3300026089 Bacteria 2611
200 Ga0207676_10368298 3300026095 Bacteria 1334
201 Ga0207674_10014497 3300026116 Bacteria 8704
202 Ga0207674_10271744 3300026116 Bacteria 1643
203 Ga0207675_100048472 3300026118 Bacteria 3965
204 Ga0207683_11635415 3300026121 Bacteria 593
205 Ga0207698_10487730 3300026142 Bacteria 1197
206 Ga0268266_10000119 3300028379 Bacteria 162424
207 Ga0268265_10130257 3300028380 Bacteria 2089
208 Ga0307517_10003309 3300028786 Bacteria 25165
209 Ga0265327_10047653 3300031251 Bacteria 2259
210 Ga0265313_10283067 3300031595 Bacteria 670
211 Ga0307405_10000003 3300031731 Bacteria 569064
212 Ga0316577_10011797 3300031733 Bacteria 4742
213 Ga0307407_10000021 3300031903 Bacteria 122064
214 Ga0307412_10000017 3300031911 Bacteria 294698
215 Ga0307409_100028282 3300031995 Bacteria 3991
216 Ga0307416_100000232 3300032002 Bacteria 29680
217 Ga0307414_10009312 3300032004 Bacteria 5634
218 Ga0307414_10027507 3300032004 Bacteria 3676
219 Ga0307414_10052469 3300032004 Bacteria 2838
220 Ga0307414_10089103 3300032004 Bacteria 2285
221 Ga0316585_10041105 3300032137 Bacteria 1473
222 Ga0307510_10010191 3300033180 Bacteria 11173
223 Ga0316582_0074316 3300036647 Bacteria 2207
224 Ga0316584_0004269 3300036712 Bacteria 9439
225 Ga0395905_0191588 3300037471 Unclassified 1918
226 Ga0395901_1442445 3300038443 Bacteria 646
227 Ga0400489_87865 3300039093 Bacteria 1341
228 Ga0436365_1353234 3300039437 Unclassified 1670
229 Ga0436365_1599414 3300039437 Bacteria 46245
230 Ga0439465_0119360 3300041413 Bacteria 923
231 Ga0451806_186804 3300041462 Bacteria 1110
232 Ga0439445_0129368 3300042004 Bacteria 728
233 Ga0451577_1080849 3300042876 Unclassified 718
234 Ga0453684_0002902 3300044712 Bacteria 40172
235 Ga0453684_0014800 3300044712 Bacteria 12429
236 Ga0466968_0087816 3300044735 Bacteria 1374
237 Ga0451576_0000389 3300045051 Bacteria 102554
238 Ga0451576_0020983 3300045051 Bacteria 7107
239 Ga0495627_028882 3300046453 Bacteria 1769
240 Ga0495627_036196 3300046453 Bacteria 1535
241 Ga0495650_0061181 3300046471 Bacteria 1509
242 Ga0495583_0182353 3300046506 Bacteria 859
243 Ga0495606_0253505 3300046507 Bacteria 975
244 Ga0495610_0000148 3300046512 Bacteria 77303
245 Ga0495610_0000266 3300046512 Bacteria 54387
246 Ga0495610_0105613 3300046512 Bacteria 1255
247 Ga0495637_0091961 3300046520 Bacteria 1195
248 Ga0495633_0107302 3300046558 Bacteria 1295
249 Ga0495633_0128723 3300046558 Bacteria 1171
250 Ga0495625_0075038 3300046660 Bacteria 2367
251 Ga0495600_0568590 3300046809 Bacteria 691
252 Ga0495687_141212 3300047443 Bacteria 837
253 Ga0495681_0075939 3300047470 Bacteria 1511
254 Ga0495686_0355117 3300047472 Bacteria 796
255 Ga0496122_0001778 3300048925 Bacteria 33029
256 Ga0496123_0020777 3300048926 Bacteria 5124
257 Ga0496125_0130427 3300048928 Bacteria 1771
258 Ga0501249_017593 3300049679 Bacteria 1540
259 Ga0501080_0337645 3300049742 Bacteria 1362
260 nmdc:mga07m45_139610_c1 3300050496 Unclassified 658
261 nmdc:mga07m45_218097_c1 3300050496 Unclassified 1110
262 Ga0500635_0000699 3300053080 Bacteria 8501
263 Ga0500651_0004796 3300053093 Bacteria 7627
264 Ga0500608_088551 3300053122 Unclassified 1450
265 Ga0500559_0120708 3300053136 Bacteria 1219
266 Ga0500568_0300063 3300053139 Bacteria 583
267 Ga0500622_0005177 3300053156 Bacteria 7902
268 2586208175 2585427687 Bacteria 5544917
269 2738759694 2738541283 Bacteria 7222293
270 2738855273 2738541302 Bacteria 5944758
271 2739589304 2739367651 Bacteria 6359826
272 2739616276 2739367656 Bacteria 5152243
273 2739648450 2739367663 Bacteria 5040914
274 2819546722 2818991437 Bacteria 5805520
275 2842725470 2842722452 Bacteria 6263924
276 2842912749 2842909656 Bacteria 6185908
277 2849282037 2849281842 Bacteria 6065644
278 2881957680 2881955468 Bacteria 3545609
279 2904446893 2904445276 Bacteria 5310396
280 2946002450 2945997725 Bacteria 6404843
281 2954019336 2954016120 Bacteria 6446024
282 Ga0070664_100276101
283 SwRhRL2b_contig_466296
284 JGI24736J21556_1008683
285 JGI24740J21852_10117974
286 JGI24737J22298_10013116
287 JGI24743J22301_10072368
288 JGI24735J21928_10053770
289 JGI25157J39369_1011791
290 JGI25152J39213_1000173
291 JGI25150J39212_1000015
292 JGI25151J46595_10000043
293 JGI25165J46597_1020301
294 JGI25153J46596_10000009
295 rootH1_10014992
296 Ga0055536_1000036
297 Ga0055530_10001821
298 Ga0065714_10001936
299 Ga0065714_10006768
300 Ga0065714_10064423
301 Ga0065714_10467403
302 Ga0065704_10000199
303 Ga0065704_10403147
304 Ga0065704_10588764
305 Ga0070658_11677983
306 Ga0070676_10220612
307 Ga0070683_100024627
308 Ga0070670_100368330
309 Ga0068869_100232080
310 Ga0070680_100444405
311 Ga0070682_101585268
312 Ga0070660_100533536
313 Ga0070692_10220290
314 Ga0070668_100776106
315 Ga0070669_100308008
316 Ga0070669_100528897
317 Ga0070674_100556313
318 Ga0070673_100291141
319 Ga0070667_100241610
320 Ga0070667_100764733
321 Ga0070667_100934448
322 Ga0070700_101148219
323 Ga0068867_100014084
324 Ga0068867_100624218
325 Ga0070685_10312220
326 Ga0070679_100001653
327 Ga0070684_100303154
328 Ga0070684_102097736
329 Ga0068853_100133506
330 Ga0068853_100293555
331 Ga0068853_101157893
332 Ga0070672_102025005
333 Ga0070696_100721012
334 Ga0070665_100000034
335 Ga0068855_100191597
336 Ga0068855_101059904
337 Ga0068857_100013296
338 Ga0068857_100348907
339 Ga0068857_100575001
340 Ga0068864_100157057
341 Ga0068864_100552130
342 Ga0068864_100849686
343 Ga0068864_101025000
344 Ga0068861_100631061
345 Ga0068870_10008604
346 Ga0068860_100001563
347 Ga0075370_10576214
348 Ga0068871_100100060
349 Ga0068865_100647340
350 Ga0068865_100759888
351 Ga0105244_10116194
352 Ga0105240_10000646
353 Ga0105240_10000699
354 Ga0105240_10376301
355 Ga0105240_10666977
356 Ga0105245_10251792
357 Ga0105241_10123903
358 Ga0105241_10477423
359 Ga0105241_10634676
360 Ga0105241_11509755
361 Ga0105242_10584352
362 Ga0105242_10796331
363 Ga0105242_11037804
364 Ga0105242_11680659
365 Ga0105248_11383764
366 Ga0105237_10003260
367 Ga0105237_10043472
368 Ga0105237_10122379
369 Ga0105237_12370712
370 Ga0105249_10715620
371 Ga0105239_10001040
372 Ga0105239_10032361
373 Ga0105239_10967707
374 Ga0105239_11208249
375 Ga0157373_10000015
376 Ga0157373_10001198
377 Ga0157373_10038328
378 Ga0157373_11272508
379 Ga0157371_10000172
380 Ga0157371_10000684
381 Ga0157371_10003100
382 Ga0157371_10032074
383 Ga0157371_10149901
384 Ga0157370_10003635
385 Ga0157370_10003924
386 Ga0157370_10036622
387 Ga0157370_10243374
388 Ga0157370_10600280
389 Ga0157369_10000007
390 Ga0157369_10022526
391 Ga0157369_10140055
392 Ga0157369_11245639
393 Ga0157369_11435794
394 Ga0157374_10197486
395 Ga0157374_10273812
396 Ga0157374_10418448
397 Ga0157374_10808749
398 Ga0157378_10006889
399 Ga0157378_10146489
400 Ga0157378_10276748
401 Ga0163162_10000063
402 Ga0163162_10002489
403 Ga0163162_10203785
404 Ga0163162_10650028
405 Ga0163162_10957137
406 Ga0163162_13328367
407 Ga0157372_10002387
408 Ga0157372_10032422
409 Ga0157372_10084218
410 Ga0157372_10254398
411 Ga0157372_10720186
412 Ga0157372_11058949
413 Ga0157372_11341200
414 Ga0157375_10418671
415 Ga0163163_10064038
416 Ga0157380_12396416
417 Ga0182008_10000771
418 Ga0182008_10007012
419 Ga0157377_10692314
420 Ga0157377_10866766
421 Ga0157376_10137676
422 Ga0157376_11564570
423 Ga0182006_1000130
424 Ga0182006_1000581
425 Ga0182006_1002737
426 Ga0182006_1033637
427 Ga0182007_10000007
428 Ga0182005_1196032
429 Ga0183373_1001
430 Ga0163161_10000045
431 Ga0163161_10003812
432 Ga0163161_10034054
433 Ga0163161_10808554
434 Ga0163161_11280815
435 Ga0213876_10002036
436 Ga0213876_10641728
437 Ga0207425_1000023
438 Ga0209026_1002310
439 Ga0209129_1000032
440 Ga0209233_1002529
441 Ga0209676_1000008
442 Ga0209025_1000047
443 Ga0209758_1000144
444 Ga0209050_1000180
445 Ga0207647_10000159
446 Ga0207647_10378204
447 Ga0207643_10424090
448 Ga0207705_10012360
449 Ga0207705_11374676
450 Ga0207654_10238340
451 Ga0207695_10000170
452 Ga0207695_10000682
453 Ga0207695_10022847
454 Ga0207671_10005263
455 Ga0207671_10026620
456 Ga0207671_10116417
457 Ga0207671_10245196
458 Ga0207652_10000739
459 Ga0207681_10299419
460 Ga0207687_10442569
461 Ga0207644_10686612
462 Ga0207686_10142466
463 Ga0207669_10453116
464 Ga0207704_10711117
465 Ga0207691_10163012
466 Ga0207689_10083793
467 Ga0207667_10110505
468 Ga0207667_10935686
469 Ga0207667_10935970
470 Ga0207712_10673242
471 Ga0207668_11441241
472 Ga0207658_10949028
473 Ga0207658_11046925
474 Ga0207677_10284488
475 Ga0207639_11124460
476 Ga0207708_11499717
477 Ga0207702_10006458
478 Ga0207641_11337522
479 Ga0207648_10019430
480 Ga0207648_10094745
481 Ga0207676_10368298
482 Ga0207674_10014497
483 Ga0207674_10271744
484 Ga0207675_100048472
485 Ga0207683_11635415
486 Ga0207698_10487730
487 Ga0268266_10000119
488 Ga0268265_10130257
489 Ga0307517_10003309
490 Ga0265327_10047653
491 Ga0265313_10283067
492 Ga0307405_10000003
493 Ga0316577_10011797
494 Ga0307407_10000021
495 Ga0307412_10000017
496 Ga0307409_100028282
497 Ga0307416_100000232
498 Ga0307414_10009312
499 Ga0307414_10027507
500 Ga0307414_10052469
501 Ga0307414_10089103
502 Ga0316585_10041105
503 Ga0307510_10010191
504 Ga0316582_0074316
505 Ga0316584_0004269
506 Ga0395905_0191588
507 Ga0395901_1442445
508 Ga0400489_87865
509 Ga0436365_1353234
510 Ga0436365_1599414
511 Ga0439465_0119360
512 Ga0451806_186804
513 Ga0439445_0129368
514 Ga0451577_1080849
515 Ga0453684_0002902
516 Ga0453684_0014800
517 Ga0466968_0087816
518 Ga0451576_0000389
519 Ga0451576_0020983
520 Ga0495627_028882
521 Ga0495627_036196
522 Ga0495650_0061181
523 Ga0495583_0182353
524 Ga0495606_0253505
525 Ga0495610_0000148
526 Ga0495610_0000266
527 Ga0495610_0105613
528 Ga0495637_0091961
529 Ga0495633_0107302
530 Ga0495633_0128723
531 Ga0495625_0075038
532 Ga0495600_0568590
533 Ga0495687_141212
534 Ga0495681_0075939
535 Ga0495686_0355117
536 Ga0496122_0001778
537 Ga0496123_0020777
538 Ga0496125_0130427
539 Ga0501249_017593
540 Ga0501080_0337645
541 nmdc:mga07m45_139610_c1
542 nmdc:mga07m45_218097_c1
543 Ga0500635_0000699
544 Ga0500651_0004796
545 Ga0500608_088551
546 Ga0500559_0120708
547 Ga0500568_0300063
548 Ga0500622_0005177
549 2586208175
550 2738759694
551 2738855273
552 2739589304
553 2739616276
554 2739648450
555 2819546722
556 2842725470
557 2842912749
558 2849282037
559 2881957680
560 2904446893
561 2946002450
562 2954019336

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

26

141

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9361 18 77
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9216 18 76
5zuo-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.9018 30 78
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8758 18 77
1u5t-assembly1.cif.gz_A structure of the escrt-ii endosomal trafficking complex 0.8712 12 76
ID Description Score Start End Superfamily
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9373 16 77 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9361 18 77 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9347 14 75 1.10.10.10
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9216 18 76 1.10.10.10
1sd6A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9207 16 77 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7Y5MU04-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9446 9 90 GO:0003677
GO:0005737
GO:0045892
AF-A0A7Y5MU04-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9129 9 90 GO:0003677
GO:0005737
GO:0045892
AF-X0ZQJ1-F1-model_v4 Penicillinase repressor 0.8949 2 74 GO:0003677
GO:0045892
AF-A0A420YU64-F1-model_v4 CopY/TcrY family copper transport repressor 0.8938 7 86 GO:0003677
GO:0045892
AF-A0A6N9A374-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.889 1 82 GO:0003677
GO:0045892

Map