F384491

General Info

Members Datasets Scaffolds Average Seq Length
281 149 281 178

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0003645|Ga0451576_0003645_6223_6756
Length 177
Sequence MELRERFASVSILFLDVDGVLTDGRVTLDGKGGETKDFDVTDGLGLRLLQDSGVTVALITGRVSEVVAQRAKELRIAELHQGVRDKVPVFRKILLEKGLAPKNAAYVGDDLLDLPVLTRVGLAVTVPSAPEEVKSSVHYVTAKNGGRGAVREVCEEILKAKGQWDSIVKGFLGAEEP

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
121 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
137 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
142 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
147 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.34
Rhizosphere 94.31
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_13990851 2162886012 Bacteria 894
2 Ga0065712_10000485 3300005290 Bacteria 12704
3 Ga0065712_10071100 3300005290 Bacteria 5486
4 Ga0065715_10099963 3300005293 Bacteria 3352
5 Ga0065715_10184816 3300005293 Bacteria 1452
6 Ga0065715_10190788 3300005293 Bacteria 1416
7 Ga0065707_10109901 3300005295 Bacteria 2452
8 Ga0070676_10064728 3300005328 Bacteria 2181
9 Ga0070683_100000857 3300005329 Bacteria 22475
10 Ga0070683_100334396 3300005329 Bacteria 1442
11 Ga0070690_100024967 3300005330 Bacteria 3679
12 Ga0070690_100491485 3300005330 Bacteria 917
13 Ga0070670_100041349 3300005331 Bacteria 3962
14 Ga0070670_100088314 3300005331 Bacteria 2665
15 Ga0070670_100384336 3300005331 Bacteria 1237
16 Ga0070670_100575934 3300005331 Bacteria 1006
17 Ga0070666_10016739 3300005335 Bacteria 4694
18 Ga0070680_100068639 3300005336 Bacteria 2910
19 Ga0068868_100084575 3300005338 Bacteria 2548
20 Ga0070691_10001081 3300005341 Bacteria 11289
21 Ga0070687_100154589 3300005343 Bacteria 1350
22 Ga0070661_100343902 3300005344 Bacteria 1169
23 Ga0070668_100055676 3300005347 Bacteria 3053
24 Ga0070668_100304617 3300005347 Bacteria 1337
25 Ga0070669_100002972 3300005353 Bacteria 12219
26 Ga0070669_100073654 3300005353 Bacteria 2530
27 Ga0070669_100125922 3300005353 Bacteria 1960
28 Ga0070669_101030748 3300005353 Bacteria 707
29 Ga0070675_100171758 3300005354 Bacteria 1870
30 Ga0070675_100256572 3300005354 Bacteria 1531
31 Ga0070675_101485961 3300005354 Bacteria 625
32 Ga0070671_100026542 3300005355 Bacteria 4761
33 Ga0070671_100215002 3300005355 Bacteria 1631
34 Ga0070674_100002729 3300005356 Bacteria 9764
35 Ga0070674_100181191 3300005356 Bacteria 1614
36 Ga0070674_100512441 3300005356 Bacteria 1001
37 Ga0070673_100886248 3300005364 Bacteria 827
38 Ga0070688_100114836 3300005365 Bacteria 1796
39 Ga0070688_100299297 3300005365 Bacteria 1162
40 Ga0070659_100699730 3300005366 Bacteria 876
41 Ga0070701_10001830 3300005438 Bacteria 8046
42 Ga0070701_10141606 3300005438 Bacteria 1376
43 Ga0070701_10427646 3300005438 Bacteria 845
44 Ga0070705_100001314 3300005440 Bacteria 13321
45 Ga0070700_100001496 3300005441 Bacteria 11632
46 Ga0070700_100713663 3300005441 Bacteria 799
47 Ga0070694_100003841 3300005444 Bacteria 8975
48 Ga0070678_100114481 3300005456 Bacteria 2116
49 Ga0070678_100427987 3300005456 Bacteria 1155
50 Ga0068867_100024164 3300005459 Bacteria 4355
51 Ga0068867_100170741 3300005459 Bacteria 1722
52 Ga0068867_101285601 3300005459 Bacteria 675
53 Ga0070707_101402347 3300005468 Bacteria 665
54 Ga0070698_100149048 3300005471 Bacteria 2288
55 Ga0070698_100210326 3300005471 Bacteria 1880
56 Ga0070684_100000384 3300005535 Bacteria 30726
57 Ga0070684_100273759 3300005535 Bacteria 1546
58 Ga0068853_100537883 3300005539 Bacteria 1106
59 Ga0070672_100495642 3300005543 Unclassified 1056
60 Ga0070686_100001857 3300005544 Bacteria 11778
61 Ga0070695_100007402 3300005545 Bacteria 6512
62 Ga0070695_100567610 3300005545 Bacteria 887
63 Ga0070665_100183153 3300005548 Bacteria 2095
64 Ga0070665_100388118 3300005548 Bacteria 1404
65 Ga0070704_100160057 3300005549 Bacteria 1780
66 Ga0070704_100339352 3300005549 Bacteria 1265
67 Ga0068855_100264049 3300005563 Bacteria 1917
68 Ga0070664_100000442 3300005564 Bacteria 31212
69 Ga0070664_100419190 3300005564 Bacteria 1226
70 Ga0068857_100022947 3300005577 Bacteria 5490
71 Ga0068854_100010165 3300005578 Bacteria 6097
72 Ga0070702_100028656 3300005615 Bacteria 3019
73 Ga0068859_100047722 3300005617 Bacteria 4303
74 Ga0068859_100478212 3300005617 Bacteria 1341
75 Ga0068859_101577788 3300005617 Bacteria 725
76 Ga0068864_100596605 3300005618 Bacteria 1071
77 Ga0068864_101432021 3300005618 Bacteria 693
78 Ga0068866_10010088 3300005718 Bacteria 4039
79 Ga0068861_100001397 3300005719 Bacteria 15173
80 Ga0068861_100271056 3300005719 Bacteria 1457
81 Ga0068861_100451583 3300005719 Bacteria 1152
82 Ga0068861_100499179 3300005719 Bacteria 1100
83 Ga0068861_100581006 3300005719 Bacteria 1025
84 Ga0068861_100748458 3300005719 Bacteria 913
85 Ga0068851_10276489 3300005834 Bacteria 959
86 Ga0068858_101058596 3300005842 Bacteria 796
87 Ga0068860_100012227 3300005843 Bacteria 8458
88 Ga0068860_100176456 3300005843 Bacteria 2065
89 Ga0068860_100324627 3300005843 Bacteria 1511
90 Ga0068862_100025130 3300005844 Bacteria 5000
91 Ga0068862_100043714 3300005844 Bacteria 3819
92 Ga0068862_100348449 3300005844 Bacteria 1373
93 Ga0068862_100798380 3300005844 Bacteria 921
94 Ga0075428_100016132 3300006844 Bacteria 8257
95 Ga0075428_100022183 3300006844 Bacteria 7030
96 Ga0075428_101065670 3300006844 Bacteria 854
97 Ga0075430_100004147 3300006846 Bacteria 12229
98 Ga0075430_100049134 3300006846 Bacteria 3561
99 Ga0075431_100030516 3300006847 Bacteria 5553
100 Ga0075431_100054613 3300006847 Bacteria 4119
101 Ga0075433_10039685 3300006852 Bacteria 4072
102 Ga0075433_10190940 3300006852 Unclassified 1822
103 Ga0075433_10913507 3300006852 Bacteria 766
104 Ga0075434_101154432 3300006871 Bacteria 787
105 Ga0075429_100022466 3300006880 Bacteria 5470
106 Ga0075429_100026882 3300006880 Bacteria 4996
107 Ga0075429_100502948 3300006880 Bacteria 1062
108 Ga0075429_100761136 3300006880 Bacteria 848
109 Ga0068865_100084700 3300006881 Bacteria 2285
110 Ga0068865_100254617 3300006881 Bacteria 1387
111 Ga0068865_100309660 3300006881 Bacteria 1267
112 Ga0075436_100111220 3300006914 Bacteria 1912
113 Ga0075436_100289017 3300006914 Bacteria 1173
114 Ga0097620_100047721 3300006931 Bacteria 4303
115 Ga0097620_100478191 3300006931 Bacteria 1341
116 Ga0097620_101577949 3300006931 Bacteria 725
117 Ga0075435_100801274 3300007076 Bacteria 820
118 Ga0111539_10002104 3300009094 Bacteria 26607
119 Ga0111539_10004657 3300009094 Bacteria 17928
120 Ga0111539_10273862 3300009094 Bacteria 1965
121 Ga0111539_11073298 3300009094 Bacteria 936
122 Ga0114129_10008634 3300009147 Bacteria 14527
123 Ga0114129_10011193 3300009147 Bacteria 12788
124 Ga0114129_10018670 3300009147 Bacteria 9874
125 Ga0105243_10011387 3300009148 Bacteria 6731
126 Ga0105243_10029935 3300009148 Bacteria 4189
127 Ga0105243_10307117 3300009148 Bacteria 1440
128 Ga0105243_10964398 3300009148 Bacteria 853
129 Ga0105248_10582558 3300009177 Bacteria 1262
130 Ga0105248_11242569 3300009177 Bacteria 842
131 Ga0105249_10054836 3300009553 Bacteria 3645
132 Ga0105249_10247342 3300009553 Bacteria 1766
133 Ga0105249_10424104 3300009553 Unclassified 1365
134 Ga0105249_10566527 3300009553 Bacteria 1188
135 Ga0105249_10600058 3300009553 Bacteria 1156
136 Ga0105249_10657139 3300009553 Bacteria 1106
137 Ga0105249_11200254 3300009553 Bacteria 830
138 Ga0105239_11577159 3300010375 Unclassified 759
139 Ga0105246_10251852 3300011119 Unclassified 1402
140 Ga0105246_10362933 3300011119 Bacteria 1191
141 Ga0157374_10168457 3300013296 Bacteria 2136
142 Ga0157375_10153538 3300013308 Bacteria 2439
143 Ga0157375_10272953 3300013308 Bacteria 1853
144 Ga0157375_10591973 3300013308 Bacteria 1269
145 Ga0157375_11655436 3300013308 Bacteria 757
146 Ga0163163_10054390 3300014325 Bacteria 3955
147 Ga0157380_10146225 3300014326 Bacteria 2037
148 Ga0157380_10197531 3300014326 Bacteria 1782
149 Ga0157377_10502797 3300014745 Bacteria 847
150 Ga0163161_11043070 3300017792 Bacteria 700
151 Ga0207697_10001012 3300025315 Bacteria 15720
152 Ga0207656_10290463 3300025321 Bacteria 808
153 Ga0207642_10047615 3300025899 Unclassified 1917
154 Ga0207642_10502777 3300025899 Bacteria 742
155 Ga0207688_10026205 3300025901 Bacteria 3204
156 Ga0207688_10077400 3300025901 Bacteria 1895
157 Ga0207680_10406953 3300025903 Bacteria 962
158 Ga0207645_10000802 3300025907 Bacteria 26290
159 Ga0207645_10070943 3300025907 Bacteria 2229
160 Ga0207660_10489169 3300025917 Bacteria 998
161 Ga0207662_10051424 3300025918 Bacteria 2452
162 Ga0207681_10014159 3300025923 Bacteria 4949
163 Ga0207681_10874721 3300025923 Bacteria 752
164 Ga0207650_10435064 3300025925 Bacteria 1090
165 Ga0207659_10391404 3300025926 Bacteria 1161
166 Ga0207659_10678883 3300025926 Bacteria 881
167 Ga0207644_10083791 3300025931 Bacteria 2362
168 Ga0207644_10504016 3300025931 Bacteria 999
169 Ga0207706_10051795 3300025933 Bacteria 3625
170 Ga0207709_10026775 3300025935 Bacteria 3315
171 Ga0207709_10351405 3300025935 Bacteria 1113
172 Ga0207670_10134091 3300025936 Bacteria 1818
173 Ga0207669_10254082 3300025937 Bacteria 1310
174 Ga0207669_10313785 3300025937 Bacteria 1197
175 Ga0207704_10030247 3300025938 Bacteria 3033
176 Ga0207704_10049656 3300025938 Bacteria 2526
177 Ga0207704_10096767 3300025938 Bacteria 1956
178 Ga0207704_10146454 3300025938 Bacteria 1660
179 Ga0207691_10377412 3300025940 Bacteria 1211
180 Ga0207711_10119569 3300025941 Bacteria 2351
181 Ga0207711_10566698 3300025941 Bacteria 1059
182 Ga0207661_10000600 3300025944 Bacteria 22994
183 Ga0207661_10112959 3300025944 Bacteria 2301
184 Ga0207651_10098551 3300025960 Unclassified 2162
185 Ga0207651_10826367 3300025960 Bacteria 822
186 Ga0207712_10128588 3300025961 Bacteria 1927
187 Ga0207712_10501644 3300025961 Bacteria 1037
188 Ga0207712_10664458 3300025961 Bacteria 907
189 Ga0207712_10846068 3300025961 Bacteria 806
190 Ga0207668_10493996 3300025972 Bacteria 1052
191 Ga0207640_10001184 3300025981 Bacteria 14256
192 Ga0207703_10088906 3300026035 Bacteria 2593
193 Ga0207703_10389192 3300026035 Bacteria 1291
194 Ga0207639_10290776 3300026041 Bacteria 1441
195 Ga0207678_10065112 3300026067 Bacteria 3130
196 Ga0207708_10003693 3300026075 Bacteria 11298
197 Ga0207708_10032219 3300026075 Bacteria 3981
198 Ga0207648_10017009 3300026089 Bacteria 6627
199 Ga0207648_10041242 3300026089 Bacteria 4053
200 Ga0207676_10195897 3300026095 Bacteria 1782
201 Ga0207676_10255323 3300026095 Bacteria 1580
202 Ga0207676_10405019 3300026095 Bacteria 1276
203 Ga0207676_11007299 3300026095 Unclassified 821
204 Ga0207674_10020785 3300026116 Bacteria 7084
205 Ga0207675_100004573 3300026118 Bacteria 13347
206 Ga0207675_100036702 3300026118 Bacteria 4571
207 Ga0207675_100174319 3300026118 Bacteria 2057
208 Ga0207675_100681295 3300026118 Bacteria 1036
209 Ga0207675_100990674 3300026118 Bacteria 859
210 Ga0207683_10020548 3300026121 Bacteria 5649
211 Ga0207683_10775829 3300026121 Bacteria 889
212 Ga0207428_10016216 3300027907 Bacteria 6415
213 Ga0207428_10016482 3300027907 Bacteria 6355
214 Ga0207428_10085010 3300027907 Bacteria 2465
215 Ga0268266_10591685 3300028379 Bacteria 1065
216 Ga0268265_10025473 3300028380 Bacteria 4199
217 Ga0268265_10054392 3300028380 Bacteria 3037
218 Ga0268265_10326076 3300028380 Unclassified 1393
219 Ga0268265_11777510 3300028380 Bacteria 623
220 Ga0268264_10007844 3300028381 Bacteria 8886
221 Ga0268264_10051074 3300028381 Bacteria 3445
222 Ga0268264_10913117 3300028381 Bacteria 882
223 Ga0307413_11240635 3300031824 Bacteria 650
224 Ga0373943_0218928 3300035170 Bacteria 1060
225 Ga0451851_0637157 3300041507 Bacteria 1015
226 Ga0451577_0150839 3300042876 Bacteria 2091
227 Ga0451577_0155216 3300042876 Bacteria 2060
228 Ga0453684_0143673 3300044712 Bacteria 2845
229 Ga0451576_0003645 3300045051 Bacteria 20903
230 Ga0451576_0161748 3300045051 Bacteria 2337
231 Ga0495653_0067418 3300046463 Bacteria 2688
232 Ga0495594_0065394 3300046499 Bacteria 2017
233 Ga0495586_0317348 3300046535 Bacteria 893
234 Ga0495622_0264310 3300046557 Bacteria 755
235 Ga0495676_0468067 3300047321 Bacteria 830
236 Ga0496102_0188464 3300048905 Bacteria 1944
237 Ga0496104_0004899 3300048907 Bacteria 11674
238 Ga0496106_0543896 3300048909 Bacteria 932
239 Ga0496107_0095698 3300048910 Bacteria 2173
240 Ga0496108_0001072 3300048911 Bacteria 21340
241 Ga0496109_0001229 3300048912 Bacteria 21283
242 Ga0496109_0299698 3300048912 Unclassified 1516
243 Ga0496109_0739527 3300048912 Bacteria 921
244 Ga0496110_0001039 3300048913 Bacteria 19543
245 Ga0496110_0160461 3300048913 Bacteria 2038
246 Ga0496111_0019595 3300048914 Bacteria 4704
247 Ga0496112_0001561 3300048915 Bacteria 17703
248 Ga0496113_0219161 3300048916 Unclassified 1516
249 Ga0496114_0262640 3300048917 Bacteria 1520
250 Ga0496115_0107220 3300048918 Bacteria 2294
251 Ga0501038_0376237 3300049574 Bacteria 1102
252 Ga0501072_0204987 3300049588 Bacteria 1572
253 Ga0501075_0611674 3300049591 Bacteria 831
254 Ga0501079_0585658 3300049741 Bacteria 878
255 Ga0501080_1410626 3300049742 Bacteria 594
256 Ga0501045_0589222 3300049824 Bacteria 824
257 nmdc:mga05p37_16708_c1 3300050507 Bacteria 8844
258 nmdc:mga05p37_24305_c1 3300050507 Bacteria 6494
259 nmdc:mga05p37_31481_c1 3300050507 Bacteria 6479
260 nmdc:mga09592_17447_c1 3300050508 Bacteria 5881
261 nmdc:mga09592_455854_c1 3300050508 Bacteria 1103
262 nmdc:mga09592_68573_c1 3300050508 Bacteria 3008
263 nmdc:mga0qj67_19822_c1 3300050509 Bacteria 5144
264 nmdc:mga0qj67_96221_c1 3300050509 Bacteria 2384
265 nmdc:mga06r32_150686_c1 3300050510 Bacteria 2304
266 nmdc:mga06r32_46524_c1 3300050510 Bacteria 4140
267 nmdc:mga06r32_869027_c1 3300050510 Bacteria 860
268 nmdc:mga08y16_132148_c1 3300050511 Bacteria 2595
269 nmdc:mga08y16_143245_c1 3300050511 Bacteria 2485
270 nmdc:mga08y16_3591_c1 3300050511 Bacteria 16109
271 nmdc:mga08y16_373097_c1 3300050511 Bacteria 1463
272 nmdc:mga08y16_81224_c1 3300050511 Bacteria 3380
273 nmdc:mga0n895_1031102_c1 3300050512 Bacteria 803
274 nmdc:mga0rr50_111258_c1 3300050513 Bacteria 2167
275 nmdc:mga0rr50_164070_c1 3300050513 Bacteria 1805
276 nmdc:mga08x19_174383_c1 3300050514 Bacteria 1465
277 nmdc:mga08x19_312535_c1 3300050514 Bacteria 1093
278 nmdc:mga0a205_150242_c1 3300050515 Bacteria 2229
279 nmdc:mga0a205_154759_c1 3300050515 Unclassified 2191
280 nmdc:mga0a205_48666_c1 3300050515 Bacteria 4092
281 Ga0501082_0294528 3300060353 Bacteria 1413

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006914 Ga0075436_100289017 Ga0075436_1002890172 162
2 3300005471 Ga0070698_100210326 Ga0070698_1002103262 165
3 3300006852 Ga0075433_10913507 Ga0075433_109135071 165
4 3300050515 nmdc:mga0a205_150242_c1 nmdc:mga0a205_150242_c1_854_1369 165
5 3300048907 Ga0496104_0004899 Ga0496104_0004899_4949_5554 167
6 3300048914 Ga0496111_0019595 Ga0496111_0019595_2121_2726 168
7 3300005549 Ga0070704_100339352 Ga0070704_1003393522 169
8 3300009148 Ga0105243_10307117 Ga0105243_103071172 170
9 3300025926 Ga0207659_10678883 Ga0207659_106788832 170
10 3300025972 Ga0207668_10493996 Ga0207668_104939962 170
11 3300042876 Ga0451577_0150839 Ga0451577_0150839_1218_1751 170
12 3300044712 Ga0453684_0143673 Ga0453684_0143673_926_1459 170
13 3300005545 Ga0070695_100567610 Ga0070695_1005676101 171
14 3300005617 Ga0068859_100478212 Ga0068859_1004782122 171
15 3300005843 Ga0068860_100176456 Ga0068860_1001764561 171
16 3300005843 Ga0068860_100324627 Ga0068860_1003246272 171
17 3300006931 Ga0097620_100478191 Ga0097620_1004781912 171
18 3300025899 Ga0207642_10047615 Ga0207642_100476152 171
19 3300026035 Ga0207703_10088906 Ga0207703_100889062 171
20 3300026035 Ga0207703_10389192 Ga0207703_103891922 171
21 3300026095 Ga0207676_11007299 Ga0207676_110072992 171
22 3300028381 Ga0268264_10051074 Ga0268264_100510742 171
23 3300046535 Ga0495586_0317348 Ga0495586_0317348_297_857 171
24 3300047321 Ga0495676_0468067 Ga0495676_0468067_260_820 171
25 3300005330 Ga0070690_100491485 Ga0070690_1004914852 172
26 3300013308 Ga0157375_10272953 Ga0157375_102729532 172
27 3300014325 Ga0163163_10054390 Ga0163163_100543904 172
28 3300005330 Ga0070690_100024967 Ga0070690_1000249672 173
29 3300005331 Ga0070670_100384336 Ga0070670_1003843362 173
30 3300005335 Ga0070666_10016739 Ga0070666_100167393 173
31 3300005343 Ga0070687_100154589 Ga0070687_1001545892 173
32 3300005353 Ga0070669_101030748 Ga0070669_1010307482 173
33 3300005354 Ga0070675_101485961 Ga0070675_1014859611 173
34 3300005471 Ga0070698_100149048 Ga0070698_1001490482 173
35 3300005539 Ga0068853_100537883 Ga0068853_1005378832 173
36 3300005544 Ga0070686_100001857 Ga0070686_1000018579 173
37 3300005563 Ga0068855_100264049 Ga0068855_1002640492 173
38 3300005578 Ga0068854_100010165 Ga0068854_1000101654 173
39 3300005617 Ga0068859_100047722 Ga0068859_1000477225 173
40 3300005834 Ga0068851_10276489 Ga0068851_102764892 173
41 3300006931 Ga0097620_100047721 Ga0097620_1000477212 173
42 3300009147 Ga0114129_10008634 Ga0114129_1000863413 173
43 3300009177 Ga0105248_10582558 Ga0105248_105825582 173
44 3300010375 Ga0105239_11577159 Ga0105239_115771592 173
45 3300025321 Ga0207656_10290463 Ga0207656_102904632 173
46 3300025903 Ga0207680_10406953 Ga0207680_104069532 173
47 3300025918 Ga0207662_10051424 Ga0207662_100514243 173
48 3300025925 Ga0207650_10435064 Ga0207650_104350642 173
49 3300025941 Ga0207711_10119569 Ga0207711_101195692 173
50 3300025941 Ga0207711_10566698 Ga0207711_105666982 173
51 3300025981 Ga0207640_10001184 Ga0207640_100011847 173
52 3300026041 Ga0207639_10290776 Ga0207639_102907762 173
53 3300026095 Ga0207676_10405019 Ga0207676_104050191 173
54 3300027907 Ga0207428_10085010 Ga0207428_100850102 173
55 3300046463 Ga0495653_0067418 Ga0495653_0067418_1905_2444 173
56 3300048917 Ga0496114_0262640 Ga0496114_0262640_799_1338 173
57 3300049588 Ga0501072_0204987 Ga0501072_0204987_950_1477 173
58 3300050507 nmdc:mga05p37_16708_c1 nmdc:mga05p37_16708_c1_3078_3611 173
59 3300050511 nmdc:mga08y16_81224_c1 nmdc:mga08y16_81224_c1_2078_2605 173
60 3300050514 nmdc:mga08x19_312535_c1 nmdc:mga08x19_312535_c1_270_809 173
61 2162886012 MBSR1b_contig_13990851 MBSR1b_0178.00003100 174
62 3300005290 Ga0065712_10000485 Ga0065712_100004859 174
63 3300005290 Ga0065712_10071100 Ga0065712_100711004 174
64 3300005293 Ga0065715_10099963 Ga0065715_100999633 174
65 3300005293 Ga0065715_10184816 Ga0065715_101848161 174
66 3300005293 Ga0065715_10190788 Ga0065715_101907882 174
67 3300005295 Ga0065707_10109901 Ga0065707_101099013 174
68 3300005328 Ga0070676_10064728 Ga0070676_100647282 174
69 3300005329 Ga0070683_100000857 Ga0070683_10000085723 174
70 3300005329 Ga0070683_100334396 Ga0070683_1003343962 174
71 3300005331 Ga0070670_100041349 Ga0070670_1000413492 174
72 3300005331 Ga0070670_100088314 Ga0070670_1000883141 174
73 3300005331 Ga0070670_100575934 Ga0070670_1005759342 174
74 3300005336 Ga0070680_100068639 Ga0070680_1000686392 174
75 3300005338 Ga0068868_100084575 Ga0068868_1000845751 174
76 3300005341 Ga0070691_10001081 Ga0070691_100010816 174
77 3300005344 Ga0070661_100343902 Ga0070661_1003439022 174
78 3300005347 Ga0070668_100055676 Ga0070668_1000556763 174
79 3300005347 Ga0070668_100304617 Ga0070668_1003046172 174
80 3300005353 Ga0070669_100002972 Ga0070669_1000029725 174
81 3300005353 Ga0070669_100073654 Ga0070669_1000736543 174
82 3300005353 Ga0070669_100125922 Ga0070669_1001259222 174
83 3300005354 Ga0070675_100171758 Ga0070675_1001717582 174
84 3300005354 Ga0070675_100256572 Ga0070675_1002565722 174
85 3300005355 Ga0070671_100026542 Ga0070671_1000265424 174
86 3300005355 Ga0070671_100215002 Ga0070671_1002150022 174
87 3300005356 Ga0070674_100002729 Ga0070674_1000027294 174
88 3300005356 Ga0070674_100181191 Ga0070674_1001811912 174
89 3300005356 Ga0070674_100512441 Ga0070674_1005124412 174
90 3300005364 Ga0070673_100886248 Ga0070673_1008862481 174
91 3300005365 Ga0070688_100114836 Ga0070688_1001148362 174
92 3300005365 Ga0070688_100299297 Ga0070688_1002992972 174
93 3300005366 Ga0070659_100699730 Ga0070659_1006997302 174
94 3300005438 Ga0070701_10001830 Ga0070701_100018304 174
95 3300005438 Ga0070701_10141606 Ga0070701_101416062 174
96 3300005438 Ga0070701_10427646 Ga0070701_104276462 174
97 3300005440 Ga0070705_100001314 Ga0070705_1000013143 174
98 3300005441 Ga0070700_100001496 Ga0070700_1000014962 174
99 3300005441 Ga0070700_100713663 Ga0070700_1007136632 174
100 3300005444 Ga0070694_100003841 Ga0070694_1000038414 174
101 3300005456 Ga0070678_100114481 Ga0070678_1001144812 174
102 3300005456 Ga0070678_100427987 Ga0070678_1004279872 174
103 3300005459 Ga0068867_100024164 Ga0068867_1000241641 174
104 3300005459 Ga0068867_100170741 Ga0068867_1001707412 174
105 3300005459 Ga0068867_101285601 Ga0068867_1012856011 174
106 3300005468 Ga0070707_101402347 Ga0070707_1014023471 174
107 3300005535 Ga0070684_100000384 Ga0070684_10000038410 174
108 3300005535 Ga0070684_100273759 Ga0070684_1002737592 174
109 3300005543 Ga0070672_100495642 Ga0070672_1004956422 174
110 3300005545 Ga0070695_100007402 Ga0070695_1000074024 174
111 3300005548 Ga0070665_100183153 Ga0070665_1001831532 174
112 3300005548 Ga0070665_100388118 Ga0070665_1003881182 174
113 3300005549 Ga0070704_100160057 Ga0070704_1001600571 174
114 3300005564 Ga0070664_100000442 Ga0070664_10000044226 174
115 3300005564 Ga0070664_100419190 Ga0070664_1004191902 174
116 3300005577 Ga0068857_100022947 Ga0068857_1000229473 174
117 3300005615 Ga0070702_100028656 Ga0070702_1000286561 174
118 3300005617 Ga0068859_101577788 Ga0068859_1015777882 174
119 3300005618 Ga0068864_100596605 Ga0068864_1005966052 174
120 3300005618 Ga0068864_101432021 Ga0068864_1014320212 174
121 3300005718 Ga0068866_10010088 Ga0068866_100100884 174
122 3300005719 Ga0068861_100001397 Ga0068861_10000139711 174
123 3300005719 Ga0068861_100271056 Ga0068861_1002710561 174
124 3300005719 Ga0068861_100451583 Ga0068861_1004515832 174
125 3300005719 Ga0068861_100499179 Ga0068861_1004991792 174
126 3300005719 Ga0068861_100581006 Ga0068861_1005810061 174
127 3300005719 Ga0068861_100748458 Ga0068861_1007484582 174
128 3300005842 Ga0068858_101058596 Ga0068858_1010585962 174
129 3300005843 Ga0068860_100012227 Ga0068860_1000122276 174
130 3300005844 Ga0068862_100025130 Ga0068862_1000251303 174
131 3300005844 Ga0068862_100043714 Ga0068862_1000437144 174
132 3300005844 Ga0068862_100348449 Ga0068862_1003484492 174
133 3300005844 Ga0068862_100798380 Ga0068862_1007983802 174
134 3300006844 Ga0075428_100016132 Ga0075428_1000161326 174
135 3300006844 Ga0075428_100022183 Ga0075428_1000221837 174
136 3300006844 Ga0075428_101065670 Ga0075428_1010656701 174
137 3300006846 Ga0075430_100004147 Ga0075430_1000041478 174
138 3300006846 Ga0075430_100049134 Ga0075430_1000491342 174
139 3300006847 Ga0075431_100030516 Ga0075431_1000305163 174
140 3300006847 Ga0075431_100054613 Ga0075431_1000546132 174
141 3300006852 Ga0075433_10039685 Ga0075433_100396852 174
142 3300006852 Ga0075433_10190940 Ga0075433_101909402 174
143 3300006871 Ga0075434_101154432 Ga0075434_1011544322 174
144 3300006880 Ga0075429_100022466 Ga0075429_1000224662 174
145 3300006880 Ga0075429_100026882 Ga0075429_1000268824 174
146 3300006880 Ga0075429_100502948 Ga0075429_1005029481 174
147 3300006880 Ga0075429_100761136 Ga0075429_1007611362 174
148 3300006881 Ga0068865_100084700 Ga0068865_1000847002 174
149 3300006881 Ga0068865_100254617 Ga0068865_1002546171 174
150 3300006881 Ga0068865_100309660 Ga0068865_1003096602 174
151 3300006914 Ga0075436_100111220 Ga0075436_1001112202 174
152 3300006931 Ga0097620_101577949 Ga0097620_1015779492 174
153 3300007076 Ga0075435_100801274 Ga0075435_1008012742 174
154 3300009094 Ga0111539_10002104 Ga0111539_1000210426 174
155 3300009094 Ga0111539_10004657 Ga0111539_1000465716 174
156 3300009094 Ga0111539_10273862 Ga0111539_102738622 174
157 3300009094 Ga0111539_11073298 Ga0111539_110732981 174
158 3300009147 Ga0114129_10011193 Ga0114129_100111939 174
159 3300009147 Ga0114129_10018670 Ga0114129_100186703 174
160 3300009148 Ga0105243_10011387 Ga0105243_100113874 174
161 3300009148 Ga0105243_10029935 Ga0105243_100299353 174
162 3300009148 Ga0105243_10964398 Ga0105243_109643982 174
163 3300009177 Ga0105248_11242569 Ga0105248_112425691 174
164 3300009553 Ga0105249_10054836 Ga0105249_100548363 174
165 3300009553 Ga0105249_10247342 Ga0105249_102473422 174
166 3300009553 Ga0105249_10424104 Ga0105249_104241041 174
167 3300009553 Ga0105249_10566527 Ga0105249_105665272 174
168 3300009553 Ga0105249_10600058 Ga0105249_106000581 174
169 3300009553 Ga0105249_10657139 Ga0105249_106571392 174
170 3300009553 Ga0105249_11200254 Ga0105249_112002541 174
171 3300011119 Ga0105246_10251852 Ga0105246_102518522 174
172 3300011119 Ga0105246_10362933 Ga0105246_103629332 174
173 3300013296 Ga0157374_10168457 Ga0157374_101684573 174
174 3300013308 Ga0157375_10153538 Ga0157375_101535382 174
175 3300013308 Ga0157375_10591973 Ga0157375_105919732 174
176 3300013308 Ga0157375_11655436 Ga0157375_116554362 174
177 3300014326 Ga0157380_10146225 Ga0157380_101462252 174
178 3300014326 Ga0157380_10197531 Ga0157380_101975311 174
179 3300014745 Ga0157377_10502797 Ga0157377_105027971 174
180 3300017792 Ga0163161_11043070 Ga0163161_110430701 174
181 3300025315 Ga0207697_10001012 Ga0207697_100010125 174
182 3300025899 Ga0207642_10502777 Ga0207642_105027772 174
183 3300025901 Ga0207688_10026205 Ga0207688_100262053 174
184 3300025901 Ga0207688_10077400 Ga0207688_100774002 174
185 3300025907 Ga0207645_10000802 Ga0207645_100008029 174
186 3300025907 Ga0207645_10070943 Ga0207645_100709432 174
187 3300025917 Ga0207660_10489169 Ga0207660_104891692 174
188 3300025923 Ga0207681_10014159 Ga0207681_100141594 174
189 3300025923 Ga0207681_10874721 Ga0207681_108747212 174
190 3300025926 Ga0207659_10391404 Ga0207659_103914042 174
191 3300025931 Ga0207644_10083791 Ga0207644_100837912 174
192 3300025931 Ga0207644_10504016 Ga0207644_105040162 174
193 3300025933 Ga0207706_10051795 Ga0207706_100517952 174
194 3300025935 Ga0207709_10026775 Ga0207709_100267754 174
195 3300025935 Ga0207709_10351405 Ga0207709_103514051 174
196 3300025936 Ga0207670_10134091 Ga0207670_101340912 174
197 3300025937 Ga0207669_10254082 Ga0207669_102540822 174
198 3300025937 Ga0207669_10313785 Ga0207669_103137852 174
199 3300025938 Ga0207704_10030247 Ga0207704_100302472 174
200 3300025938 Ga0207704_10049656 Ga0207704_100496563 174
201 3300025938 Ga0207704_10096767 Ga0207704_100967672 174
202 3300025938 Ga0207704_10146454 Ga0207704_101464542 174
203 3300025940 Ga0207691_10377412 Ga0207691_103774122 174
204 3300025944 Ga0207661_10000600 Ga0207661_100006008 174
205 3300025944 Ga0207661_10112959 Ga0207661_101129592 174
206 3300025960 Ga0207651_10098551 Ga0207651_100985512 174
207 3300025960 Ga0207651_10826367 Ga0207651_108263672 174
208 3300025961 Ga0207712_10128588 Ga0207712_101285881 174
209 3300025961 Ga0207712_10501644 Ga0207712_105016442 174
210 3300025961 Ga0207712_10664458 Ga0207712_106644582 174
211 3300025961 Ga0207712_10846068 Ga0207712_108460682 174
212 3300026067 Ga0207678_10065112 Ga0207678_100651124 174
213 3300026075 Ga0207708_10003693 Ga0207708_1000369311 174
214 3300026075 Ga0207708_10032219 Ga0207708_100322192 174
215 3300026089 Ga0207648_10017009 Ga0207648_100170094 174
216 3300026089 Ga0207648_10041242 Ga0207648_100412424 174
217 3300026095 Ga0207676_10195897 Ga0207676_101958972 174
218 3300026095 Ga0207676_10255323 Ga0207676_102553232 174
219 3300026116 Ga0207674_10020785 Ga0207674_100207856 174
220 3300026118 Ga0207675_100004573 Ga0207675_10000457310 174
221 3300026118 Ga0207675_100036702 Ga0207675_1000367023 174
222 3300026118 Ga0207675_100174319 Ga0207675_1001743192 174
223 3300026118 Ga0207675_100681295 Ga0207675_1006812952 174
224 3300026118 Ga0207675_100990674 Ga0207675_1009906741 174
225 3300026121 Ga0207683_10020548 Ga0207683_100205486 174
226 3300026121 Ga0207683_10775829 Ga0207683_107758291 174
227 3300027907 Ga0207428_10016216 Ga0207428_100162164 174
228 3300027907 Ga0207428_10016482 Ga0207428_100164824 174
229 3300028379 Ga0268266_10591685 Ga0268266_105916852 174
230 3300028380 Ga0268265_10025473 Ga0268265_100254733 174
231 3300028380 Ga0268265_10054392 Ga0268265_100543923 174
232 3300028380 Ga0268265_10326076 Ga0268265_103260762 174
233 3300028380 Ga0268265_11777510 Ga0268265_117775101 174
234 3300028381 Ga0268264_10007844 Ga0268264_100078444 174
235 3300028381 Ga0268264_10913117 Ga0268264_109131172 174
236 3300031824 Ga0307413_11240635 Ga0307413_112406351 174
237 3300035170 Ga0373943_0218928 Ga0373943_0218928_442_969 174
238 3300041507 Ga0451851_0637157 Ga0451851_0637157_198_758 174
239 3300042876 Ga0451577_0155216 Ga0451577_0155216_78_611 174
240 3300045051 Ga0451576_0003645 Ga0451576_0003645_6223_6756 174
241 3300045051 Ga0451576_0161748 Ga0451576_0161748_281_823 174
242 3300046499 Ga0495594_0065394 Ga0495594_0065394_824_1351 174
243 3300046557 Ga0495622_0264310 Ga0495622_0264310_124_651 174
244 3300048905 Ga0496102_0188464 Ga0496102_0188464_707_1234 174
245 3300048909 Ga0496106_0543896 Ga0496106_0543896_119_646 174
246 3300048910 Ga0496107_0095698 Ga0496107_0095698_906_1433 174
247 3300048911 Ga0496108_0001072 Ga0496108_0001072_2289_2873 174
248 3300048912 Ga0496109_0001229 Ga0496109_0001229_10328_10912 174
249 3300048912 Ga0496109_0299698 Ga0496109_0299698_537_1079 174
250 3300048912 Ga0496109_0739527 Ga0496109_0739527_65_589 174
251 3300048913 Ga0496110_0001039 Ga0496110_0001039_8667_9272 174
252 3300048913 Ga0496110_0160461 Ga0496110_0160461_482_1006 174
253 3300048915 Ga0496112_0001561 Ga0496112_0001561_8805_9389 174
254 3300048916 Ga0496113_0219161 Ga0496113_0219161_289_873 174
255 3300048918 Ga0496115_0107220 Ga0496115_0107220_190_744 174
256 3300049574 Ga0501038_0376237 Ga0501038_0376237_262_798 174
257 3300049591 Ga0501075_0611674 Ga0501075_0611674_37_570 174
258 3300049741 Ga0501079_0585658 Ga0501079_0585658_284_820 174
259 3300049742 Ga0501080_1410626 Ga0501080_1410626_23_556 174
260 3300049824 Ga0501045_0589222 Ga0501045_0589222_71_607 174
261 3300050507 nmdc:mga05p37_24305_c1 nmdc:mga05p37_24305_c1_2824_3351 174
262 3300050507 nmdc:mga05p37_31481_c1 nmdc:mga05p37_31481_c1_416_958 174
263 3300050508 nmdc:mga09592_17447_c1 nmdc:mga09592_17447_c1_866_1393 174
264 3300050508 nmdc:mga09592_455854_c1 nmdc:mga09592_455854_c1_472_999 174
265 3300050508 nmdc:mga09592_68573_c1 nmdc:mga09592_68573_c1_2212_2754 174
266 3300050509 nmdc:mga0qj67_19822_c1 nmdc:mga0qj67_19822_c1_3889_4431 174
267 3300050509 nmdc:mga0qj67_96221_c1 nmdc:mga0qj67_96221_c1_1830_2372 174
268 3300050510 nmdc:mga06r32_150686_c1 nmdc:mga06r32_150686_c1_81_608 174
269 3300050510 nmdc:mga06r32_46524_c1 nmdc:mga06r32_46524_c1_912_1445 174
270 3300050510 nmdc:mga06r32_869027_c1 nmdc:mga06r32_869027_c1_178_720 174
271 3300050511 nmdc:mga08y16_132148_c1 nmdc:mga08y16_132148_c1_949_1476 174
272 3300050511 nmdc:mga08y16_143245_c1 nmdc:mga08y16_143245_c1_480_1007 174
273 3300050511 nmdc:mga08y16_3591_c1 nmdc:mga08y16_3591_c1_2971_3513 174
274 3300050511 nmdc:mga08y16_373097_c1 nmdc:mga08y16_373097_c1_894_1436 174
275 3300050512 nmdc:mga0n895_1031102_c1 nmdc:mga0n895_1031102_c1_146_673 174
276 3300050513 nmdc:mga0rr50_111258_c1 nmdc:mga0rr50_111258_c1_1613_2140 174
277 3300050513 nmdc:mga0rr50_164070_c1 nmdc:mga0rr50_164070_c1_1217_1744 174
278 3300050514 nmdc:mga08x19_174383_c1 nmdc:mga08x19_174383_c1_339_866 174
279 3300050515 nmdc:mga0a205_154759_c1 nmdc:mga0a205_154759_c1_1231_1758 174
280 3300050515 nmdc:mga0a205_48666_c1 nmdc:mga0a205_48666_c1_1804_2331 174
281 3300060353 Ga0501082_0294528 Ga0501082_0294528_549_1082 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08282

Hydrolase_3

haloacid dehalogenase-like hydrolase

76

153

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ij5-assembly1.cif.gz_A 1.95 angstrom resolution crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from yersinia pestis 0.986 3 165
3hyc-assembly3.cif.gz_E crystal structure of e. coli phosphatase yrbi, with mg, tetragonal form 0.9806 3 166
4umf-assembly1.cif.gz_C crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from moraxella catarrhalis in complex with magnesium ion, phosphate ion and kdo molecule 0.9767 3 171
3nrj-assembly3.cif.gz_I crystal structure of probable yrbi family phosphatase from pseudomonas syringae pv.phaseolica 1448a complexed with magnesium 0.9747 3 171
3n07-assembly1.cif.gz_A-1 structure of putative 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from vibrio cholerae 0.9725 3 163
ID Description Score Start End Superfamily
3ij5D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9816 3 163 3.40.50.1000
4um7A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9746 3 171 3.40.50.1000
4navA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9674 3 172 3.40.50.1000
1j8dB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9588 5 162 3.40.50.1000
3mmzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9584 7 158 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A7W0FM05-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) (KDO 8-P phosphatase) 0.9932 3 174 GO:0008781
GO:0009103
GO:0016788
GO:0046872
AF-A0A2E4WAY8-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) (KDO 8-P phosphatase) 0.9927 3 164 GO:0008781
GO:0009103
GO:0016788
GO:0046872
AF-A0A7C7L7L6-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) (KDO 8-P phosphatase) 0.9918 3 168 GO:0008781
GO:0009103
GO:0016788
AF-A0A317HV95-F1-model_v4 Phenylphosphate carboxylase subunit delta 0.9914 4 171 GO:0008781
GO:0009103
GO:0016788
GO:0046872
AF-A0A7V9AW43-F1-model_v4 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) (KDO 8-P phosphatase) 0.9909 2 172 GO:0008781
GO:0009103
GO:0016788
GO:0046872

Feature Viewer

pLDDT pTM Quality
95.87 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map