F384336

General Info

Members Datasets Scaffolds Average Seq Length
281 165 562 134

Family's Representative Sequence

Representative Sequence 3300025927|Ga0207687_10007619|Ga0207687_100076197
Length 160
Sequence VNIEWFTLETKISSGLIYTLCFMPPWGSINSMSEDPQGKKILLVEDDDALASVYTMRLKGEGFVVTRVANGEDALAAAKEHKPDLILLDAMMPKVSGFDVLDILRNTPETANLKIIMLTALSQETDKQRAQGLGVDDYLVKSQVVISDVVDRIKYHLGLS

Samples

Sample ID Description Type Environment
1 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
100 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
112 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
113 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
136 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
137 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
138 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
139 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
140 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
141 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
142 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
143 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
144 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
145 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
146 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
147 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
148 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
149 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
150 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
151 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
152 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
153 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
154 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
155 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
156 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
157 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
158 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
159 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
160 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
161 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
162 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
163 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.28
Nodule 0
Rhizoplane 1.78
Rhizosphere 76.16
Stem 0
Stem Tuber 0
Unclassified 15.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207687_10007619 3300025927 Bacteria 7118
2 rootH2_10138994 3300003320 Bacteria 2464
3 rootH2_10300390 3300003320 Bacteria 1633
4 rootL2_10113312 3300003322 Bacteria 3461
5 rootH1_10217599 3300003323 Bacteria 3206
6 JGI25405J52794_10021008 3300003911 Bacteria 1318
7 Ga0070658_10000036 3300005327 Bacteria 143743
8 Ga0070658_10002131 3300005327 Bacteria 16615
9 Ga0070658_10011577 3300005327 Bacteria 7077
10 Ga0070658_10404313 3300005327 Bacteria 1173
11 Ga0070658_10560378 3300005327 Unclassified 989
12 Ga0070658_11158239 3300005327 Unclassified 672
13 Ga0070676_10006474 3300005328 Bacteria 6257
14 Ga0070676_10621167 3300005328 Bacteria 781
15 Ga0070683_101700279 3300005329 Bacteria 607
16 Ga0070666_10635378 3300005335 Bacteria 780
17 Ga0070680_101478414 3300005336 Bacteria 588
18 Ga0070682_100001662 3300005337 Bacteria 12364
19 Ga0070660_100711913 3300005339 Unclassified 842
20 Ga0070668_100112597 3300005347 Bacteria 2167
21 Ga0070671_100007741 3300005355 Bacteria 8583
22 Ga0070674_100007469 3300005356 Bacteria 6448
23 Ga0070673_100012444 3300005364 Bacteria 5842
24 Ga0070659_100356996 3300005366 Bacteria 1227
25 Ga0070667_100009751 3300005367 Bacteria 7962
26 Ga0070667_100015465 3300005367 Bacteria 6311
27 Ga0070663_100083698 3300005455 Bacteria 2350
28 Ga0070678_100000867 3300005456 Bacteria 15459
29 Ga0070678_100166701 3300005456 Bacteria 1790
30 Ga0070681_10003503 3300005458 Bacteria 14697
31 Ga0070681_10197909 3300005458 Bacteria 1928
32 Ga0070681_10464609 3300005458 Bacteria 1178
33 Ga0070685_10003504 3300005466 Bacteria 7984
34 Ga0070685_10302888 3300005466 Unclassified 1078
35 Ga0070679_100048580 3300005530 Bacteria 4226
36 Ga0070679_100075490 3300005530 Bacteria 3360
37 Ga0070679_100111785 3300005530 Bacteria 2718
38 Ga0070679_100315207 3300005530 Bacteria 1514
39 Ga0070684_101353628 3300005535 Bacteria 670
40 Ga0070665_100076900 3300005548 Bacteria 3344
41 Ga0070665_100229266 3300005548 Bacteria 1857
42 Ga0068855_100003265 3300005563 Bacteria 19847
43 Ga0068855_100097546 3300005563 Bacteria 3385
44 Ga0068855_100924815 3300005563 Unclassified 920
45 Ga0068855_101530782 3300005563 Unclassified 684
46 Ga0070664_100659984 3300005564 Bacteria 972
47 Ga0068856_100003627 3300005614 Bacteria 15508
48 Ga0068856_100311663 3300005614 Unclassified 1591
49 Ga0068856_100805196 3300005614 Bacteria 959
50 Ga0068859_100063258 3300005617 Bacteria 3731
51 Ga0068864_100707875 3300005618 Bacteria 984
52 Ga0068863_100132671 3300005841 Bacteria 2378
53 Ga0068863_100180615 3300005841 Bacteria 2025
54 Ga0068858_100432122 3300005842 Bacteria 1267
55 Ga0068860_100080290 3300005843 Bacteria 3102
56 Ga0068862_100660216 3300005844 Bacteria 1009
57 Ga0081455_10000003 3300005937 Bacteria 367763
58 Ga0075363_100039945 3300006048 Bacteria 2472
59 Ga0075364_10019027 3300006051 Bacteria 4308
60 Ga0075364_10217775 3300006051 Bacteria 1295
61 Ga0075369_10000042 3300006186 Bacteria 33379
62 Ga0075369_10000845 3300006186 Bacteria 10098
63 Ga0075366_10000001 3300006195 Bacteria 569172
64 Ga0075366_10002255 3300006195 Bacteria 9851
65 Ga0075370_10014627 3300006353 Bacteria 4190
66 Ga0075370_10628282 3300006353 Unclassified 651
67 Ga0068871_100763610 3300006358 Bacteria 889
68 Ga0068871_101483894 3300006358 Bacteria 640
69 Ga0068865_100034029 3300006881 Unclassified 3416
70 Ga0068865_100486680 3300006881 Bacteria 1026
71 Ga0097620_100063255 3300006931 Bacteria 3731
72 Ga0105240_10000003 3300009093 Bacteria 1183681
73 Ga0105245_10000001 3300009098 Bacteria 939270
74 Ga0105245_10000093 3300009098 Bacteria 86866
75 Ga0105245_10013517 3300009098 Bacteria 7108
76 Ga0105245_10065851 3300009098 Unclassified 3277
77 Ga0105245_10088823 3300009098 Bacteria 2839
78 Ga0105245_10455725 3300009098 Unclassified 1288
79 Ga0105245_12646879 3300009098 Bacteria 555
80 Ga0105243_10000001 3300009148 Bacteria 1156578
81 Ga0105243_10001490 3300009148 Bacteria 20502
82 Ga0105242_10000002 3300009176 Bacteria 262559
83 Ga0105242_10001924 3300009176 Bacteria 16329
84 Ga0105242_10161097 3300009176 Unclassified 1964
85 Ga0105242_10402746 3300009176 Bacteria 1277
86 Ga0105248_10068249 3300009177 Bacteria 3992
87 Ga0105248_10848850 3300009177 Bacteria 1031
88 Ga0105237_10010322 3300009545 Bacteria 9950
89 Ga0105237_11989945 3300009545 Bacteria 589
90 Ga0105238_10187685 3300009551 Unclassified 2043
91 Ga0105238_12295422 3300009551 Bacteria 575
92 Ga0105249_10396784 3300009553 Bacteria 1409
93 Ga0105239_10129856 3300010375 Bacteria 2802
94 Ga0105239_11330179 3300010375 Bacteria 829
95 Ga0105246_10088314 3300011119 Unclassified 2227
96 Ga0105246_10535845 3300011119 Unclassified 1001
97 Ga0157371_10001803 3300013102 Bacteria 21647
98 Ga0157371_11026429 3300013102 Unclassified 630
99 Ga0157369_10875790 3300013105 Unclassified 921
100 Ga0157369_11443005 3300013105 Bacteria 700
101 Ga0157374_10000225 3300013296 Bacteria 52365
102 Ga0157374_10005951 3300013296 Bacteria 10312
103 Ga0157374_10006116 3300013296 Bacteria 10191
104 Ga0157374_10251614 3300013296 Unclassified 1739
105 Ga0157374_10517606 3300013296 Bacteria 1199
106 Ga0157374_11398200 3300013296 Bacteria 722
107 Ga0157374_12553795 3300013296 Bacteria 538
108 Ga0157378_10157870 3300013297 Bacteria 2119
109 Ga0157378_12616371 3300013297 Unclassified 557
110 Ga0157375_11536764 3300013308 Unclassified 786
111 Ga0163163_10062840 3300014325 Bacteria 3680
112 Ga0163163_10255135 3300014325 Unclassified 1804
113 Ga0163163_11942178 3300014325 Unclassified 648
114 Ga0157377_10008772 3300014745 Bacteria 4944
115 Ga0157377_10017090 3300014745 Bacteria 3747
116 Ga0157376_10000007 3300014969 Bacteria 368004
117 Ga0207647_10005315 3300025904 Bacteria 9464
118 Ga0207647_10383554 3300025904 Bacteria 793
119 Ga0207645_10031310 3300025907 Bacteria 3423
120 Ga0207705_10000011 3300025909 Bacteria 517768
121 Ga0207705_10000065 3300025909 Bacteria 137123
122 Ga0207705_10041774 3300025909 Bacteria 3290
123 Ga0207707_10049716 3300025912 Bacteria 3653
124 Ga0207707_10619268 3300025912 Bacteria 915
125 Ga0207695_10000005 3300025913 Bacteria 1196715
126 Ga0207671_10098039 3300025914 Bacteria 2217
127 Ga0207671_11229938 3300025914 Bacteria 585
128 Ga0207660_10003941 3300025917 Bacteria 9669
129 Ga0207657_10183180 3300025919 Bacteria 1692
130 Ga0207657_10485580 3300025919 Bacteria 968
131 Ga0207657_10641701 3300025919 Unclassified 827
132 Ga0207652_10077233 3300025921 Bacteria 2906
133 Ga0207652_10104792 3300025921 Bacteria 2502
134 Ga0207652_10115008 3300025921 Bacteria 2389
135 Ga0207687_10000004 3300025927 Bacteria 841177
136 Ga0207687_10000907 3300025927 Bacteria 20171
137 Ga0207687_10249521 3300025927 Unclassified 1410
138 Ga0207687_10561505 3300025927 Unclassified 958
139 Ga0207687_10736806 3300025927 Unclassified 838
140 Ga0207644_10084931 3300025931 Bacteria 2347
141 Ga0207690_10304475 3300025932 Bacteria 1248
142 Ga0207686_10000001 3300025934 Bacteria 1169580
143 Ga0207686_10001050 3300025934 Bacteria 16339
144 Ga0207686_10101839 3300025934 Unclassified 1919
145 Ga0207709_10000002 3300025935 Bacteria 1171536
146 Ga0207709_10045841 3300025935 Bacteria 2650
147 Ga0207669_10003116 3300025937 Bacteria 7143
148 Ga0207704_10722393 3300025938 Unclassified 826
149 Ga0207691_10069298 3300025940 Bacteria 3186
150 Ga0207711_10046717 3300025941 Bacteria 3700
151 Ga0207711_10543335 3300025941 Bacteria 1084
152 Ga0207667_10003751 3300025949 Bacteria 18715
153 Ga0207667_10045938 3300025949 Bacteria 4624
154 Ga0207667_10330297 3300025949 Bacteria 1557
155 Ga0207667_11288099 3300025949 Unclassified 708
156 Ga0207667_11769167 3300025949 Unclassified 583
157 Ga0207651_10005395 3300025960 Bacteria 6556
158 Ga0207712_10267765 3300025961 Bacteria 1388
159 Ga0207658_10012025 3300025986 Bacteria 5904
160 Ga0207703_10106426 3300026035 Bacteria 2386
161 Ga0207639_10021773 3300026041 Bacteria 4608
162 Ga0207678_10068646 3300026067 Bacteria 3041
163 Ga0207702_10000062 3300026078 Bacteria 124850
164 Ga0207702_10018901 3300026078 Bacteria 5700
165 Ga0207641_10108205 3300026088 Bacteria 2460
166 Ga0207674_10263781 3300026116 Bacteria 1670
167 Ga0207674_10298621 3300026116 Bacteria 1560
168 Ga0207675_102366839 3300026118 Unclassified 544
169 Ga0207683_10001083 3300026121 Bacteria 24823
170 Ga0207683_10005840 3300026121 Bacteria 10553
171 Ga0268266_10719828 3300028379 Bacteria 962
172 Ga0268264_10062819 3300028381 Bacteria 3120
173 Ga0265326_10216366 3300028558 Unclassified 551
174 Ga0265334_10000403 3300028573 Bacteria 22701
175 Ga0265336_10189676 3300028666 Unclassified 611
176 Ga0265338_10000323 3300028800 Bacteria 87009
177 Ga0265338_10001590 3300028800 Bacteria 36442
178 Ga0265338_10122928 3300028800 Bacteria 2065
179 Ga0265340_10007442 3300031247 Bacteria 5944
180 Ga0265327_10003876 3300031251 Bacteria 13782
181 Ga0265342_10066847 3300031712 Bacteria 2105
182 Ga0307516_10339382 3300031730 Bacteria 1170
183 Ga0395899_0005059 3300037312 Bacteria 10257
184 Ga0395899_0009465 3300037312 Bacteria 7478
185 Ga0395899_0435203 3300037312 Bacteria 862
186 Ga0395899_0496566 3300037312 Unclassified 792
187 Ga0395900_0000520 3300037418 Bacteria 54397
188 Ga0395900_0025131 3300037418 Bacteria 6097
189 Ga0395900_0057344 3300037418 Bacteria 4009
190 Ga0395900_0111578 3300037418 Bacteria 2809
191 Ga0395900_0182337 3300037418 Bacteria 2133
192 Ga0395900_0256497 3300037418 Bacteria 1748
193 Ga0395898_0002453 3300037466 Bacteria 21908
194 Ga0395898_0080368 3300037466 Unclassified 3144
195 Ga0395905_0000937 3300037471 Bacteria 37558
196 Ga0395905_0023742 3300037471 Bacteria 5789
197 Ga0395905_0030654 3300037471 Bacteria 5065
198 Ga0395905_1042232 3300037471 Unclassified 721
199 Ga0395901_0001452 3300038443 Bacteria 24693
200 Ga0395901_0032234 3300038443 Bacteria 5407
201 Ga0395901_0810531 3300038443 Bacteria 924
202 Ga0451807_0614734 3300041486 Bacteria 1352
203 Ga0466966_0373779 3300044684 Bacteria 856
204 Ga0466967_0168264 3300045976 Bacteria 2061
205 Ga0466967_0342497 3300045976 Unclassified 1446
206 Ga0495629_0129887 3300046459 Bacteria 1755
207 Ga0495582_0030308 3300046473 Bacteria 2970
208 Ga0495609_0154423 3300046538 Bacteria 975
209 Ga0495622_0000051 3300046557 Bacteria 105674
210 Ga0495611_0577627 3300046648 Unclassified 508
211 Ga0495658_0009251 3300046683 Bacteria 4901
212 Ga0495658_0384063 3300046683 Bacteria 894
213 Ga0495600_0021762 3300046809 Bacteria 4111
214 Ga0495672_0075726 3300047320 Bacteria 1892
215 Ga0496100_0711051 3300048903 Bacteria 784
216 Ga0496105_0065098 3300048908 Unclassified 3009
217 Ga0496105_1002725 3300048908 Bacteria 624
218 Ga0496112_0027304 3300048915 Bacteria 5504
219 Ga0501032_0313374 3300049569 Bacteria 1013
220 Ga0501034_0001363 3300049571 Bacteria 32981
221 Ga0501037_0091462 3300049573 Bacteria 2200
222 Ga0501043_0123316 3300049579 Bacteria 2032
223 Ga0501047_0000119 3300049581 Bacteria 96051
224 Ga0501048_0090054 3300049582 Bacteria 2164
225 Ga0501070_0491736 3300049586 Unclassified 986
226 Ga0501073_0050333 3300049589 Bacteria 2920
227 Ga0501073_0333391 3300049589 Bacteria 1047
228 Ga0501080_0000893 3300049742 Bacteria 24429
229 Ga0501083_0135850 3300049744 Bacteria 1611
230 Ga0501035_0000570 3300049822 Bacteria 40767
231 Ga0501044_0021401 3300049823 Bacteria 6900
232 nmdc:mga03n38_368303_c1 3300050490 Bacteria 785
233 nmdc:mga03n38_382898_c1 3300050490 Unclassified 771
234 nmdc:mga00v17_250285_c1 3300050491 Bacteria 1149
235 nmdc:mga00v17_26893_c1 3300050491 Bacteria 3355
236 nmdc:mga0yw44_124059_c1 3300050492 Unclassified 1666
237 nmdc:mga0k408_113_c1 3300050493 Bacteria 39351
238 nmdc:mga0k408_1961_c2 3300050493 Bacteria 9850
239 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
240 nmdc:mga07m45_8899_c2 3300050496 Bacteria 4480
241 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
242 nmdc:mga0sz30_386361_c1 3300050516 Bacteria 627
243 nmdc:mga0sz30_4_c1 3300050516 Bacteria 84956
244 Ga0500610_0000002 3300053079 Bacteria 166752
245 Ga0500643_000010 3300053087 Bacteria 408084
246 Ga0500643_002840 3300053087 Bacteria 8637
247 Ga0500644_0000198 3300053088 Bacteria 36907
248 Ga0500644_0003980 3300053088 Bacteria 3675
249 Ga0500644_0019598 3300053088 Bacteria 1999
250 Ga0500644_0054522 3300053088 Bacteria 1384
251 Ga0500646_0000510 3300053090 Bacteria 11408
252 Ga0500583_0000057 3300053092 Bacteria 71874
253 Ga0500583_0002559 3300053092 Bacteria 5495
254 Ga0500583_0114774 3300053092 Bacteria 1329
255 Ga0500651_0000381 3300053093 Bacteria 24265
256 Ga0500651_0049807 3300053093 Bacteria 2630
257 Ga0500566_0000001 3300053094 Bacteria 1101031
258 Ga0500650_0000001 3300053098 Bacteria 818797
259 Ga0500555_000002 3300053103 Bacteria 1314346
260 Ga0500562_018293 3300053108 Bacteria 1809
261 Ga0500594_0000001 3300053118 Bacteria 1178472
262 Ga0500594_0000258 3300053118 Bacteria 12500
263 Ga0500594_0344896 3300053118 Bacteria 501
264 Ga0500614_000850 3300053123 Bacteria 7692
265 Ga0500628_000009 3300053129 Bacteria 122386
266 Ga0500628_028077 3300053129 Unclassified 1198
267 Ga0500642_0347785 3300053130 Bacteria 658
268 Ga0500652_000119 3300053131 Bacteria 30219
269 Ga0500655_000400 3300053133 Bacteria 9181
270 Ga0500568_0013420 3300053139 Bacteria 3736
271 Ga0500577_0000288 3300053142 Bacteria 13114
272 Ga0500579_002076 3300053143 Bacteria 11828
273 Ga0500589_000002 3300053147 Bacteria 245055
274 Ga0500616_0207719 3300053153 Bacteria 863
275 Ga0500622_0110435 3300053156 Bacteria 1344
276 Ga0500633_0002385 3300053160 Bacteria 3852
277 Ga0500570_000003 3300053724 Bacteria 149500
278 Ga0500611_130648 3300053727 Bacteria 676
279 Ga0500599_025698 3300053736 Bacteria 855
280 Ga0501084_0231450 3300054114 Unclassified 1560
281 Ga0587094_004609 3300059513 Bacteria 1574
282 Ga0207687_10007619
283 rootH2_10138994
284 rootH2_10300390
285 rootL2_10113312
286 rootH1_10217599
287 JGI25405J52794_10021008
288 Ga0070658_10000036
289 Ga0070658_10002131
290 Ga0070658_10011577
291 Ga0070658_10404313
292 Ga0070658_10560378
293 Ga0070658_11158239
294 Ga0070676_10006474
295 Ga0070676_10621167
296 Ga0070683_101700279
297 Ga0070666_10635378
298 Ga0070680_101478414
299 Ga0070682_100001662
300 Ga0070660_100711913
301 Ga0070668_100112597
302 Ga0070671_100007741
303 Ga0070674_100007469
304 Ga0070673_100012444
305 Ga0070659_100356996
306 Ga0070667_100009751
307 Ga0070667_100015465
308 Ga0070663_100083698
309 Ga0070678_100000867
310 Ga0070678_100166701
311 Ga0070681_10003503
312 Ga0070681_10197909
313 Ga0070681_10464609
314 Ga0070685_10003504
315 Ga0070685_10302888
316 Ga0070679_100048580
317 Ga0070679_100075490
318 Ga0070679_100111785
319 Ga0070679_100315207
320 Ga0070684_101353628
321 Ga0070665_100076900
322 Ga0070665_100229266
323 Ga0068855_100003265
324 Ga0068855_100097546
325 Ga0068855_100924815
326 Ga0068855_101530782
327 Ga0070664_100659984
328 Ga0068856_100003627
329 Ga0068856_100311663
330 Ga0068856_100805196
331 Ga0068859_100063258
332 Ga0068864_100707875
333 Ga0068863_100132671
334 Ga0068863_100180615
335 Ga0068858_100432122
336 Ga0068860_100080290
337 Ga0068862_100660216
338 Ga0081455_10000003
339 Ga0075363_100039945
340 Ga0075364_10019027
341 Ga0075364_10217775
342 Ga0075369_10000042
343 Ga0075369_10000845
344 Ga0075366_10000001
345 Ga0075366_10002255
346 Ga0075370_10014627
347 Ga0075370_10628282
348 Ga0068871_100763610
349 Ga0068871_101483894
350 Ga0068865_100034029
351 Ga0068865_100486680
352 Ga0097620_100063255
353 Ga0105240_10000003
354 Ga0105245_10000001
355 Ga0105245_10000093
356 Ga0105245_10013517
357 Ga0105245_10065851
358 Ga0105245_10088823
359 Ga0105245_10455725
360 Ga0105245_12646879
361 Ga0105243_10000001
362 Ga0105243_10001490
363 Ga0105242_10000002
364 Ga0105242_10001924
365 Ga0105242_10161097
366 Ga0105242_10402746
367 Ga0105248_10068249
368 Ga0105248_10848850
369 Ga0105237_10010322
370 Ga0105237_11989945
371 Ga0105238_10187685
372 Ga0105238_12295422
373 Ga0105249_10396784
374 Ga0105239_10129856
375 Ga0105239_11330179
376 Ga0105246_10088314
377 Ga0105246_10535845
378 Ga0157371_10001803
379 Ga0157371_11026429
380 Ga0157369_10875790
381 Ga0157369_11443005
382 Ga0157374_10000225
383 Ga0157374_10005951
384 Ga0157374_10006116
385 Ga0157374_10251614
386 Ga0157374_10517606
387 Ga0157374_11398200
388 Ga0157374_12553795
389 Ga0157378_10157870
390 Ga0157378_12616371
391 Ga0157375_11536764
392 Ga0163163_10062840
393 Ga0163163_10255135
394 Ga0163163_11942178
395 Ga0157377_10008772
396 Ga0157377_10017090
397 Ga0157376_10000007
398 Ga0207647_10005315
399 Ga0207647_10383554
400 Ga0207645_10031310
401 Ga0207705_10000011
402 Ga0207705_10000065
403 Ga0207705_10041774
404 Ga0207707_10049716
405 Ga0207707_10619268
406 Ga0207695_10000005
407 Ga0207671_10098039
408 Ga0207671_11229938
409 Ga0207660_10003941
410 Ga0207657_10183180
411 Ga0207657_10485580
412 Ga0207657_10641701
413 Ga0207652_10077233
414 Ga0207652_10104792
415 Ga0207652_10115008
416 Ga0207687_10000004
417 Ga0207687_10000907
418 Ga0207687_10249521
419 Ga0207687_10561505
420 Ga0207687_10736806
421 Ga0207644_10084931
422 Ga0207690_10304475
423 Ga0207686_10000001
424 Ga0207686_10001050
425 Ga0207686_10101839
426 Ga0207709_10000002
427 Ga0207709_10045841
428 Ga0207669_10003116
429 Ga0207704_10722393
430 Ga0207691_10069298
431 Ga0207711_10046717
432 Ga0207711_10543335
433 Ga0207667_10003751
434 Ga0207667_10045938
435 Ga0207667_10330297
436 Ga0207667_11288099
437 Ga0207667_11769167
438 Ga0207651_10005395
439 Ga0207712_10267765
440 Ga0207658_10012025
441 Ga0207703_10106426
442 Ga0207639_10021773
443 Ga0207678_10068646
444 Ga0207702_10000062
445 Ga0207702_10018901
446 Ga0207641_10108205
447 Ga0207674_10263781
448 Ga0207674_10298621
449 Ga0207675_102366839
450 Ga0207683_10001083
451 Ga0207683_10005840
452 Ga0268266_10719828
453 Ga0268264_10062819
454 Ga0265326_10216366
455 Ga0265334_10000403
456 Ga0265336_10189676
457 Ga0265338_10000323
458 Ga0265338_10001590
459 Ga0265338_10122928
460 Ga0265340_10007442
461 Ga0265327_10003876
462 Ga0265342_10066847
463 Ga0307516_10339382
464 Ga0395899_0005059
465 Ga0395899_0009465
466 Ga0395899_0435203
467 Ga0395899_0496566
468 Ga0395900_0000520
469 Ga0395900_0025131
470 Ga0395900_0057344
471 Ga0395900_0111578
472 Ga0395900_0182337
473 Ga0395900_0256497
474 Ga0395898_0002453
475 Ga0395898_0080368
476 Ga0395905_0000937
477 Ga0395905_0023742
478 Ga0395905_0030654
479 Ga0395905_1042232
480 Ga0395901_0001452
481 Ga0395901_0032234
482 Ga0395901_0810531
483 Ga0451807_0614734
484 Ga0466966_0373779
485 Ga0466967_0168264
486 Ga0466967_0342497
487 Ga0495629_0129887
488 Ga0495582_0030308
489 Ga0495609_0154423
490 Ga0495622_0000051
491 Ga0495611_0577627
492 Ga0495658_0009251
493 Ga0495658_0384063
494 Ga0495600_0021762
495 Ga0495672_0075726
496 Ga0496100_0711051
497 Ga0496105_0065098
498 Ga0496105_1002725
499 Ga0496112_0027304
500 Ga0501032_0313374
501 Ga0501034_0001363
502 Ga0501037_0091462
503 Ga0501043_0123316
504 Ga0501047_0000119
505 Ga0501048_0090054
506 Ga0501070_0491736
507 Ga0501073_0050333
508 Ga0501073_0333391
509 Ga0501080_0000893
510 Ga0501083_0135850
511 Ga0501035_0000570
512 Ga0501044_0021401
513 nmdc:mga03n38_368303_c1
514 nmdc:mga03n38_382898_c1
515 nmdc:mga00v17_250285_c1
516 nmdc:mga00v17_26893_c1
517 nmdc:mga0yw44_124059_c1
518 nmdc:mga0k408_113_c1
519 nmdc:mga0k408_1961_c2
520 nmdc:mga0k408_1_c1
521 nmdc:mga07m45_8899_c2
522 nmdc:mga0sz30_1_c1
523 nmdc:mga0sz30_386361_c1
524 nmdc:mga0sz30_4_c1
525 Ga0500610_0000002
526 Ga0500643_000010
527 Ga0500643_002840
528 Ga0500644_0000198
529 Ga0500644_0003980
530 Ga0500644_0019598
531 Ga0500644_0054522
532 Ga0500646_0000510
533 Ga0500583_0000057
534 Ga0500583_0002559
535 Ga0500583_0114774
536 Ga0500651_0000381
537 Ga0500651_0049807
538 Ga0500566_0000001
539 Ga0500650_0000001
540 Ga0500555_000002
541 Ga0500562_018293
542 Ga0500594_0000001
543 Ga0500594_0000258
544 Ga0500594_0344896
545 Ga0500614_000850
546 Ga0500628_000009
547 Ga0500628_028077
548 Ga0500642_0347785
549 Ga0500652_000119
550 Ga0500655_000400
551 Ga0500568_0013420
552 Ga0500577_0000288
553 Ga0500579_002076
554 Ga0500589_000002
555 Ga0500616_0207719
556 Ga0500622_0110435
557 Ga0500633_0002385
558 Ga0500570_000003
559 Ga0500611_130648
560 Ga0500599_025698
561 Ga0501084_0231450
562 Ga0587094_004609

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

41

154

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pl1-assembly1.cif.gz_A berrylium fluoride activated receiver domain of e.coli phop 0.9489 13 131
4lx8-assembly1.cif.gz_A crystal structure (2.2a) of mg2+ bound chey3 of vibrio cholerae 0.9489 11 114
4kfc-assembly1.cif.gz_A crystal structure of a hyperactive mutant of response regulator kdpe complexed to its promoter dna 0.9467 10 131
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.9442 11 128
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9441 12 128
ID Description Score Start End Superfamily
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.96 12 93 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9541 11 93 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9534 10 93 3.40.50.2300
af_O14283_368_529_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9492 13 130 3.40.50.2300
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9491 13 93 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1J5HG63-F1-model_v4 Two-component system response regulator 0.9732 10 128 GO:0000160
AF-A0A136LND6-F1-model_v4 Response regulator receiver protein 0.9722 10 131 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7X9K873-F1-model_v4 deleted 0.9721 10 131
AF-A0A7C3SY16-F1-model_v4 Response regulator 0.972 8 130 GO:0000160
AF-A0A117MDS2-F1-model_v4 Phosphate regulon transcriptional regulatory protein PhoB (SphR) 0.9718 11 131 GO:0000160

Map