F384281

General Info

Members Datasets Scaffolds Average Seq Length
281 152 562 295

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10001842|Ga0157373_1000184220
Length 336
Sequence LQSGAAILYATKSVHFRLAKLKQFYISKKYKYFWPPKHINYLKRKALFIINPVSGGKKKDQVPQLIQKHLDHQAFDYRIEFSTLDKEIRAIAMEAAHTYDMIVAVGGDGTVNETASAIAGTDKLLGIVPYGSGNGLSRFLQIPMDPVKAIKLLSTGSVRSIDSAQLNGRWFFNMAGMGFDAHISEVFSHTTKRGFSSYLKSSIEEISKYKAQAYHLEIDGHVYDRTAFMLSFANSSQYGNNAHVSPHASLHDGLLDICIIKPFPPYRLPEMGLRMLTKTSESSKFVEIIRGRHIKIERAAAGPVHLDGEPSIIGALVQIEVVPNSLNVIVGHGYKG

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
63 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
90 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
94 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
101 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
102 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
103 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
104 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
105 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
106 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
109 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
110 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
111 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
114 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
119 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
120 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
121 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
122 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
123 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
127 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
128 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
129 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
130 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
131 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
132 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
133 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
134 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
135 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
136 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
137 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
138 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
139 2738541284 Pedobacter sp. YR016 Isolate Unclassified
140 2738543023 Pedobacter sp. OK628 Isolate Unclassified
141 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
142 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
143 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
144 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
145 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
146 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
147 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
148 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
149 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
150 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
151 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
152 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.66
Metatranscriptomes 0
Isolates 5.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.41
Nodule 0
Rhizoplane 0.71
Rhizosphere 84.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10001842 3300013100 Bacteria 16117
2 SwRhRL2b_contig_305047 2162886007 Bacteria 3589
3 JGI24736J21556_1007343 3300001904 Bacteria 1852
4 JGI24743J22301_10029862 3300001991 Bacteria 1070
5 JGI24735J21928_10000032 3300002067 Bacteria 72360
6 JGI24744J21845_10000598 3300002077 Bacteria 6507
7 JGI25162J39368_1000162 3300002737 Bacteria 74157
8 JGI25162J39368_1002950 3300002737 Bacteria 5737
9 JGI25164J39214_1002870 3300002772 Bacteria 2391
10 JGI25165J46597_1000742 3300003214 Bacteria 25223
11 rootH1_10010867 3300003316 Bacteria 12601
12 rootH2_10009361 3300003320 Bacteria 18045
13 rootH2_10012714 3300003320 Bacteria 66260
14 rootH2_10058441 3300003320 Bacteria 2990
15 rootH2_10196396 3300003320 Bacteria 2811
16 rootL2_10027888 3300003322 Bacteria 3000
17 rootH1_10039931 3300003323 Bacteria 4340
18 rootH1_10271741 3300003323 Bacteria 1603
19 Ga0065714_10003515 3300005288 Bacteria 13628
20 Ga0065714_10003609 3300005288 Bacteria 12234
21 Ga0065714_10004130 3300005288 Bacteria 15383
22 Ga0065714_10070570 3300005288 Bacteria 3830
23 Ga0065714_10179932 3300005288 Bacteria 959
24 Ga0065704_10000273 3300005289 Bacteria 42739
25 Ga0065704_10077318 3300005289 Bacteria 4780
26 Ga0065704_10117810 3300005289 Bacteria 1827
27 Ga0070658_10037412 3300005327 Bacteria 3913
28 Ga0070676_10000113 3300005328 Bacteria 29666
29 Ga0070683_100232869 3300005329 Bacteria 1751
30 Ga0070680_100016622 3300005336 Bacteria 5792
31 Ga0070660_100018897 3300005339 Bacteria 5044
32 Ga0070671_100006063 3300005355 Bacteria 9632
33 Ga0070673_100038462 3300005364 Bacteria 3654
34 Ga0070659_100001588 3300005366 Bacteria 16376
35 Ga0070659_100001887 3300005366 Bacteria 14999
36 Ga0070678_100020868 3300005456 Bacteria 4306
37 Ga0070662_100000790 3300005457 Bacteria 19431
38 Ga0070681_10019029 3300005458 Bacteria 6873
39 Ga0068867_100002711 3300005459 Bacteria 12489
40 Ga0068853_100006526 3300005539 Bacteria 9285
41 Ga0068853_100085861 3300005539 Bacteria 2759
42 Ga0070665_100000118 3300005548 Bacteria 149830
43 Ga0068855_100000049 3300005563 Bacteria 145321
44 Ga0068855_100010971 3300005563 Bacteria 10934
45 Ga0068855_100011610 3300005563 Bacteria 10643
46 Ga0068855_100074713 3300005563 Bacteria 3936
47 Ga0068855_100363513 3300005563 Bacteria 1592
48 Ga0068857_100055815 3300005577 Bacteria 3505
49 Ga0068856_100001430 3300005614 Bacteria 25032
50 Ga0068856_100003358 3300005614 Bacteria 16226
51 Ga0068856_100149042 3300005614 Bacteria 2348
52 Ga0068856_100281093 3300005614 Bacteria 1681
53 Ga0068852_100002261 3300005616 Bacteria 13217
54 Ga0068852_100465255 3300005616 Bacteria 1254
55 Ga0068866_10184633 3300005718 Bacteria 1234
56 Ga0068870_10104319 3300005840 Bacteria 1608
57 Ga0097621_100000174 3300006237 Bacteria 40714
58 Ga0075370_10152606 3300006353 Bacteria 1354
59 Ga0068871_100000060 3300006358 Bacteria 59245
60 Ga0068865_100000345 3300006881 Bacteria 25771
61 Ga0105240_10000371 3300009093 Bacteria 84390
62 Ga0105240_10034096 3300009093 Bacteria 6569
63 Ga0105240_10119962 3300009093 Bacteria 3167
64 Ga0105240_10306243 3300009093 Bacteria 1816
65 Ga0105240_10580336 3300009093 Bacteria 1237
66 Ga0105241_10005441 3300009174 Bacteria 9415
67 Ga0105241_10007671 3300009174 Bacteria 7932
68 Ga0105241_10012046 3300009174 Bacteria 6352
69 Ga0105241_10134360 3300009174 Bacteria 2006
70 Ga0105241_10232647 3300009174 Bacteria 1554
71 Ga0105242_10059468 3300009176 Bacteria 3136
72 Ga0105237_10001504 3300009545 Bacteria 30678
73 Ga0105237_10002057 3300009545 Bacteria 25541
74 Ga0105237_10003728 3300009545 Bacteria 17950
75 Ga0105237_10003766 3300009545 Bacteria 17851
76 Ga0105237_10004069 3300009545 Bacteria 17053
77 Ga0105237_10118880 3300009545 Bacteria 2637
78 Ga0105237_10235980 3300009545 Bacteria 1830
79 Ga0105237_10263276 3300009545 Bacteria 1727
80 Ga0105237_10410493 3300009545 Bacteria 1359
81 Ga0105238_10018895 3300009551 Bacteria 7018
82 Ga0105238_10065037 3300009551 Bacteria 3648
83 Ga0105239_10000166 3300010375 Bacteria 94743
84 Ga0105239_10002482 3300010375 Bacteria 23507
85 Ga0105239_10005013 3300010375 Bacteria 15635
86 Ga0105239_10007388 3300010375 Bacteria 12612
87 Ga0105239_10012823 3300010375 Bacteria 9325
88 Ga0105239_10049873 3300010375 Bacteria 4591
89 Ga0105239_10230233 3300010375 Bacteria 2079
90 Ga0105246_10070987 3300011119 Bacteria 2451
91 Ga0105246_10495522 3300011119 Bacteria 1036
92 Ga0157373_10000086 3300013100 Bacteria 80524
93 Ga0157373_10000678 3300013100 Bacteria 26681
94 Ga0157373_10003702 3300013100 Bacteria 11569
95 Ga0157373_10027255 3300013100 Bacteria 4122
96 Ga0157373_10154052 3300013100 Bacteria 1617
97 Ga0157371_10000107 3300013102 Bacteria 126477
98 Ga0157371_10001199 3300013102 Bacteria 27770
99 Ga0157371_10002901 3300013102 Bacteria 16036
100 Ga0157371_10029525 3300013102 Bacteria 3963
101 Ga0157371_10131734 3300013102 Bacteria 1779
102 Ga0157370_10011253 3300013104 Bacteria 9380
103 Ga0157370_10012946 3300013104 Bacteria 8623
104 Ga0157370_10020182 3300013104 Bacteria 6660
105 Ga0157370_10095274 3300013104 Bacteria 2793
106 Ga0157370_10159394 3300013104 Bacteria 2100
107 Ga0157369_10072333 3300013105 Bacteria 3701
108 Ga0157369_10239289 3300013105 Bacteria 1896
109 Ga0157374_10000301 3300013296 Bacteria 45768
110 Ga0157374_10003768 3300013296 Bacteria 12747
111 Ga0157374_10061126 3300013296 Bacteria 3527
112 Ga0157374_10317172 3300013296 Bacteria 1544
113 Ga0157378_10014377 3300013297 Bacteria 6929
114 Ga0157378_10041128 3300013297 Bacteria 4099
115 Ga0157378_10049627 3300013297 Bacteria 3734
116 Ga0163162_10000012 3300013306 Bacteria 292674
117 Ga0163162_10003815 3300013306 Bacteria 14452
118 Ga0157372_10000238 3300013307 Bacteria 60988
119 Ga0157372_10002381 3300013307 Bacteria 20343
120 Ga0157372_10019173 3300013307 Bacteria 7366
121 Ga0157372_10081703 3300013307 Bacteria 3658
122 Ga0157375_10017179 3300013308 Bacteria 6523
123 Ga0182008_10000020 3300014497 Bacteria 228333
124 Ga0182008_10000053 3300014497 Bacteria 102934
125 Ga0182008_10083126 3300014497 Bacteria 1576
126 Ga0182006_1000749 3300015261 Bacteria 22227
127 Ga0182006_1004122 3300015261 Bacteria 7224
128 Ga0182007_10016748 3300015262 Bacteria 2696
129 Ga0163161_10002680 3300017792 Bacteria 12657
130 Ga0163161_10004076 3300017792 Bacteria 10218
131 Ga0163161_10041158 3300017792 Bacteria 3320
132 Ga0163161_10065058 3300017792 Bacteria 2661
133 Ga0213872_10068564 3300021361 Bacteria 1600
134 Ga0207427_100122 3300025231 Bacteria 99064
135 Ga0209437_100048 3300025233 Bacteria 405107
136 Ga0209437_100102 3300025233 Bacteria 224216
137 Ga0209026_1000852 3300025250 Bacteria 15983
138 Ga0209233_1000029 3300025261 Bacteria 641642
139 Ga0209233_1002032 3300025261 Bacteria 7659
140 Ga0207642_10165658 3300025899 Bacteria 1191
141 Ga0207647_10000018 3300025904 Bacteria 124816
142 Ga0207647_10000071 3300025904 Bacteria 79170
143 Ga0207645_10000229 3300025907 Bacteria 46502
144 Ga0207705_10000026 3300025909 Bacteria 256051
145 Ga0207654_10001012 3300025911 Bacteria 15381
146 Ga0207654_10021427 3300025911 Bacteria 3437
147 Ga0207654_10024974 3300025911 Bacteria 3218
148 Ga0207695_10000142 3300025913 Bacteria 214715
149 Ga0207695_10027609 3300025913 Bacteria 6316
150 Ga0207695_10099835 3300025913 Bacteria 2899
151 Ga0207695_10345986 3300025913 Bacteria 1374
152 Ga0207671_10000110 3300025914 Bacteria 126480
153 Ga0207671_10001959 3300025914 Bacteria 22712
154 Ga0207671_10002617 3300025914 Bacteria 18990
155 Ga0207671_10002756 3300025914 Bacteria 18350
156 Ga0207671_10004032 3300025914 Bacteria 14254
157 Ga0207671_10042286 3300025914 Bacteria 3373
158 Ga0207671_10085711 3300025914 Bacteria 2367
159 Ga0207671_10183637 3300025914 Bacteria 1629
160 Ga0207660_10009697 3300025917 Bacteria 6232
161 Ga0207657_10080647 3300025919 Bacteria 2735
162 Ga0207657_10087859 3300025919 Bacteria 2599
163 Ga0207644_10005924 3300025931 Bacteria 7969
164 Ga0207690_10004024 3300025932 Bacteria 8680
165 Ga0207690_10008902 3300025932 Bacteria 5959
166 Ga0207706_10001203 3300025933 Bacteria 26147
167 Ga0207704_10000047 3300025938 Bacteria 84386
168 Ga0207667_10000015 3300025949 Bacteria 417534
169 Ga0207667_10000274 3300025949 Bacteria 71328
170 Ga0207667_10148038 3300025949 Bacteria 2417
171 Ga0207667_10206793 3300025949 Bacteria 2012
172 Ga0207651_10001551 3300025960 Bacteria 10494
173 Ga0207639_10005859 3300026041 Bacteria 8324
174 Ga0207639_10028850 3300026041 Bacteria 4056
175 Ga0207639_10081550 3300026041 Bacteria 2562
176 Ga0207702_10002682 3300026078 Bacteria 16707
177 Ga0207702_10121226 3300026078 Bacteria 2341
178 Ga0207702_10194341 3300026078 Bacteria 1877
179 Ga0207702_10437064 3300026078 Bacteria 1267
180 Ga0207648_10001813 3300026089 Bacteria 23430
181 Ga0207674_10162334 3300026116 Bacteria 2188
182 Ga0207683_10001294 3300026121 Bacteria 22621
183 Ga0207698_10032371 3300026142 Bacteria 3787
184 Ga0268266_10000121 3300028379 Bacteria 154995
185 Ga0307517_10000198 3300028786 Bacteria 102181
186 Ga0307515_10001436 3300028794 Bacteria 53821
187 Ga0307515_10002325 3300028794 Bacteria 41513
188 Ga0307515_10127683 3300028794 Bacteria 2826
189 Ga0265338_10011009 3300028800 Bacteria 10506
190 Ga0316181_1215266 3300030744 Bacteria 3273
191 Ga0307509_10180922 3300031507 Bacteria 1973
192 Ga0307412_10000001 3300031911 Bacteria 822691
193 Ga0307414_10002281 3300032004 Bacteria 10021
194 Ga0307414_10003267 3300032004 Bacteria 8640
195 Ga0307414_10025436 3300032004 Bacteria 3792
196 Ga0307414_10208206 3300032004 Bacteria 1596
197 Ga0307507_10000099 3300033179 Bacteria 139532
198 Ga0307510_10023674 3300033180 Bacteria 7115
199 Ga0395899_0000027 3300037312 Bacteria 337387
200 Ga0395899_0000811 3300037312 Bacteria 30415
201 Ga0395899_0002683 3300037312 Bacteria 14349
202 Ga0395900_0000275 3300037418 Bacteria 78207
203 Ga0395900_0001518 3300037418 Bacteria 27559
204 Ga0395900_0017647 3300037418 Bacteria 7284
205 Ga0395898_0010841 3300037466 Bacteria 9522
206 Ga0395905_0000248 3300037471 Bacteria 81042
207 Ga0395905_0000327 3300037471 Bacteria 68334
208 Ga0395901_0003259 3300038443 Bacteria 16332
209 Ga0395901_0333532 3300038443 Bacteria 1567
210 Ga0436361_1180836 3300039447 Bacteria 4260
211 Ga0439455_0014885 3300042012 Bacteria 1782
212 Ga0495650_0000231 3300046471 Bacteria 113969
213 Ga0495650_0032257 3300046471 Bacteria 2345
214 Ga0495605_0046383 3300046474 Bacteria 2137
215 Ga0495585_0000037 3300046492 Bacteria 133335
216 Ga0495585_0001133 3300046492 Bacteria 21876
217 Ga0495585_0106511 3300046492 Bacteria 1495
218 Ga0495596_0008716 3300046500 Bacteria 4493
219 Ga0495583_0011811 3300046506 Bacteria 4992
220 Ga0495606_0000060 3300046507 Bacteria 185907
221 Ga0495606_0011937 3300046507 Bacteria 7023
222 Ga0495610_0000751 3300046512 Bacteria 30621
223 Ga0495616_0011492 3300046513 Bacteria 5068
224 Ga0495616_0038100 3300046513 Bacteria 2470
225 Ga0495631_0002688 3300046518 Bacteria 9884
226 Ga0495648_0005749 3300046524 Bacteria 10233
227 Ga0495652_0079591 3300046529 Bacteria 2709
228 Ga0495609_0002226 3300046538 Bacteria 12129
229 Ga0495609_0004442 3300046538 Bacteria 7667
230 Ga0495633_0000015 3300046558 Bacteria 254484
231 Ga0495633_0006007 3300046558 Bacteria 7296
232 Ga0495668_0000041 3300046616 Bacteria 229462
233 Ga0495611_0172231 3300046648 Bacteria 1012
234 Ga0495625_0000191 3300046660 Bacteria 97363
235 Ga0495625_0000663 3300046660 Bacteria 49012
236 Ga0495625_0001074 3300046660 Bacteria 35469
237 Ga0495625_0006807 3300046660 Bacteria 10099
238 Ga0495625_0019812 3300046660 Bacteria 5206
239 Ga0495625_0052810 3300046660 Bacteria 2909
240 Ga0495625_0060394 3300046660 Bacteria 2686
241 Ga0495661_0003969 3300046665 Bacteria 10802
242 Ga0495661_0019791 3300046665 Bacteria 4405
243 Ga0495671_0047709 3300046692 Bacteria 2139
244 Ga0495649_0000061 3300046694 Bacteria 97338
245 Ga0495649_0041674 3300046694 Bacteria 2510
246 Ga0495660_0004591 3300046810 Bacteria 8332
247 Ga0495683_0018196 3300047323 Bacteria 3634
248 Ga0495687_000570 3300047443 Bacteria 43484
249 Ga0495686_0000679 3300047472 Bacteria 46024
250 Ga0495686_0008700 3300047472 Bacteria 7411
251 Ga0495686_0112543 3300047472 Bacteria 1630
252 Ga0496114_0156360 3300048917 Bacteria 1980
253 Ga0496122_0003830 3300048925 Bacteria 19337
254 Ga0496123_0011796 3300048926 Bacteria 7527
255 Ga0495678_001603 3300049459 Bacteria 17329
256 Ga0495682_0015405 3300049460 Bacteria 2897
257 Ga0501241_002896 3300049758 Bacteria 3283
258 Ga0501241_023639 3300049758 Bacteria 1139
259 nmdc:mga0k408_31_c1 3300050493 Bacteria 85612
260 nmdc:mga07m45_220839_c1 3300050496 Bacteria 1102
261 Ga0500651_0000058 3300053093 Bacteria 72493
262 Ga0500608_000955 3300053122 Bacteria 10346
263 Ga0500608_016055 3300053122 Bacteria 3376
264 Ga0500618_000016 3300053125 Bacteria 164049
265 Ga0500622_0000302 3300053156 Bacteria 50416
266 Ga0500624_002159 3300053157 Bacteria 2727
267 2599481436 2599185184 Bacteria 6430550
268 2738763354 2738541284 Bacteria 5199923
269 2739304114 2738543023 Bacteria 6767879
270 2776616041 2775506987 Bacteria 5373360
271 2852627081 2852623160 Bacteria 4376875
272 2852630714 2852627209 Bacteria 5896285
273 2884935185 2884933994 Bacteria 4535041
274 2902050063 2902048731 Bacteria 4976191
275 2919190673 2919186247 Bacteria 6244071
276 2919443043 2919437846 Bacteria 6199444
277 2928083269 2928078545 Bacteria 6534839
278 2928152731 2928147474 Bacteria 6512076
279 2932088307 2932082852 Bacteria 6563563
280 2939669117 2939664404 Bacteria 6364494
281 2977234030 2977232053 Bacteria 5485925
282 Ga0157373_10001842
283 SwRhRL2b_contig_305047
284 JGI24736J21556_1007343
285 JGI24743J22301_10029862
286 JGI24735J21928_10000032
287 JGI24744J21845_10000598
288 JGI25162J39368_1000162
289 JGI25162J39368_1002950
290 JGI25164J39214_1002870
291 JGI25165J46597_1000742
292 rootH1_10010867
293 rootH2_10009361
294 rootH2_10012714
295 rootH2_10058441
296 rootH2_10196396
297 rootL2_10027888
298 rootH1_10039931
299 rootH1_10271741
300 Ga0065714_10003515
301 Ga0065714_10003609
302 Ga0065714_10004130
303 Ga0065714_10070570
304 Ga0065714_10179932
305 Ga0065704_10000273
306 Ga0065704_10077318
307 Ga0065704_10117810
308 Ga0070658_10037412
309 Ga0070676_10000113
310 Ga0070683_100232869
311 Ga0070680_100016622
312 Ga0070660_100018897
313 Ga0070671_100006063
314 Ga0070673_100038462
315 Ga0070659_100001588
316 Ga0070659_100001887
317 Ga0070678_100020868
318 Ga0070662_100000790
319 Ga0070681_10019029
320 Ga0068867_100002711
321 Ga0068853_100006526
322 Ga0068853_100085861
323 Ga0070665_100000118
324 Ga0068855_100000049
325 Ga0068855_100010971
326 Ga0068855_100011610
327 Ga0068855_100074713
328 Ga0068855_100363513
329 Ga0068857_100055815
330 Ga0068856_100001430
331 Ga0068856_100003358
332 Ga0068856_100149042
333 Ga0068856_100281093
334 Ga0068852_100002261
335 Ga0068852_100465255
336 Ga0068866_10184633
337 Ga0068870_10104319
338 Ga0097621_100000174
339 Ga0075370_10152606
340 Ga0068871_100000060
341 Ga0068865_100000345
342 Ga0105240_10000371
343 Ga0105240_10034096
344 Ga0105240_10119962
345 Ga0105240_10306243
346 Ga0105240_10580336
347 Ga0105241_10005441
348 Ga0105241_10007671
349 Ga0105241_10012046
350 Ga0105241_10134360
351 Ga0105241_10232647
352 Ga0105242_10059468
353 Ga0105237_10001504
354 Ga0105237_10002057
355 Ga0105237_10003728
356 Ga0105237_10003766
357 Ga0105237_10004069
358 Ga0105237_10118880
359 Ga0105237_10235980
360 Ga0105237_10263276
361 Ga0105237_10410493
362 Ga0105238_10018895
363 Ga0105238_10065037
364 Ga0105239_10000166
365 Ga0105239_10002482
366 Ga0105239_10005013
367 Ga0105239_10007388
368 Ga0105239_10012823
369 Ga0105239_10049873
370 Ga0105239_10230233
371 Ga0105246_10070987
372 Ga0105246_10495522
373 Ga0157373_10000086
374 Ga0157373_10000678
375 Ga0157373_10003702
376 Ga0157373_10027255
377 Ga0157373_10154052
378 Ga0157371_10000107
379 Ga0157371_10001199
380 Ga0157371_10002901
381 Ga0157371_10029525
382 Ga0157371_10131734
383 Ga0157370_10011253
384 Ga0157370_10012946
385 Ga0157370_10020182
386 Ga0157370_10095274
387 Ga0157370_10159394
388 Ga0157369_10072333
389 Ga0157369_10239289
390 Ga0157374_10000301
391 Ga0157374_10003768
392 Ga0157374_10061126
393 Ga0157374_10317172
394 Ga0157378_10014377
395 Ga0157378_10041128
396 Ga0157378_10049627
397 Ga0163162_10000012
398 Ga0163162_10003815
399 Ga0157372_10000238
400 Ga0157372_10002381
401 Ga0157372_10019173
402 Ga0157372_10081703
403 Ga0157375_10017179
404 Ga0182008_10000020
405 Ga0182008_10000053
406 Ga0182008_10083126
407 Ga0182006_1000749
408 Ga0182006_1004122
409 Ga0182007_10016748
410 Ga0163161_10002680
411 Ga0163161_10004076
412 Ga0163161_10041158
413 Ga0163161_10065058
414 Ga0213872_10068564
415 Ga0207427_100122
416 Ga0209437_100048
417 Ga0209437_100102
418 Ga0209026_1000852
419 Ga0209233_1000029
420 Ga0209233_1002032
421 Ga0207642_10165658
422 Ga0207647_10000018
423 Ga0207647_10000071
424 Ga0207645_10000229
425 Ga0207705_10000026
426 Ga0207654_10001012
427 Ga0207654_10021427
428 Ga0207654_10024974
429 Ga0207695_10000142
430 Ga0207695_10027609
431 Ga0207695_10099835
432 Ga0207695_10345986
433 Ga0207671_10000110
434 Ga0207671_10001959
435 Ga0207671_10002617
436 Ga0207671_10002756
437 Ga0207671_10004032
438 Ga0207671_10042286
439 Ga0207671_10085711
440 Ga0207671_10183637
441 Ga0207660_10009697
442 Ga0207657_10080647
443 Ga0207657_10087859
444 Ga0207644_10005924
445 Ga0207690_10004024
446 Ga0207690_10008902
447 Ga0207706_10001203
448 Ga0207704_10000047
449 Ga0207667_10000015
450 Ga0207667_10000274
451 Ga0207667_10148038
452 Ga0207667_10206793
453 Ga0207651_10001551
454 Ga0207639_10005859
455 Ga0207639_10028850
456 Ga0207639_10081550
457 Ga0207702_10002682
458 Ga0207702_10121226
459 Ga0207702_10194341
460 Ga0207702_10437064
461 Ga0207648_10001813
462 Ga0207674_10162334
463 Ga0207683_10001294
464 Ga0207698_10032371
465 Ga0268266_10000121
466 Ga0307517_10000198
467 Ga0307515_10001436
468 Ga0307515_10002325
469 Ga0307515_10127683
470 Ga0265338_10011009
471 Ga0316181_1215266
472 Ga0307509_10180922
473 Ga0307412_10000001
474 Ga0307414_10002281
475 Ga0307414_10003267
476 Ga0307414_10025436
477 Ga0307414_10208206
478 Ga0307507_10000099
479 Ga0307510_10023674
480 Ga0395899_0000027
481 Ga0395899_0000811
482 Ga0395899_0002683
483 Ga0395900_0000275
484 Ga0395900_0001518
485 Ga0395900_0017647
486 Ga0395898_0010841
487 Ga0395905_0000248
488 Ga0395905_0000327
489 Ga0395901_0003259
490 Ga0395901_0333532
491 Ga0436361_1180836
492 Ga0439455_0014885
493 Ga0495650_0000231
494 Ga0495650_0032257
495 Ga0495605_0046383
496 Ga0495585_0000037
497 Ga0495585_0001133
498 Ga0495585_0106511
499 Ga0495596_0008716
500 Ga0495583_0011811
501 Ga0495606_0000060
502 Ga0495606_0011937
503 Ga0495610_0000751
504 Ga0495616_0011492
505 Ga0495616_0038100
506 Ga0495631_0002688
507 Ga0495648_0005749
508 Ga0495652_0079591
509 Ga0495609_0002226
510 Ga0495609_0004442
511 Ga0495633_0000015
512 Ga0495633_0006007
513 Ga0495668_0000041
514 Ga0495611_0172231
515 Ga0495625_0000191
516 Ga0495625_0000663
517 Ga0495625_0001074
518 Ga0495625_0006807
519 Ga0495625_0019812
520 Ga0495625_0052810
521 Ga0495625_0060394
522 Ga0495661_0003969
523 Ga0495661_0019791
524 Ga0495671_0047709
525 Ga0495649_0000061
526 Ga0495649_0041674
527 Ga0495660_0004591
528 Ga0495683_0018196
529 Ga0495687_000570
530 Ga0495686_0000679
531 Ga0495686_0008700
532 Ga0495686_0112543
533 Ga0496114_0156360
534 Ga0496122_0003830
535 Ga0496123_0011796
536 Ga0495678_001603
537 Ga0495682_0015405
538 Ga0501241_002896
539 Ga0501241_023639
540 nmdc:mga0k408_31_c1
541 nmdc:mga07m45_220839_c1
542 Ga0500651_0000058
543 Ga0500608_000955
544 Ga0500608_016055
545 Ga0500618_000016
546 Ga0500622_0000302
547 Ga0500624_002159
548 2599481436
549 2738763354
550 2739304114
551 2776616041
552 2852627081
553 2852630714
554 2884935185
555 2902050063
556 2919190673
557 2919443043
558 2928083269
559 2928152731
560 2932088307
561 2939669117
562 2977234030

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00781

DAGK_cat

Diacylglycerol kinase catalytic domain

45

166

0.98

PF19279

YegS_C

YegS C-terminal NAD kinase beta sandwich-like domain

173

330

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s40-assembly5.cif.gz_D the crystal structure of a diacylglycerol kinases from bacillus anthracis str. sterne 0.8566 1 296
3s40-assembly5.cif.gz_A the crystal structure of a diacylglycerol kinases from bacillus anthracis str. sterne 0.8546 1 292
2jgr-assembly1.cif.gz_A crystal structure of yegs in complex with adp 0.8537 4 292
3s40-assembly5.cif.gz_D the crystal structure of a diacylglycerol kinases from bacillus anthracis str. sterne 0.8505 1 296
2qvl-assembly1.cif.gz_A crystal structure of diacylglycerol kinase 0.8499 1 296
ID Description Score Start End Superfamily
af_Q2FWZ2_3_120_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.9119 4 116 3.40.50.10330
2qvlA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.8911 3 120 3.40.50.10330
af_P9WP29_9_143_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.8808 1 129 3.40.50.10330
af_Q2G084_1_135_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.8742 3 120 3.40.50.10330
af_Q2FWZ2_3_120_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.8685 4 116 3.40.50.10330
ID Description Score Start End GO Terms
AF-A0A1H9UI26-F1-model_v4 Lipid kinase, YegS/Rv2252/BmrU family 0.9682 2 292 GO:0005524
GO:0005886
GO:0008654
GO:0016301
GO:0046872
AF-A0A7K3XIF3-F1-model_v4 Diacylglycerol kinase family lipid kinase 0.9641 3 292 GO:0005524
GO:0005886
GO:0016301
AF-A0A5J4Q0J7-F1-model_v4 Diacylglycerol kinase (EC 2.7.1.107) 0.9602 1 122 GO:0004143
GO:0005886
AF-A0A3S3QEW4-F1-model_v4 Diacylglycerol kinase family lipid kinase 0.9595 1 293 GO:0005524
GO:0005886
GO:0008654
GO:0016301
GO:0046872
AF-A0A2M7RVP3-F1-model_v4 Diacylglycerol kinase 0.9554 42 292 GO:0005524
GO:0005886
GO:0008654
GO:0016301
GO:0046872

Map