F384302

General Info

Members Datasets Scaffolds Average Seq Length
281 216 562 150

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10470796|Ga0157375_104707963
Length 180
Sequence LGAGRYDASINSPGQRAQRQLRENSESKGELIMPTGTIRLHRVLRAPPERVYRAFLDADAKAKWLPPYGFTCKVHHLDAKVGGTYKMSFTNFTTGHGHSFGGEYRELVPSERIRYTDRFDDPNLPGEMQTTVTLRQVSCGTELNIVQEGVPEAIPVEMCYLGWQESLAQLAKLVEPEIPG

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
134 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
135 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
136 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
142 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
168 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
205 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
206 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
207 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
208 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
209 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
210 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
211 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
212 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
216 2738541283 Pedobacter sp. OK701 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0
Isolates 0.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.12
Nodule 0
Rhizoplane 1.42
Rhizosphere 85.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10470796 3300013308 Bacteria 1422
2 JGI25156J39149_1041130 3300002705 Bacteria 637
3 JGI25153J46596_10021622 3300003215 Bacteria 2392
4 Ga0065712_10329068 3300005290 Bacteria 817
5 Ga0070676_10007271 3300005328 Bacteria 5939
6 Ga0070670_100413756 3300005331 Bacteria 1191
7 Ga0068869_100014487 3300005334 Bacteria 5268
8 Ga0068868_100269893 3300005338 Bacteria 1437
9 Ga0070689_100321485 3300005340 Bacteria 1292
10 Ga0070691_10090441 3300005341 Bacteria 1508
11 Ga0070691_10151083 3300005341 Bacteria 1191
12 Ga0070687_100592593 3300005343 Bacteria 760
13 Ga0070668_100958809 3300005347 Bacteria 767
14 Ga0070671_100613207 3300005355 Bacteria 941
15 Ga0070674_100307579 3300005356 Bacteria 1266
16 Ga0070673_100003637 3300005364 Bacteria 9647
17 Ga0070659_100748513 3300005366 Bacteria 847
18 Ga0070667_100093117 3300005367 Bacteria 2595
19 Ga0070703_10100874 3300005406 Bacteria 1017
20 Ga0070701_10520934 3300005438 Bacteria 775
21 Ga0070705_100092438 3300005440 Bacteria 1888
22 Ga0070700_100407202 3300005441 Bacteria 1024
23 Ga0070694_100010290 3300005444 Bacteria 5766
24 Ga0070708_102020140 3300005445 Bacteria 534
25 Ga0070678_100022446 3300005456 Bacteria 4183
26 Ga0068867_100022511 3300005459 Bacteria 4506
27 Ga0068867_100051145 3300005459 Bacteria 3047
28 Ga0070706_100021834 3300005467 Bacteria 5895
29 Ga0070706_100102994 3300005467 Bacteria 2654
30 Ga0070706_101346317 3300005467 Bacteria 654
31 Ga0070707_100074831 3300005468 Bacteria 3266
32 Ga0070707_100676650 3300005468 Bacteria 995
33 Ga0070698_101677067 3300005471 Bacteria 588
34 Ga0070697_100517886 3300005536 Bacteria 1044
35 Ga0070672_100051363 3300005543 Bacteria 3215
36 Ga0070695_100001022 3300005545 Bacteria 15270
37 Ga0070695_100083806 3300005545 Bacteria 2113
38 Ga0070696_101106451 3300005546 Bacteria 666
39 Ga0070693_100784240 3300005547 Bacteria 705
40 Ga0070704_100220661 3300005549 Bacteria 1541
41 Ga0068855_100291887 3300005563 Bacteria 1808
42 Ga0068855_100506225 3300005563 Bacteria 1312
43 Ga0070664_100063531 3300005564 Bacteria 3148
44 Ga0068857_100015328 3300005577 Bacteria 6692
45 Ga0068854_100042802 3300005578 Bacteria 3207
46 Ga0068854_100128715 3300005578 Bacteria 1931
47 Ga0068854_100447765 3300005578 Bacteria 1078
48 Ga0068859_100235503 3300005617 Bacteria 1919
49 Ga0068864_100009530 3300005618 Bacteria 8013
50 Ga0068866_10048267 3300005718 Bacteria 2152
51 Ga0068861_100000163 3300005719 Bacteria 34909
52 Ga0068870_10007131 3300005840 Bacteria 4971
53 Ga0068870_10231502 3300005840 Bacteria 1136
54 Ga0068863_100067429 3300005841 Bacteria 3384
55 Ga0068858_100021710 3300005842 Bacteria 5999
56 Ga0068860_100030886 3300005843 Bacteria 5151
57 Ga0068862_100008828 3300005844 Bacteria 8348
58 Ga0081455_10002261 3300005937 Bacteria 22946
59 Ga0081455_10400233 3300005937 Bacteria 953
60 Ga0075432_10054637 3300006058 Bacteria 1414
61 Ga0070712_100494049 3300006175 Bacteria 1025
62 Ga0075362_10191789 3300006177 Bacteria 993
63 Ga0075362_10423339 3300006177 Bacteria 674
64 Ga0075366_10001709 3300006195 Bacteria 11032
65 Ga0075366_10110009 3300006195 Bacteria 1657
66 Ga0075366_10300583 3300006195 Bacteria 982
67 Ga0075370_10573271 3300006353 Bacteria 683
68 Ga0075433_10059137 3300006852 Bacteria 3353
69 Ga0075436_100022957 3300006914 Bacteria 4286
70 Ga0097620_100235496 3300006931 Bacteria 1919
71 Ga0099795_10067496 3300007788 Bacteria 1342
72 Ga0105240_11219920 3300009093 Bacteria 796
73 Ga0105245_10661395 3300009098 Bacteria 1075
74 Ga0105245_10713736 3300009098 Bacteria 1036
75 Ga0114129_10060098 3300009147 Bacteria 5314
76 Ga0114129_10253859 3300009147 Bacteria 2359
77 Ga0105243_10088668 3300009148 Bacteria 2542
78 Ga0105243_10226558 3300009148 Bacteria 1656
79 Ga0105248_10005106 3300009177 Bacteria 14485
80 Ga0105239_10478528 3300010375 Bacteria 1415
81 Ga0105239_10518873 3300010375 Bacteria 1355
82 Ga0105246_10042282 3300011119 Bacteria 3086
83 Ga0105246_10702758 3300011119 Bacteria 886
84 Ga0157378_10010313 3300013297 Bacteria 8156
85 Ga0157378_10037827 3300013297 Bacteria 4276
86 Ga0157378_10532786 3300013297 Bacteria 1177
87 Ga0163162_10182795 3300013306 Bacteria 2223
88 Ga0163162_10202229 3300013306 Bacteria 2115
89 Ga0157372_10050010 3300013307 Bacteria 4650
90 Ga0157375_10112930 3300013308 Bacteria 2817
91 Ga0157380_10130230 3300014326 Bacteria 2145
92 Ga0157380_10256540 3300014326 Bacteria 1586
93 Ga0182008_10011231 3300014497 Bacteria 4771
94 Ga0157379_10002520 3300014968 Bacteria 15334
95 Ga0157376_11325824 3300014969 Bacteria 750
96 Ga0209759_1001255 3300025256 Bacteria 15355
97 Ga0209758_1000045 3300025297 Bacteria 369174
98 Ga0207653_10061755 3300025885 Bacteria 1265
99 Ga0207710_10057849 3300025900 Bacteria 1752
100 Ga0207680_10064628 3300025903 Bacteria 2244
101 Ga0207699_10628009 3300025906 Bacteria 783
102 Ga0207645_10008775 3300025907 Bacteria 7030
103 Ga0207684_10976975 3300025910 Bacteria 709
104 Ga0207693_10514046 3300025915 Bacteria 935
105 Ga0207662_10159129 3300025918 Bacteria 1442
106 Ga0207657_10189496 3300025919 Bacteria 1660
107 Ga0207646_10066142 3300025922 Bacteria 3227
108 Ga0207646_10398955 3300025922 Bacteria 1242
109 Ga0207681_10014348 3300025923 Bacteria 4922
110 Ga0207650_10005891 3300025925 Bacteria 8366
111 Ga0207650_10597780 3300025925 Bacteria 928
112 Ga0207650_10747675 3300025925 Bacteria 827
113 Ga0207687_10471209 3300025927 Bacteria 1044
114 Ga0207644_10074348 3300025931 Bacteria 2494
115 Ga0207644_10264687 3300025931 Bacteria 1376
116 Ga0207706_10089838 3300025933 Bacteria 2701
117 Ga0207709_10087512 3300025935 Bacteria 2025
118 Ga0207709_10141135 3300025935 Bacteria 1656
119 Ga0207670_10160974 3300025936 Bacteria 1675
120 Ga0207669_10103875 3300025937 Bacteria 1886
121 Ga0207669_10282239 3300025937 Bacteria 1253
122 Ga0207704_10488484 3300025938 Bacteria 990
123 Ga0207691_10003291 3300025940 Bacteria 15739
124 Ga0207691_11107957 3300025940 Bacteria 658
125 Ga0207689_10118846 3300025942 Bacteria 2174
126 Ga0207679_10032973 3300025945 Bacteria 3641
127 Ga0207667_10205071 3300025949 Bacteria 2022
128 Ga0207667_10500152 3300025949 Bacteria 1233
129 Ga0207651_10015387 3300025960 Bacteria 4445
130 Ga0207651_10304398 3300025960 Bacteria 1327
131 Ga0207668_10484137 3300025972 Bacteria 1062
132 Ga0207640_10044798 3300025981 Bacteria 2837
133 Ga0207640_10154241 3300025981 Bacteria 1691
134 Ga0207658_10009677 3300025986 Bacteria 6540
135 Ga0207703_10005927 3300026035 Bacteria 9792
136 Ga0207708_10192900 3300026075 Bacteria 1622
137 Ga0207641_10192431 3300026088 Bacteria 1875
138 Ga0207648_10000348 3300026089 Bacteria 50841
139 Ga0207648_10001548 3300026089 Bacteria 25313
140 Ga0207648_10046963 3300026089 Bacteria 3785
141 Ga0207676_10017632 3300026095 Bacteria 5177
142 Ga0207674_10022583 3300026116 Bacteria 6753
143 Ga0207674_10023260 3300026116 Bacteria 6639
144 Ga0207675_101099439 3300026118 Bacteria 815
145 Ga0207683_10003507 3300026121 Bacteria 13682
146 Ga0209969_1001291 3300027360 Bacteria 3444
147 Ga0209967_1005796 3300027364 Bacteria 1668
148 Ga0209981_1001875 3300027378 Bacteria 2678
149 Ga0209996_1004227 3300027395 Bacteria 1823
150 Ga0210000_1003933 3300027462 Bacteria 2150
151 Ga0209995_1004693 3300027471 Bacteria 2192
152 Ga0209179_1051799 3300027512 Bacteria 881
153 Ga0209968_1002561 3300027526 Bacteria 2741
154 Ga0209999_1000652 3300027543 Bacteria 5566
155 Ga0209982_1010905 3300027552 Bacteria 1351
156 Ga0209970_1007320 3300027614 Bacteria 1809
157 Ga0210002_1009058 3300027617 Bacteria 1520
158 Ga0209983_1007215 3300027665 Bacteria 2279
159 Ga0209971_1000102 3300027682 Bacteria 25201
160 Ga0209966_1000058 3300027695 Bacteria 48823
161 Ga0209998_10000922 3300027717 Bacteria 7513
162 Ga0209974_10003495 3300027876 Bacteria 5662
163 Ga0268265_10050835 3300028380 Bacteria 3125
164 Ga0268264_10003538 3300028381 Bacteria 13449
165 Ga0268264_10559440 3300028381 Bacteria 1123
166 Ga0307515_10114830 3300028794 Bacteria 3108
167 Ga0265332_10000128 3300031238 Bacteria 63543
168 Ga0265328_10002207 3300031239 Bacteria 8773
169 Ga0307513_10159043 3300031456 Bacteria 2154
170 Ga0307509_10006668 3300031507 Bacteria 15407
171 Ga0307509_10048750 3300031507 Bacteria 4546
172 Ga0307508_10010240 3300031616 Bacteria 8577
173 Ga0307508_10011657 3300031616 Bacteria 8035
174 Ga0307508_10411615 3300031616 Bacteria 943
175 Ga0307514_10049920 3300031649 Bacteria 3251
176 Ga0307516_10598090 3300031730 Bacteria 757
177 Ga0307507_10265296 3300033179 Bacteria 1091
178 Ga0307507_10374600 3300033179 Bacteria 823
179 Ga0307510_10031450 3300033180 Bacteria 5997
180 Ga0307510_10257656 3300033180 Bacteria 1227
181 Ga0373931_0213031 3300035691 Bacteria 1159
182 Ga0373931_0316904 3300035691 Bacteria 967
183 Ga0242420_141792 3300038996 Bacteria 535
184 Ga0436361_0714943 3300039447 Bacteria 1719
185 Ga0439464_0001007 3300042439 Bacteria 6416
186 Ga0439460_0001111 3300042461 Bacteria 6287
187 Ga0451577_0012508 3300042876 Bacteria 7968
188 Ga0466969_0002537 3300044656 Bacteria 9757
189 Ga0466972_0002440 3300044658 Bacteria 9185
190 Ga0453683_0059878 3300044673 Bacteria 2380
191 Ga0453683_0622498 3300044673 Bacteria 705
192 Ga0466965_0074037 3300044683 Bacteria 1716
193 Ga0466966_0003298 3300044684 Bacteria 10643
194 Ga0466961_0006006 3300044693 Bacteria 7699
195 Ga0466963_0198513 3300044694 Bacteria 1403
196 Ga0466964_0495133 3300044706 Bacteria 655
197 Ga0453684_0021679 3300044712 Bacteria 9581
198 Ga0453684_0084376 3300044712 Bacteria 3950
199 Ga0453684_0265606 3300044712 Bacteria 1964
200 Ga0453684_0534137 3300044712 Bacteria 1294
201 Ga0453684_0643319 3300044712 Bacteria 1158
202 Ga0466968_0014864 3300044735 Bacteria 3081
203 Ga0466959_0033038 3300045049 Bacteria 3828
204 Ga0466959_0191507 3300045049 Bacteria 1427
205 Ga0451576_0012259 3300045051 Bacteria 9649
206 Ga0451576_0027638 3300045051 Bacteria 6090
207 Ga0451576_0219453 3300045051 Bacteria 1985
208 Ga0495592_0000142 3300046454 Bacteria 63571
209 Ga0495629_0525706 3300046459 Bacteria 796
210 Ga0495620_0200487 3300046515 Bacteria 768
211 Ga0495632_0076232 3300046519 Bacteria 1604
212 Ga0495648_0328766 3300046524 Bacteria 706
213 Ga0495666_0210848 3300046526 Bacteria 891
214 Ga0495645_0099981 3300046543 Bacteria 2063
215 Ga0495646_0294117 3300046680 Bacteria 860
216 Ga0495647_0579441 3300046681 Bacteria 526
217 Ga0495658_0006084 3300046683 Bacteria 5927
218 Ga0495624_0128685 3300046690 Bacteria 1553
219 Ga0495673_0062729 3300047469 Bacteria 1587
220 Ga0495593_0186144 3300047673 Bacteria 1045
221 Ga0496102_0074637 3300048905 Bacteria 3118
222 Ga0496103_0515601 3300048906 Bacteria 764
223 Ga0496108_0210705 3300048911 Bacteria 1687
224 Ga0496109_0023483 3300048912 Bacteria 5476
225 Ga0496125_0190445 3300048928 Bacteria 1355
226 Ga0501290_002543 3300049513 Bacteria 2347
227 Ga0501031_0460062 3300049568 Bacteria 822
228 Ga0501032_0032590 3300049569 Bacteria 3570
229 Ga0501032_0243085 3300049569 Bacteria 1169
230 Ga0501033_0061890 3300049570 Bacteria 2757
231 Ga0501034_0039081 3300049571 Bacteria 4806
232 Ga0501034_0896723 3300049571 Bacteria 775
233 Ga0501037_0045082 3300049573 Bacteria 3237
234 Ga0501038_0301636 3300049574 Bacteria 1257
235 Ga0501039_0742967 3300049575 Bacteria 766
236 Ga0501040_0000560 3300049576 Bacteria 22514
237 Ga0501042_0061445 3300049578 Bacteria 2684
238 Ga0501042_0392794 3300049578 Bacteria 1005
239 Ga0501043_0012166 3300049579 Bacteria 6725
240 Ga0501043_0259765 3300049579 Bacteria 1336
241 Ga0501043_0707283 3300049579 Bacteria 735
242 Ga0501046_0002471 3300049580 Bacteria 17326
243 Ga0501046_0361317 3300049580 Bacteria 1053
244 Ga0501067_0310102 3300049583 Bacteria 879
245 Ga0501068_0007908 3300049584 Bacteria 5893
246 Ga0501068_0415506 3300049584 Bacteria 868
247 Ga0501070_0647936 3300049586 Bacteria 839
248 Ga0501072_0006407 3300049588 Bacteria 8968
249 Ga0501073_0005551 3300049589 Bacteria 9435
250 Ga0501073_0147933 3300049589 Bacteria 1628
251 Ga0501074_0073938 3300049590 Bacteria 2448
252 Ga0501075_0001273 3300049591 Bacteria 16347
253 Ga0501080_0013306 3300049742 Bacteria 7561
254 Ga0501081_0000171 3300049743 Bacteria 30406
255 Ga0501083_0128180 3300049744 Bacteria 1663
256 Ga0501035_0446460 3300049822 Bacteria 1070
257 Ga0501044_0050386 3300049823 Bacteria 4296
258 Ga0501044_0354302 3300049823 Bacteria 1386
259 Ga0501044_0696064 3300049823 Bacteria 902
260 Ga0501045_0000437 3300049824 Bacteria 25547
261 nmdc:mga0k408_442875_c1 3300050493 Bacteria 772
262 nmdc:mga07m45_311073_c1 3300050496 Bacteria 916
263 nmdc:mga05p37_161958_c1 3300050507 Bacteria 2732
264 nmdc:mga05p37_218673_c1 3300050507 Bacteria 2300
265 nmdc:mga08x19_14445_c1 3300050514 Bacteria 4789
266 nmdc:mga0a205_398760_c1 3300050515 Bacteria 1240
267 Ga0500644_0016271 3300053088 Bacteria 2139
268 Ga0500614_110123 3300053123 Bacteria 802
269 Ga0500559_0000203 3300053136 Bacteria 47280
270 Ga0500559_0035536 3300053136 Bacteria 2153
271 Ga0500604_0090862 3300053151 Bacteria 997
272 Ga0500616_0110459 3300053153 Bacteria 1329
273 Ga0500619_019572 3300053154 Bacteria 1920
274 Ga0500622_0000873 3300053156 Bacteria 25654
275 Ga0500636_0072480 3300053177 Bacteria 1996
276 Ga0500587_013370 3300053739 Bacteria 1036
277 Ga0501084_0001036 3300054114 Bacteria 21606
278 Ga0501084_0558918 3300054114 Bacteria 967
279 Ga0501082_0665397 3300060353 Bacteria 911
280 2501069651 2501025501 Bacteria 7768574
281 2738758794 2738541283 Bacteria 7222293
282 Ga0157375_10470796
283 JGI25156J39149_1041130
284 JGI25153J46596_10021622
285 Ga0065712_10329068
286 Ga0070676_10007271
287 Ga0070670_100413756
288 Ga0068869_100014487
289 Ga0068868_100269893
290 Ga0070689_100321485
291 Ga0070691_10090441
292 Ga0070691_10151083
293 Ga0070687_100592593
294 Ga0070668_100958809
295 Ga0070671_100613207
296 Ga0070674_100307579
297 Ga0070673_100003637
298 Ga0070659_100748513
299 Ga0070667_100093117
300 Ga0070703_10100874
301 Ga0070701_10520934
302 Ga0070705_100092438
303 Ga0070700_100407202
304 Ga0070694_100010290
305 Ga0070708_102020140
306 Ga0070678_100022446
307 Ga0068867_100022511
308 Ga0068867_100051145
309 Ga0070706_100021834
310 Ga0070706_100102994
311 Ga0070706_101346317
312 Ga0070707_100074831
313 Ga0070707_100676650
314 Ga0070698_101677067
315 Ga0070697_100517886
316 Ga0070672_100051363
317 Ga0070695_100001022
318 Ga0070695_100083806
319 Ga0070696_101106451
320 Ga0070693_100784240
321 Ga0070704_100220661
322 Ga0068855_100291887
323 Ga0068855_100506225
324 Ga0070664_100063531
325 Ga0068857_100015328
326 Ga0068854_100042802
327 Ga0068854_100128715
328 Ga0068854_100447765
329 Ga0068859_100235503
330 Ga0068864_100009530
331 Ga0068866_10048267
332 Ga0068861_100000163
333 Ga0068870_10007131
334 Ga0068870_10231502
335 Ga0068863_100067429
336 Ga0068858_100021710
337 Ga0068860_100030886
338 Ga0068862_100008828
339 Ga0081455_10002261
340 Ga0081455_10400233
341 Ga0075432_10054637
342 Ga0070712_100494049
343 Ga0075362_10191789
344 Ga0075362_10423339
345 Ga0075366_10001709
346 Ga0075366_10110009
347 Ga0075366_10300583
348 Ga0075370_10573271
349 Ga0075433_10059137
350 Ga0075436_100022957
351 Ga0097620_100235496
352 Ga0099795_10067496
353 Ga0105240_11219920
354 Ga0105245_10661395
355 Ga0105245_10713736
356 Ga0114129_10060098
357 Ga0114129_10253859
358 Ga0105243_10088668
359 Ga0105243_10226558
360 Ga0105248_10005106
361 Ga0105239_10478528
362 Ga0105239_10518873
363 Ga0105246_10042282
364 Ga0105246_10702758
365 Ga0157378_10010313
366 Ga0157378_10037827
367 Ga0157378_10532786
368 Ga0163162_10182795
369 Ga0163162_10202229
370 Ga0157372_10050010
371 Ga0157375_10112930
372 Ga0157380_10130230
373 Ga0157380_10256540
374 Ga0182008_10011231
375 Ga0157379_10002520
376 Ga0157376_11325824
377 Ga0209759_1001255
378 Ga0209758_1000045
379 Ga0207653_10061755
380 Ga0207710_10057849
381 Ga0207680_10064628
382 Ga0207699_10628009
383 Ga0207645_10008775
384 Ga0207684_10976975
385 Ga0207693_10514046
386 Ga0207662_10159129
387 Ga0207657_10189496
388 Ga0207646_10066142
389 Ga0207646_10398955
390 Ga0207681_10014348
391 Ga0207650_10005891
392 Ga0207650_10597780
393 Ga0207650_10747675
394 Ga0207687_10471209
395 Ga0207644_10074348
396 Ga0207644_10264687
397 Ga0207706_10089838
398 Ga0207709_10087512
399 Ga0207709_10141135
400 Ga0207670_10160974
401 Ga0207669_10103875
402 Ga0207669_10282239
403 Ga0207704_10488484
404 Ga0207691_10003291
405 Ga0207691_11107957
406 Ga0207689_10118846
407 Ga0207679_10032973
408 Ga0207667_10205071
409 Ga0207667_10500152
410 Ga0207651_10015387
411 Ga0207651_10304398
412 Ga0207668_10484137
413 Ga0207640_10044798
414 Ga0207640_10154241
415 Ga0207658_10009677
416 Ga0207703_10005927
417 Ga0207708_10192900
418 Ga0207641_10192431
419 Ga0207648_10000348
420 Ga0207648_10001548
421 Ga0207648_10046963
422 Ga0207676_10017632
423 Ga0207674_10022583
424 Ga0207674_10023260
425 Ga0207675_101099439
426 Ga0207683_10003507
427 Ga0209969_1001291
428 Ga0209967_1005796
429 Ga0209981_1001875
430 Ga0209996_1004227
431 Ga0210000_1003933
432 Ga0209995_1004693
433 Ga0209179_1051799
434 Ga0209968_1002561
435 Ga0209999_1000652
436 Ga0209982_1010905
437 Ga0209970_1007320
438 Ga0210002_1009058
439 Ga0209983_1007215
440 Ga0209971_1000102
441 Ga0209966_1000058
442 Ga0209998_10000922
443 Ga0209974_10003495
444 Ga0268265_10050835
445 Ga0268264_10003538
446 Ga0268264_10559440
447 Ga0307515_10114830
448 Ga0265332_10000128
449 Ga0265328_10002207
450 Ga0307513_10159043
451 Ga0307509_10006668
452 Ga0307509_10048750
453 Ga0307508_10010240
454 Ga0307508_10011657
455 Ga0307508_10411615
456 Ga0307514_10049920
457 Ga0307516_10598090
458 Ga0307507_10265296
459 Ga0307507_10374600
460 Ga0307510_10031450
461 Ga0307510_10257656
462 Ga0373931_0213031
463 Ga0373931_0316904
464 Ga0242420_141792
465 Ga0436361_0714943
466 Ga0439464_0001007
467 Ga0439460_0001111
468 Ga0451577_0012508
469 Ga0466969_0002537
470 Ga0466972_0002440
471 Ga0453683_0059878
472 Ga0453683_0622498
473 Ga0466965_0074037
474 Ga0466966_0003298
475 Ga0466961_0006006
476 Ga0466963_0198513
477 Ga0466964_0495133
478 Ga0453684_0021679
479 Ga0453684_0084376
480 Ga0453684_0265606
481 Ga0453684_0534137
482 Ga0453684_0643319
483 Ga0466968_0014864
484 Ga0466959_0033038
485 Ga0466959_0191507
486 Ga0451576_0012259
487 Ga0451576_0027638
488 Ga0451576_0219453
489 Ga0495592_0000142
490 Ga0495629_0525706
491 Ga0495620_0200487
492 Ga0495632_0076232
493 Ga0495648_0328766
494 Ga0495666_0210848
495 Ga0495645_0099981
496 Ga0495646_0294117
497 Ga0495647_0579441
498 Ga0495658_0006084
499 Ga0495624_0128685
500 Ga0495673_0062729
501 Ga0495593_0186144
502 Ga0496102_0074637
503 Ga0496103_0515601
504 Ga0496108_0210705
505 Ga0496109_0023483
506 Ga0496125_0190445
507 Ga0501290_002543
508 Ga0501031_0460062
509 Ga0501032_0032590
510 Ga0501032_0243085
511 Ga0501033_0061890
512 Ga0501034_0039081
513 Ga0501034_0896723
514 Ga0501037_0045082
515 Ga0501038_0301636
516 Ga0501039_0742967
517 Ga0501040_0000560
518 Ga0501042_0061445
519 Ga0501042_0392794
520 Ga0501043_0012166
521 Ga0501043_0259765
522 Ga0501043_0707283
523 Ga0501046_0002471
524 Ga0501046_0361317
525 Ga0501067_0310102
526 Ga0501068_0007908
527 Ga0501068_0415506
528 Ga0501070_0647936
529 Ga0501072_0006407
530 Ga0501073_0005551
531 Ga0501073_0147933
532 Ga0501074_0073938
533 Ga0501075_0001273
534 Ga0501080_0013306
535 Ga0501081_0000171
536 Ga0501083_0128180
537 Ga0501035_0446460
538 Ga0501044_0050386
539 Ga0501044_0354302
540 Ga0501044_0696064
541 Ga0501045_0000437
542 nmdc:mga0k408_442875_c1
543 nmdc:mga07m45_311073_c1
544 nmdc:mga05p37_161958_c1
545 nmdc:mga05p37_218673_c1
546 nmdc:mga08x19_14445_c1
547 nmdc:mga0a205_398760_c1
548 Ga0500644_0016271
549 Ga0500614_110123
550 Ga0500559_0000203
551 Ga0500559_0035536
552 Ga0500604_0090862
553 Ga0500616_0110459
554 Ga0500619_019572
555 Ga0500622_0000873
556 Ga0500636_0072480
557 Ga0500587_013370
558 Ga0501084_0001036
559 Ga0501084_0558918
560 Ga0501082_0665397
561 2501069651
562 2738758794

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

45

175

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9917 4 145
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9906 4 145
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9879 4 145
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9765 4 145
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.974 4 145
ID Description Score Start End Superfamily
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9904 4 145 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.976 4 145 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8934 4 141 3.30.530.20
2ldkA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8881 4 141 3.30.530.20
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8488 4 141 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A530H529-F1-model_v4 Toxin 1 5 136
AF-A0A529M9F3-F1-model_v4 Toxin 0.9968 5 119
AF-A0A527HZZ3-F1-model_v4 deleted 0.9962 3 105
AF-A0A1C6NIL8-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9941 4 145
AF-A0A3C0B758-F1-model_v4 Polyketide cyclase 0.9921 50 131

Map