F384277

General Info

Members Datasets Scaffolds Average Seq Length
281 159 271 398

Family's Representative Sequence

Representative Sequence 3300009984|Ga0105029_101279|Ga0105029_1012791
Length 421
Sequence VSKPEKSPTLTQVMEQKKEEQFNLEEIKKKALEQFRSGKSLYGKDGAFAPLLKSFLEAALEGEMESHLDEDERQEGNRRNGKTRKTVQTSSGPVVLETSRDRNGTFEPELVKKRETVLADTLEGKILGMYGLGMSFRDISSHLKEMYDADISHSTLSAITDRIIPAIKEWQARPLESLYCIVWLDAMHYKVKDQGKIVSRAVYHILGINQEGRKELLGMYVSESEGANFWLGVLSDLRNRGLEDILIACIDNLKGFAEAIQATFPKTEVQSCIVHQIRNSLKYVASKDQKPFLTDLKEVYQASTKEFAEQQLDALDEKWGKKYPVVIASWRNNWAKLSTYFKYDPSIRKLIYTTNTIEGFHRQVRKVTKTKGAFPSDMALLKLIYLAYTNIQKKWTHPLQNWSITVSQLAIWFEGRMHLSI

Samples

Sample ID Description Type Environment
1 2739367651 Pedobacter sp. OK291 Isolate Unclassified
2 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
3 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
4 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
53 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
94 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
100 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
101 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
102 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
103 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
104 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
107 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
108 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
109 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
110 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
111 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
114 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
115 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
116 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
117 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
118 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
119 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
120 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
121 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
143 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
144 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
145 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
146 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
147 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
148 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
149 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
150 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
151 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
152 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
155 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
156 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
157 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
158 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
159 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.44
Metatranscriptomes 0
Isolates 3.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.2
Nodule 0
Rhizoplane 0.71
Rhizosphere 82.92
Stem 0
Stem Tuber 0
Unclassified 13.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1011604 3300001915 Bacteria 1534
2 JGI24740J21852_10038086 3300001979 Bacteria 1478
3 rootH1_10073719 3300003316 Bacteria 1352
4 rootH1_10097048 3300003316 Bacteria 1551
5 rootH2_10002202 3300003320 Bacteria 120052
6 rootH2_10009245 3300003320 Bacteria 27016
7 rootH2_10054091 3300003320 Bacteria 3491
8 rootH2_10054092 3300003320 Bacteria 6104
9 rootH2_10101222 3300003320 Unclassified 1367
10 rootL2_10103824 3300003322 Bacteria 5695
11 rootL2_10153601 3300003322 Bacteria 6173
12 rootH1_10002411 3300003323 Bacteria 3666
13 rootH1_10040578 3300003323 Bacteria 1467
14 rootH1_10053236 3300003323 Bacteria 1449
15 rootH1_10190823 3300003323 Bacteria 1310
16 Ga0070658_10144946 3300005327 Bacteria 1985
17 Ga0070658_10176730 3300005327 Bacteria 1796
18 Ga0070658_10206928 3300005327 Bacteria 1657
19 Ga0070658_10267172 3300005327 Unclassified 1454
20 Ga0070666_10010736 3300005335 Bacteria 5730
21 Ga0070680_100167023 3300005336 Bacteria 1850
22 Ga0070680_100176382 3300005336 Bacteria 1799
23 Ga0070680_100201080 3300005336 Bacteria 1680
24 Ga0068868_100323897 3300005338 Bacteria 1313
25 Ga0070660_100022871 3300005339 Bacteria 4628
26 Ga0070660_100151527 3300005339 Bacteria 1864
27 Ga0070660_100202036 3300005339 Bacteria 1612
28 Ga0070689_100199954 3300005340 Bacteria 1631
29 Ga0070661_100133625 3300005344 Bacteria 1865
30 Ga0070659_100035611 3300005366 Unclassified 3876
31 Ga0070659_100256614 3300005366 Unclassified 1450
32 Ga0070662_100089226 3300005457 Unclassified 2312
33 Ga0070681_10114433 3300005458 Unclassified 2636
34 Ga0070681_10168079 3300005458 Bacteria 2115
35 Ga0070681_10327103 3300005458 Bacteria 1442
36 Ga0070679_100239007 3300005530 Unclassified 1774
37 Ga0070679_100279604 3300005530 Unclassified 1622
38 Ga0070684_100009909 3300005535 Bacteria 7530
39 Ga0070684_100173531 3300005535 Bacteria 1959
40 Ga0070684_100202046 3300005535 Bacteria 1810
41 Ga0070697_100278333 3300005536 Bacteria 1435
42 Ga0068853_100300671 3300005539 Unclassified 1483
43 Ga0068853_100336232 3300005539 Bacteria 1402
44 Ga0068855_100063462 3300005563 Bacteria 4311
45 Ga0068855_100179090 3300005563 Bacteria 2397
46 Ga0068855_100280934 3300005563 Bacteria 1849
47 Ga0068855_100349654 3300005563 Bacteria 1628
48 Ga0068855_100363729 3300005563 Unclassified 1592
49 Ga0068855_100434587 3300005563 Bacteria 1434
50 Ga0070664_100273695 3300005564 Bacteria 1521
51 Ga0068857_100079278 3300005577 Unclassified 2932
52 Ga0068857_100134451 3300005577 Bacteria 2232
53 Ga0068857_100295478 3300005577 Unclassified 1492
54 Ga0068856_100155311 3300005614 Bacteria 2298
55 Ga0068856_100380138 3300005614 Bacteria 1431
56 Ga0068852_100039308 3300005616 Bacteria 3982
57 Ga0068852_100260969 3300005616 Unclassified 1663
58 Ga0068852_100320505 3300005616 Bacteria 1505
59 Ga0068858_100284827 3300005842 Unclassified 1574
60 Ga0068860_100298586 3300005843 Unclassified 1577
61 Ga0068862_100079056 3300005844 Bacteria 2851
62 Ga0068862_100185991 3300005844 Viruses 1867
63 Ga0070717_10234748 3300006028 Bacteria 1615
64 Ga0075364_10170532 3300006051 Unclassified 1471
65 Ga0097621_100045167 3300006237 Bacteria 3557
66 Ga0105240_10000232 3300009093 Bacteria 110394
67 Ga0105240_10019373 3300009093 Bacteria 9092
68 Ga0105240_10021831 3300009093 Bacteria 8507
69 Ga0105240_10023871 3300009093 Bacteria 8077
70 Ga0105240_10164845 3300009093 Bacteria 2629
71 Ga0105240_10354270 3300009093 Bacteria 1664
72 Ga0105240_10367807 3300009093 Bacteria 1627
73 Ga0105241_10054545 3300009174 Bacteria 3060
74 Ga0105241_10216583 3300009174 Unclassified 1607
75 Ga0105237_10004986 3300009545 Bacteria 15131
76 Ga0105237_10022364 3300009545 Bacteria 6488
77 Ga0105249_10174763 3300009553 Unclassified 2085
78 Ga0105249_10341914 3300009553 Bacteria 1513
79 Ga0105029_101279 3300009984 Bacteria 1535
80 Ga0105239_10274752 3300010375 Bacteria 1896
81 Ga0105239_10340354 3300010375 Unclassified 1693
82 Ga0157373_10006680 3300013100 Bacteria 8592
83 Ga0157373_10160154 3300013100 Unclassified 1584
84 Ga0157371_10084409 3300013102 Bacteria 2250
85 Ga0157371_10113479 3300013102 Bacteria 1924
86 Ga0157371_10131806 3300013102 Bacteria 1779
87 Ga0157371_10133746 3300013102 Bacteria 1765
88 Ga0157371_10154844 3300013102 Bacteria 1635
89 Ga0157371_10165601 3300013102 Unclassified 1579
90 Ga0157371_10177477 3300013102 Bacteria 1523
91 Ga0157370_10025994 3300013104 Bacteria 5785
92 Ga0157370_10138029 3300013104 Unclassified 2272
93 Ga0157370_10139538 3300013104 Unclassified 2259
94 Ga0157370_10226423 3300013104 Bacteria 1731
95 Ga0157370_10271861 3300013104 Unclassified 1566
96 Ga0157369_10378725 3300013105 Bacteria 1469
97 Ga0157369_10437236 3300013105 Bacteria 1355
98 Ga0157374_10116154 3300013296 Bacteria 2578
99 Ga0157374_10355274 3300013296 Bacteria 1457
100 Ga0157378_10091954 3300013297 Bacteria 2760
101 Ga0157378_10425764 3300013297 Bacteria 1313
102 Ga0163162_10000423 3300013306 Bacteria 39010
103 Ga0157372_10073267 3300013307 Bacteria 3860
104 Ga0157372_10273839 3300013307 Bacteria 1962
105 Ga0157372_10371887 3300013307 Bacteria 1665
106 Ga0163163_10206990 3300014325 Bacteria 2010
107 Ga0157380_10249622 3300014326 Bacteria 1605
108 Ga0182006_1024083 3300015261 Bacteria 2514
109 Ga0182006_1034150 3300015261 Bacteria 2036
110 Ga0209050_1019282 3300025298 Bacteria 2599
111 Ga0207680_10124840 3300025903 Unclassified 1688
112 Ga0207647_10054928 3300025904 Bacteria 2448
113 Ga0207647_10127667 3300025904 Bacteria 1496
114 Ga0207705_10190617 3300025909 Unclassified 1550
115 Ga0207705_10201946 3300025909 Bacteria 1506
116 Ga0207705_10207256 3300025909 Bacteria 1486
117 Ga0207654_10032415 3300025911 Bacteria 2887
118 Ga0207654_10127226 3300025911 Bacteria 1608
119 Ga0207707_10131090 3300025912 Unclassified 2192
120 Ga0207707_10231543 3300025912 Bacteria 1607
121 Ga0207707_10253519 3300025912 Bacteria 1528
122 Ga0207707_10313721 3300025912 Bacteria 1355
123 Ga0207695_10000169 3300025913 Bacteria 192566
124 Ga0207695_10012598 3300025913 Bacteria 10134
125 Ga0207695_10027072 3300025913 Bacteria 6388
126 Ga0207695_10118562 3300025913 Bacteria 2617
127 Ga0207695_10205213 3300025913 Bacteria 1884
128 Ga0207695_10261595 3300025913 Bacteria 1628
129 Ga0207671_10010140 3300025914 Bacteria 7807
130 Ga0207671_10017608 3300025914 Bacteria 5502
131 Ga0207660_10222989 3300025917 Bacteria 1480
132 Ga0207657_10014423 3300025919 Bacteria 7719
133 Ga0207657_10096858 3300025919 Bacteria 2454
134 Ga0207657_10209239 3300025919 Bacteria 1566
135 Ga0207649_10116206 3300025920 Bacteria 1796
136 Ga0207652_10255574 3300025921 Bacteria 1580
137 Ga0207652_10277366 3300025921 Bacteria 1512
138 Ga0207694_10076760 3300025924 Bacteria 2617
139 Ga0207690_10204994 3300025932 Bacteria 1500
140 Ga0207670_10192829 3300025936 Bacteria 1543
141 Ga0207661_10036551 3300025944 Bacteria 3834
142 Ga0207679_10065493 3300025945 Bacteria 2719
143 Ga0207667_10000905 3300025949 Bacteria 37857
144 Ga0207667_10011623 3300025949 Bacteria 10221
145 Ga0207667_10347346 3300025949 Bacteria 1513
146 Ga0207667_10390548 3300025949 Unclassified 1417
147 Ga0207668_10300969 3300025972 Bacteria 1323
148 Ga0207677_10161309 3300026023 Bacteria 1742
149 Ga0207639_10192180 3300026041 Bacteria 1744
150 Ga0207639_10250340 3300026041 Unclassified 1545
151 Ga0207639_10258722 3300026041 Bacteria 1521
152 Ga0207702_10021405 3300026078 Bacteria 5353
153 Ga0207702_10313028 3300026078 Bacteria 1493
154 Ga0207674_10059618 3300026116 Bacteria 3861
155 Ga0207674_10064926 3300026116 Bacteria 3681
156 Ga0207674_10095661 3300026116 Bacteria 2956
157 Ga0207674_10146271 3300026116 Unclassified 2322
158 Ga0207674_10203813 3300026116 Bacteria 1927
159 Ga0207698_10162400 3300026142 Bacteria 1956
160 Ga0268266_10402388 3300028379 Bacteria 1294
161 Ga0268265_10206410 3300028380 Bacteria 1708
162 Ga0268265_10309206 3300028380 Viruses 1426
163 Ga0268264_10000041 3300028381 Bacteria 372501
164 Ga0268264_10273800 3300028381 Unclassified 1578
165 Ga0307508_10220338 3300031616 Bacteria 1497
166 Ga0307516_10000379 3300031730 Bacteria 58257
167 Ga0307405_10186315 3300031731 Bacteria 1494
168 Ga0307413_10206131 3300031824 Bacteria 1424
169 Ga0307413_10209479 3300031824 Bacteria 1414
170 Ga0307410_10128820 3300031852 Bacteria 1856
171 Ga0307407_10139861 3300031903 Bacteria 1560
172 Ga0307412_10220140 3300031911 Bacteria 1454
173 Ga0307416_100375612 3300032002 Bacteria 1449
174 Ga0307414_10115696 3300032004 Bacteria 2051
175 Ga0307414_10125632 3300032004 Bacteria 1981
176 Ga0307414_10179661 3300032004 Bacteria 1701
177 Ga0307414_10199749 3300032004 Bacteria 1625
178 Ga0307414_10215238 3300032004 Unclassified 1573
179 Ga0307414_10273219 3300032004 Bacteria 1416
180 Ga0307411_10169743 3300032005 Bacteria 1643
181 Ga0307415_100211940 3300032126 Bacteria 1546
182 Ga0307510_10030558 3300033180 Bacteria 6104
183 Ga0373935_0087511 3300035692 Bacteria 2034
184 Ga0316582_0141629 3300036647 Unclassified 1621
185 Ga0316582_0178215 3300036647 Bacteria 1445
186 Ga0316584_0137378 3300036712 Bacteria 1824
187 Ga0395899_0000806 3300037312 Bacteria 30625
188 Ga0395899_0093730 3300037312 Bacteria 2173
189 Ga0395899_0171713 3300037312 Bacteria 1526
190 Ga0395899_0182323 3300037312 Bacteria 1473
191 Ga0395899_0183066 3300037312 Unclassified 1469
192 Ga0395900_0034164 3300037418 Bacteria 5235
193 Ga0395900_0258077 3300037418 Bacteria 1741
194 Ga0395900_0343110 3300037418 Bacteria 1468
195 Ga0395898_0003048 3300037466 Bacteria 18987
196 Ga0395898_0054623 3300037466 Bacteria 3896
197 Ga0395898_0326855 3300037466 Bacteria 1462
198 Ga0395901_0024029 3300038443 Bacteria 6251
199 Ga0395901_0296912 3300038443 Bacteria 1675
200 Ga0395901_0322667 3300038443 Bacteria 1597
201 Ga0400484_02964 3300038725 Bacteria 7737
202 Ga0400491_07149 3300038727 Bacteria 1565
203 Ga0400488_02236 3300038741 Bacteria 4172
204 Ga0400488_56657 3300038741 Bacteria 1805
205 Ga0400483_060274 3300039062 Bacteria 1386
206 Ga0400483_282367 3300039062 Bacteria 1276
207 Ga0400489_71599 3300039093 Bacteria 1519
208 Ga0400489_88682 3300039093 Bacteria 2820
209 Ga0400487_47433 3300039110 Bacteria 3926
210 Ga0436365_0520212 3300039437 Bacteria 2271
211 Ga0439436_0024013 3300041404 Bacteria 1801
212 Ga0439438_030550 3300041405 Bacteria 1436
213 Ga0439439_0018169 3300041406 Bacteria 1735
214 Ga0439461_0017970 3300041410 Bacteria 1379
215 Ga0439465_0014323 3300041413 Bacteria 2472
216 Ga0451807_0024369 3300041486 Bacteria 1985
217 Ga0451807_2492621 3300041486 Bacteria 1883
218 Ga0451853_1995651 3300041512 Bacteria 4893
219 Ga0439431_0011183 3300041997 Bacteria 2046
220 Ga0439442_012925 3300042002 Bacteria 1710
221 Ga0439445_0010830 3300042004 Bacteria 2165
222 Ga0439457_017246 3300042014 Bacteria 1604
223 Ga0439462_0007461 3300042015 Bacteria 2738
224 Ga0450897_000311 3300042128 Bacteria 2577
225 Ga0450905_006700 3300042142 Bacteria 1562
226 Ga0439446_0017527 3300042156 Bacteria 2002
227 Ga0439434_0023659 3300042435 Bacteria 1850
228 Ga0466972_0070307 3300044658 Unclassified 1670
229 Ga0466965_0070818 3300044683 Bacteria 1753
230 Ga0466970_0089505 3300044765 Bacteria 1670
231 Ga0466957_0112368 3300044842 Unclassified 1729
232 Ga0451576_0325925 3300045051 Unclassified 1607
233 Ga0451576_0628422 3300045051 Bacteria 1128
234 Ga0495651_0195074 3300046462 Bacteria 1422
235 Ga0495630_0247077 3300046517 Bacteria 1363
236 Ga0495643_0115572 3300046522 Bacteria 1360
237 Ga0495668_0000153 3300046616 Bacteria 104580
238 Ga0495625_0116096 3300046660 Bacteria 1826
239 Ga0495636_0000670 3300047318 Bacteria 12571
240 Ga0495686_0042201 3300047472 Unclassified 2902
241 Ga0495686_0107273 3300047472 Bacteria 1678
242 Ga0495686_0146114 3300047472 Bacteria 1391
243 Ga0496122_0001885 3300048925 Bacteria 31746
244 Ga0496125_0101309 3300048928 Bacteria 2120
245 Ga0501032_0105488 3300049569 Bacteria 1867
246 Ga0501033_0130688 3300049570 Bacteria 1819
247 Ga0501034_0066277 3300049571 Unclassified 3624
248 Ga0501034_0239123 3300049571 Bacteria 1762
249 Ga0501038_0240773 3300049574 Bacteria 1436
250 Ga0501046_0187683 3300049580 Bacteria 1543
251 Ga0501048_0159663 3300049582 Bacteria 1595
252 Ga0501206_003283 3300049653 Unclassified 2052
253 Ga0501223_018387 3300049663 Bacteria 1375
254 Ga0501239_004417 3300049672 Bacteria 1379
255 Ga0501250_004723 3300049680 Bacteria 1370
256 Ga0501251_005138 3300049681 Bacteria 1377
257 Ga0501253_008232 3300049683 Bacteria 1492
258 Ga0501261_008716 3300049690 Bacteria 1313
259 Ga0501225_0038976 3300049705 Bacteria 1309
260 Ga0501241_002018 3300049758 Bacteria 3981
261 Ga0501270_001857 3300049767 Bacteria 2093
262 Ga0501271_002463 3300049768 Bacteria 1655
263 Ga0501035_0139264 3300049822 Bacteria 2110
264 Ga0501035_0357137 3300049822 Bacteria 1222
265 Ga0500646_0027320 3300053090 Bacteria 1552
266 Ga0500646_0028031 3300053090 Bacteria 1536
267 Ga0500559_0065180 3300053136 Bacteria 1631
268 Ga0500588_0023352 3300053146 Unclassified 1694
269 Ga0500616_0057121 3300053153 Bacteria 2034
270 Ga0500645_026952 3300053730 Bacteria 1745
271 Ga0500661_003496 3300055283 Bacteria 2946

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025924 Ga0207694_10076760 Ga0207694_100767602 332
2 3300039062 Ga0400483_282367 Ga0400483_282367_22_1035 334
3 3300005539 Ga0068853_100336232 Ga0068853_1003362322 337
4 3300039062 Ga0400483_060274 Ga0400483_060274_13_1077 351
5 3300009093 Ga0105240_10354270 Ga0105240_103542701 355
6 3300003320 rootH2_10002202 rootH2_1000220271 359
7 3300006051 Ga0075364_10170532 Ga0075364_101705323 359
8 3300045051 Ga0451576_0628422 Ga0451576_0628422_15_1115 359
9 iso_pu_bacteria 2916178963 2916179181 361
10 3300049822 Ga0501035_0357137 Ga0501035_0357137_26_1150 368
11 3300045051 Ga0451576_0325925 Ga0451576_0325925_290_1513 378
12 3300001979 JGI24740J21852_10038086 JGI24740J21852_100380861 379
13 3300005614 Ga0068856_100155311 Ga0068856_1001553111 379
14 3300009174 Ga0105241_10216583 Ga0105241_102165832 379
15 3300013100 Ga0157373_10006680 Ga0157373_100066808 379
16 3300013102 Ga0157371_10133746 Ga0157371_101337461 379
17 3300013105 Ga0157369_10378725 Ga0157369_103787252 379
18 3300013307 Ga0157372_10273839 Ga0157372_102738392 379
19 3300025911 Ga0207654_10127226 Ga0207654_101272262 379
20 3300026078 Ga0207702_10313028 Ga0207702_103130282 379
21 3300037312 Ga0395899_0171713 Ga0395899_0171713_201_1424 379
22 3300037418 Ga0395900_0258077 Ga0395900_0258077_478_1701 379
23 3300037466 Ga0395898_0054623 Ga0395898_0054623_2467_3690 379
24 3300038443 Ga0395901_0322667 Ga0395901_0322667_174_1397 379
25 3300049571 Ga0501034_0066277 Ga0501034_0066277_1039_2265 379
26 3300005327 Ga0070658_10206928 Ga0070658_102069281 380
27 3300005336 Ga0070680_100201080 Ga0070680_1002010801 380
28 3300005339 Ga0070660_100151527 Ga0070660_1001515271 380
29 3300005366 Ga0070659_100035611 Ga0070659_1000356113 380
30 3300005458 Ga0070681_10327103 Ga0070681_103271031 380
31 3300005563 Ga0068855_100179090 Ga0068855_1001790901 380
32 3300013104 Ga0157370_10226423 Ga0157370_102264231 380
33 3300025904 Ga0207647_10054928 Ga0207647_100549282 380
34 3300025909 Ga0207705_10207256 Ga0207705_102072561 380
35 3300025912 Ga0207707_10253519 Ga0207707_102535191 380
36 3300025919 Ga0207657_10096858 Ga0207657_100968582 380
37 3300025921 Ga0207652_10277366 Ga0207652_102773661 380
38 3300025932 Ga0207690_10204994 Ga0207690_102049941 380
39 3300025949 Ga0207667_10347346 Ga0207667_103473461 380
40 3300026041 Ga0207639_10258722 Ga0207639_102587221 380
41 3300026116 Ga0207674_10146271 Ga0207674_101462711 380
42 3300013102 Ga0157371_10177477 Ga0157371_101774771 381
43 3300013104 Ga0157370_10271861 Ga0157370_102718611 381
44 3300037312 Ga0395899_0183066 Ga0395899_0183066_67_1290 381
45 3300037418 Ga0395900_0034164 Ga0395900_0034164_3945_5168 381
46 3300037466 Ga0395898_0003048 Ga0395898_0003048_8067_9290 381
47 3300038443 Ga0395901_0024029 Ga0395901_0024029_4484_5707 381
48 3300047318 Ga0495636_0000670 Ga0495636_0000670_6993_8225 381
49 3300003322 rootL2_10153601 rootL2_101536011 382
50 3300005327 Ga0070658_10176730 Ga0070658_101767302 382
51 3300005336 Ga0070680_100167023 Ga0070680_1001670231 382
52 3300005535 Ga0070684_100173531 Ga0070684_1001735313 382
53 3300005563 Ga0068855_100363729 Ga0068855_1003637292 382
54 3300005577 Ga0068857_100079278 Ga0068857_1000792781 382
55 3300013102 Ga0157371_10113479 Ga0157371_101134792 382
56 3300025912 Ga0207707_10313721 Ga0207707_103137212 382
57 3300026116 Ga0207674_10203813 Ga0207674_102038132 382
58 3300037312 Ga0395899_0093730 Ga0395899_0093730_750_1973 382
59 3300037418 Ga0395900_0343110 Ga0395900_0343110_178_1401 382
60 3300037466 Ga0395898_0326855 Ga0395898_0326855_170_1393 382
61 3300038443 Ga0395901_0296912 Ga0395901_0296912_262_1485 382
62 3300053146 Ga0500588_0023352 Ga0500588_0023352_98_1321 382
63 3300031824 Ga0307413_10206131 Ga0307413_102061311 383
64 3300032004 Ga0307414_10215238 Ga0307414_102152382 383
65 3300003320 rootH2_10009245 rootH2_1000924526 384
66 3300014326 Ga0157380_10249622 Ga0157380_102496221 385
67 3300005563 Ga0068855_100280934 Ga0068855_1002809342 386
68 3300036712 Ga0316584_0137378 Ga0316584_0137378_114_1325 386
69 3300053090 Ga0500646_0028031 Ga0500646_0028031_196_1428 386
70 3300005614 Ga0068856_100380138 Ga0068856_1003801381 387
71 3300025298 Ga0209050_1019282 Ga0209050_10192821 387
72 3300026078 Ga0207702_10021405 Ga0207702_100214051 387
73 3300026116 Ga0207674_10095661 Ga0207674_100956612 387
74 3300041486 Ga0451807_0024369 Ga0451807_0024369_658_1884 387
75 3300041512 Ga0451853_1995651 Ga0451853_1995651_989_2215 387
76 3300013102 Ga0157371_10084409 Ga0157371_100844092 388
77 3300014325 Ga0163163_10206990 Ga0163163_102069901 388
78 3300025914 Ga0207671_10010140 Ga0207671_100101406 388
79 3300041404 Ga0439436_0024013 Ga0439436_0024013_449_1675 388
80 3300041405 Ga0439438_030550 Ga0439438_030550_84_1310 388
81 3300041406 Ga0439439_0018169 Ga0439439_0018169_20_1246 388
82 3300041410 Ga0439461_0017970 Ga0439461_0017970_93_1319 388
83 3300041413 Ga0439465_0014323 Ga0439465_0014323_56_1282 388
84 3300041997 Ga0439431_0011183 Ga0439431_0011183_396_1622 388
85 3300042002 Ga0439442_012925 Ga0439442_012925_373_1599 388
86 3300042004 Ga0439445_0010830 Ga0439445_0010830_783_2009 388
87 3300042014 Ga0439457_017246 Ga0439457_017246_232_1458 388
88 3300042015 Ga0439462_0007461 Ga0439462_0007461_122_1348 388
89 3300042128 Ga0450897_000311 Ga0450897_000311_1284_2510 388
90 3300042156 Ga0439446_0017527 Ga0439446_0017527_427_1653 388
91 3300042435 Ga0439434_0023659 Ga0439434_0023659_567_1793 388
92 3300048925 Ga0496122_0001885 Ga0496122_0001885_11447_12670 388
93 3300048928 Ga0496125_0101309 Ga0496125_0101309_328_1551 388
94 3300053136 Ga0500559_0065180 Ga0500559_0065180_273_1493 388
95 3300013297 Ga0157378_10091954 Ga0157378_100919543 389
96 3300003316 rootH1_10073719 rootH1_100737191 390
97 3300003323 rootH1_10002411 rootH1_100024113 390
98 3300003323 rootH1_10053236 rootH1_100532361 390
99 3300005563 Ga0068855_100434587 Ga0068855_1004345871 390
100 3300044765 Ga0466970_0089505 Ga0466970_0089505_70_1290 390
101 3300046517 Ga0495630_0247077 Ga0495630_0247077_49_1272 390
102 3300005338 Ga0068868_100323897 Ga0068868_1003238971 391
103 3300005616 Ga0068852_100039308 Ga0068852_1000393083 391
104 3300013296 Ga0157374_10355274 Ga0157374_103552741 391
105 3300013297 Ga0157378_10425764 Ga0157378_104257641 391
106 3300026023 Ga0207677_10161309 Ga0207677_101613091 391
107 3300026142 Ga0207698_10162400 Ga0207698_101624002 391
108 3300039437 Ga0436365_0520212 Ga0436365_0520212_335_1561 391
109 3300031616 Ga0307508_10220338 Ga0307508_102203382 392
110 3300037312 Ga0395899_0182323 Ga0395899_0182323_81_1322 392
111 3300005844 Ga0068862_100079056 Ga0068862_1000790562 394
112 3300009174 Ga0105241_10054545 Ga0105241_100545452 394
113 3300025911 Ga0207654_10032415 Ga0207654_100324152 394
114 3300028380 Ga0268265_10206410 Ga0268265_102064102 394
115 3300031731 Ga0307405_10186315 Ga0307405_101863151 394
116 3300031824 Ga0307413_10209479 Ga0307413_102094791 394
117 3300031852 Ga0307410_10128820 Ga0307410_101288202 394
118 3300031903 Ga0307407_10139861 Ga0307407_101398611 394
119 3300031911 Ga0307412_10220140 Ga0307412_102201401 394
120 3300032002 Ga0307416_100375612 Ga0307416_1003756121 394
121 3300032004 Ga0307414_10273219 Ga0307414_102732191 394
122 3300032005 Ga0307411_10169743 Ga0307411_101697431 394
123 3300032126 Ga0307415_100211940 Ga0307415_1002119401 394
124 3300049663 Ga0501223_018387 Ga0501223_018387_83_1345 394
125 3300049672 Ga0501239_004417 Ga0501239_004417_33_1295 394
126 3300049680 Ga0501250_004723 Ga0501250_004723_33_1295 394
127 3300049681 Ga0501251_005138 Ga0501251_005138_26_1288 394
128 3300049683 Ga0501253_008232 Ga0501253_008232_57_1319 394
129 3300049690 Ga0501261_008716 Ga0501261_008716_30_1292 394
130 3300049705 Ga0501225_0038976 Ga0501225_0038976_32_1294 394
131 3300049767 Ga0501270_001857 Ga0501270_001857_312_1574 394
132 3300049768 Ga0501271_002463 Ga0501271_002463_336_1598 394
133 3300047472 Ga0495686_0146114 Ga0495686_0146114_84_1301 395
134 3300046462 Ga0495651_0195074 Ga0495651_0195074_184_1410 396
135 3300046660 Ga0495625_0116096 Ga0495625_0116096_282_1508 396
136 3300005344 Ga0070661_100133625 Ga0070661_1001336251 397
137 3300005366 Ga0070659_100256614 Ga0070659_1002566141 397
138 3300005457 Ga0070662_100089226 Ga0070662_1000892261 397
139 3300005535 Ga0070684_100009909 Ga0070684_1000099094 397
140 3300005564 Ga0070664_100273695 Ga0070664_1002736951 397
141 3300005577 Ga0068857_100134451 Ga0068857_1001344513 397
142 3300025920 Ga0207649_10116206 Ga0207649_101162062 397
143 3300025944 Ga0207661_10036551 Ga0207661_100365511 397
144 3300025945 Ga0207679_10065493 Ga0207679_100654932 397
145 3300026116 Ga0207674_10059618 Ga0207674_100596181 397
146 3300042142 Ga0450905_006700 Ga0450905_006700_211_1413 397
147 3300032004 Ga0307414_10125632 Ga0307414_101256322 399
148 3300038725 Ga0400484_02964 Ga0400484_02964_359_1570 399
149 3300038727 Ga0400491_07149 Ga0400491_07149_182_1390 399
150 3300038741 Ga0400488_02236 Ga0400488_02236_18_1226 399
151 3300038741 Ga0400488_56657 Ga0400488_56657_308_1516 399
152 3300039093 Ga0400489_71599 Ga0400489_71599_176_1384 399
153 3300039093 Ga0400489_88682 Ga0400489_88682_137_1345 399
154 3300039110 Ga0400487_47433 Ga0400487_47433_737_1945 399
155 iso_pu_bacteria 2739367651 2739591419 399
156 iso_pu_bacteria 2884791551 2884792153 399
157 iso_pu_bacteria 2884791551 2884792713 399
158 iso_pu_bacteria 2884791551 2884794355 399
159 iso_pu_bacteria 2884791551 2884794640 399
160 iso_pu_bacteria 2884791551 2884797081 399
161 iso_pu_bacteria 2884791551 2884798202 399
162 iso_pu_bacteria 2884791551 2884798357 399
163 3300046522 Ga0495643_0115572 Ga0495643_0115572_77_1288 400
164 iso_pu_bacteria 2896344016 2896344314 400
165 3300053730 Ga0500645_026952 Ga0500645_026952_484_1701 401
166 3300009553 Ga0105249_10341914 Ga0105249_103419142 402
167 3300013102 Ga0157371_10131806 Ga0157371_101318061 402
168 3300025972 Ga0207668_10300969 Ga0207668_103009691 402
169 3300028379 Ga0268266_10402388 Ga0268266_104023881 402
170 3300044683 Ga0466965_0070818 Ga0466965_0070818_70_1299 402
171 3300044842 Ga0466957_0112368 Ga0466957_0112368_167_1396 402
172 3300049653 Ga0501206_003283 Ga0501206_003283_70_1278 402
173 3300001915 JGI24741J21665_1011604 JGI24741J21665_10116041 403
174 3300003316 rootH1_10097048 rootH1_100970482 403
175 3300003320 rootH2_10054091 rootH2_100540912 403
176 3300003320 rootH2_10054092 rootH2_100540924 403
177 3300003320 rootH2_10101222 rootH2_101012221 403
178 3300003322 rootL2_10103824 rootL2_101038243 403
179 3300003323 rootH1_10040578 rootH1_100405781 403
180 3300003323 rootH1_10190823 rootH1_101908231 403
181 3300005327 Ga0070658_10144946 Ga0070658_101449461 403
182 3300005327 Ga0070658_10267172 Ga0070658_102671722 403
183 3300005335 Ga0070666_10010736 Ga0070666_100107366 403
184 3300005336 Ga0070680_100176382 Ga0070680_1001763821 403
185 3300005339 Ga0070660_100022871 Ga0070660_1000228712 403
186 3300005339 Ga0070660_100202036 Ga0070660_1002020361 403
187 3300005340 Ga0070689_100199954 Ga0070689_1001999541 403
188 3300005458 Ga0070681_10114433 Ga0070681_101144331 403
189 3300005458 Ga0070681_10168079 Ga0070681_101680792 403
190 3300005530 Ga0070679_100239007 Ga0070679_1002390072 403
191 3300005530 Ga0070679_100279604 Ga0070679_1002796042 403
192 3300005535 Ga0070684_100202046 Ga0070684_1002020462 403
193 3300005536 Ga0070697_100278333 Ga0070697_1002783331 403
194 3300005539 Ga0068853_100300671 Ga0068853_1003006711 403
195 3300005563 Ga0068855_100063462 Ga0068855_1000634624 403
196 3300005563 Ga0068855_100349654 Ga0068855_1003496542 403
197 3300005577 Ga0068857_100295478 Ga0068857_1002954781 403
198 3300005616 Ga0068852_100260969 Ga0068852_1002609691 403
199 3300005616 Ga0068852_100320505 Ga0068852_1003205051 403
200 3300005842 Ga0068858_100284827 Ga0068858_1002848272 403
201 3300005843 Ga0068860_100298586 Ga0068860_1002985861 403
202 3300005844 Ga0068862_100185991 Ga0068862_1001859912 403
203 3300006028 Ga0070717_10234748 Ga0070717_102347482 403
204 3300006237 Ga0097621_100045167 Ga0097621_1000451673 403
205 3300009093 Ga0105240_10000232 Ga0105240_1000023222 403
206 3300009093 Ga0105240_10019373 Ga0105240_100193735 403
207 3300009093 Ga0105240_10021831 Ga0105240_1002183110 403
208 3300009093 Ga0105240_10023871 Ga0105240_100238719 403
209 3300009093 Ga0105240_10164845 Ga0105240_101648453 403
210 3300009093 Ga0105240_10367807 Ga0105240_103678071 403
211 3300009545 Ga0105237_10004986 Ga0105237_100049867 403
212 3300009545 Ga0105237_10022364 Ga0105237_100223642 403
213 3300009553 Ga0105249_10174763 Ga0105249_101747632 403
214 3300009984 Ga0105029_101279 Ga0105029_1012791 403
215 3300010375 Ga0105239_10274752 Ga0105239_102747521 403
216 3300010375 Ga0105239_10340354 Ga0105239_103403541 403
217 3300013100 Ga0157373_10160154 Ga0157373_101601541 403
218 3300013102 Ga0157371_10154844 Ga0157371_101548442 403
219 3300013102 Ga0157371_10165601 Ga0157371_101656012 403
220 3300013104 Ga0157370_10025994 Ga0157370_100259942 403
221 3300013104 Ga0157370_10138029 Ga0157370_101380291 403
222 3300013104 Ga0157370_10139538 Ga0157370_101395381 403
223 3300013105 Ga0157369_10437236 Ga0157369_104372361 403
224 3300013296 Ga0157374_10116154 Ga0157374_101161542 403
225 3300013306 Ga0163162_10000423 Ga0163162_1000042317 403
226 3300013307 Ga0157372_10073267 Ga0157372_100732671 403
227 3300013307 Ga0157372_10371887 Ga0157372_103718871 403
228 3300015261 Ga0182006_1024083 Ga0182006_10240832 403
229 3300015261 Ga0182006_1034150 Ga0182006_10341501 403
230 3300025903 Ga0207680_10124840 Ga0207680_101248402 403
231 3300025904 Ga0207647_10127667 Ga0207647_101276672 403
232 3300025909 Ga0207705_10190617 Ga0207705_101906171 403
233 3300025909 Ga0207705_10201946 Ga0207705_102019461 403
234 3300025912 Ga0207707_10131090 Ga0207707_101310902 403
235 3300025912 Ga0207707_10231543 Ga0207707_102315431 403
236 3300025913 Ga0207695_10000169 Ga0207695_10000169158 403
237 3300025913 Ga0207695_10012598 Ga0207695_100125989 403
238 3300025913 Ga0207695_10027072 Ga0207695_100270726 403
239 3300025913 Ga0207695_10118562 Ga0207695_101185621 403
240 3300025913 Ga0207695_10205213 Ga0207695_102052132 403
241 3300025913 Ga0207695_10261595 Ga0207695_102615951 403
242 3300025914 Ga0207671_10017608 Ga0207671_100176083 403
243 3300025917 Ga0207660_10222989 Ga0207660_102229891 403
244 3300025919 Ga0207657_10014423 Ga0207657_100144233 403
245 3300025919 Ga0207657_10209239 Ga0207657_102092391 403
246 3300025921 Ga0207652_10255574 Ga0207652_102555741 403
247 3300025936 Ga0207670_10192829 Ga0207670_101928291 403
248 3300025949 Ga0207667_10000905 Ga0207667_1000090529 403
249 3300025949 Ga0207667_10011623 Ga0207667_100116236 403
250 3300025949 Ga0207667_10390548 Ga0207667_103905481 403
251 3300026041 Ga0207639_10192180 Ga0207639_101921802 403
252 3300026041 Ga0207639_10250340 Ga0207639_102503402 403
253 3300026116 Ga0207674_10064926 Ga0207674_100649262 403
254 3300028380 Ga0268265_10309206 Ga0268265_103092061 403
255 3300028381 Ga0268264_10000041 Ga0268264_10000041138 403
256 3300028381 Ga0268264_10273800 Ga0268264_102738001 403
257 3300031730 Ga0307516_10000379 Ga0307516_100003791 403
258 3300032004 Ga0307414_10115696 Ga0307414_101156962 403
259 3300032004 Ga0307414_10179661 Ga0307414_101796612 403
260 3300032004 Ga0307414_10199749 Ga0307414_101997492 403
261 3300033180 Ga0307510_10030558 Ga0307510_100305586 403
262 3300035692 Ga0373935_0087511 Ga0373935_0087511_511_1746 403
263 3300036647 Ga0316582_0141629 Ga0316582_0141629_159_1382 403
264 3300036647 Ga0316582_0178215 Ga0316582_0178215_69_1292 403
265 3300037312 Ga0395899_0000806 Ga0395899_0000806_25956_27179 403
266 3300041486 Ga0451807_2492621 Ga0451807_2492621_640_1863 403
267 3300044658 Ga0466972_0070307 Ga0466972_0070307_305_1525 403
268 3300046616 Ga0495668_0000153 Ga0495668_0000153_56212_57435 403
269 3300047472 Ga0495686_0042201 Ga0495686_0042201_375_1601 403
270 3300047472 Ga0495686_0107273 Ga0495686_0107273_366_1601 403
271 3300049569 Ga0501032_0105488 Ga0501032_0105488_154_1374 403
272 3300049570 Ga0501033_0130688 Ga0501033_0130688_487_1707 403
273 3300049571 Ga0501034_0239123 Ga0501034_0239123_413_1633 403
274 3300049574 Ga0501038_0240773 Ga0501038_0240773_95_1315 403
275 3300049580 Ga0501046_0187683 Ga0501046_0187683_126_1346 403
276 3300049582 Ga0501048_0159663 Ga0501048_0159663_225_1445 403
277 3300049758 Ga0501241_002018 Ga0501241_002018_1028_2248 403
278 3300049822 Ga0501035_0139264 Ga0501035_0139264_809_2029 403
279 3300053090 Ga0500646_0027320 Ga0500646_0027320_276_1490 403
280 3300053153 Ga0500616_0057121 Ga0500616_0057121_588_1802 403
281 3300055283 Ga0500661_003496 Ga0500661_003496_469_1701 403

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00872

Transposase_mut

Transposase, Mutator family

23

398

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xg8-assembly1.cif.gz_B iscth4 transposase, pre-cleaved complex, pcc 0.9146 101 399
6xgx-assembly1.cif.gz_B iscth4 transposase, strand transfer complex 1, stc1 0.801 4 399
6xgx-assembly1.cif.gz_B iscth4 transposase, strand transfer complex 1, stc1 0.7926 4 399
6xgw-assembly1.cif.gz_B iscth4 transposase, pre-reaction complex, prc 0.7874 6 399
6xgw-assembly1.cif.gz_B iscth4 transposase, pre-reaction complex, prc 0.7853 6 399
ID Description Score Start End Superfamily
af_K7LV62_47_129_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8636 198 262 3.30.420.10
af_I1MFY3_263_357_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8341 165 261 3.30.420.10
af_Q2QXD6_295_388_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8297 183 262 3.30.420.10
af_K7L793_270_365_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8169 165 261 3.30.420.10
af_A0A0P0VHN3_509_601_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8156 183 258 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A4Q0Z9H5-F1-model_v4 Mutator family transposase 0.9938 117 248 GO:0003677
GO:0004803
GO:0006313
AF-A0A1J5NA35-F1-model_v4 Mutator family transposase 0.9932 113 254 GO:0003677
GO:0004803
GO:0006313
AF-A0A1G9ZXE4-F1-model_v4 Mutator family transposase 0.9913 109 233 GO:0003677
GO:0004803
GO:0006313
AF-D5BJJ1-F1-model_v4 Mutator family transposase 0.9888 117 399 GO:0003677
GO:0004803
GO:0006313
AF-A0A2A5K2R8-F1-model_v4 deleted 0.9875 158 256

Feature Viewer

pLDDT pTM Quality
84.3 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map