F384491
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 281 | 149 | 281 | 178 |
Family's Representative Sequence
| Representative Sequence | 3300045051|Ga0451576_0003645|Ga0451576_0003645_6223_6756 |
| Length | 177 |
| Sequence | MELRERFASVSILFLDVDGVLTDGRVTLDGKGGETKDFDVTDGLGLRLLQDSGVTVALITGRVSEVVAQRAKELRIAELHQGVRDKVPVFRKILLEKGLAPKNAAYVGDDLLDLPVLTRVGLAVTVPSAPEEVKSSVHYVTAKNGGRGAVREVCEEILKAKGQWDSIVKGFLGAEEP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 55 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 56 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 108 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 112 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 113 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 114 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 115 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 116 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 117 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 123 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 124 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 125 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 126 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 127 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 128 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 129 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 130 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 131 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 132 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 133 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 134 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 141 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.34 |
| Rhizosphere | 94.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_13990851 | 2162886012 | Bacteria | 894 |
| 2 | Ga0065712_10000485 | 3300005290 | Bacteria | 12704 |
| 3 | Ga0065712_10071100 | 3300005290 | Bacteria | 5486 |
| 4 | Ga0065715_10099963 | 3300005293 | Bacteria | 3352 |
| 5 | Ga0065715_10184816 | 3300005293 | Bacteria | 1452 |
| 6 | Ga0065715_10190788 | 3300005293 | Bacteria | 1416 |
| 7 | Ga0065707_10109901 | 3300005295 | Bacteria | 2452 |
| 8 | Ga0070676_10064728 | 3300005328 | Bacteria | 2181 |
| 9 | Ga0070683_100000857 | 3300005329 | Bacteria | 22475 |
| 10 | Ga0070683_100334396 | 3300005329 | Bacteria | 1442 |
| 11 | Ga0070690_100024967 | 3300005330 | Bacteria | 3679 |
| 12 | Ga0070690_100491485 | 3300005330 | Bacteria | 917 |
| 13 | Ga0070670_100041349 | 3300005331 | Bacteria | 3962 |
| 14 | Ga0070670_100088314 | 3300005331 | Bacteria | 2665 |
| 15 | Ga0070670_100384336 | 3300005331 | Bacteria | 1237 |
| 16 | Ga0070670_100575934 | 3300005331 | Bacteria | 1006 |
| 17 | Ga0070666_10016739 | 3300005335 | Bacteria | 4694 |
| 18 | Ga0070680_100068639 | 3300005336 | Bacteria | 2910 |
| 19 | Ga0068868_100084575 | 3300005338 | Bacteria | 2548 |
| 20 | Ga0070691_10001081 | 3300005341 | Bacteria | 11289 |
| 21 | Ga0070687_100154589 | 3300005343 | Bacteria | 1350 |
| 22 | Ga0070661_100343902 | 3300005344 | Bacteria | 1169 |
| 23 | Ga0070668_100055676 | 3300005347 | Bacteria | 3053 |
| 24 | Ga0070668_100304617 | 3300005347 | Bacteria | 1337 |
| 25 | Ga0070669_100002972 | 3300005353 | Bacteria | 12219 |
| 26 | Ga0070669_100073654 | 3300005353 | Bacteria | 2530 |
| 27 | Ga0070669_100125922 | 3300005353 | Bacteria | 1960 |
| 28 | Ga0070669_101030748 | 3300005353 | Bacteria | 707 |
| 29 | Ga0070675_100171758 | 3300005354 | Bacteria | 1870 |
| 30 | Ga0070675_100256572 | 3300005354 | Bacteria | 1531 |
| 31 | Ga0070675_101485961 | 3300005354 | Bacteria | 625 |
| 32 | Ga0070671_100026542 | 3300005355 | Bacteria | 4761 |
| 33 | Ga0070671_100215002 | 3300005355 | Bacteria | 1631 |
| 34 | Ga0070674_100002729 | 3300005356 | Bacteria | 9764 |
| 35 | Ga0070674_100181191 | 3300005356 | Bacteria | 1614 |
| 36 | Ga0070674_100512441 | 3300005356 | Bacteria | 1001 |
| 37 | Ga0070673_100886248 | 3300005364 | Bacteria | 827 |
| 38 | Ga0070688_100114836 | 3300005365 | Bacteria | 1796 |
| 39 | Ga0070688_100299297 | 3300005365 | Bacteria | 1162 |
| 40 | Ga0070659_100699730 | 3300005366 | Bacteria | 876 |
| 41 | Ga0070701_10001830 | 3300005438 | Bacteria | 8046 |
| 42 | Ga0070701_10141606 | 3300005438 | Bacteria | 1376 |
| 43 | Ga0070701_10427646 | 3300005438 | Bacteria | 845 |
| 44 | Ga0070705_100001314 | 3300005440 | Bacteria | 13321 |
| 45 | Ga0070700_100001496 | 3300005441 | Bacteria | 11632 |
| 46 | Ga0070700_100713663 | 3300005441 | Bacteria | 799 |
| 47 | Ga0070694_100003841 | 3300005444 | Bacteria | 8975 |
| 48 | Ga0070678_100114481 | 3300005456 | Bacteria | 2116 |
| 49 | Ga0070678_100427987 | 3300005456 | Bacteria | 1155 |
| 50 | Ga0068867_100024164 | 3300005459 | Bacteria | 4355 |
| 51 | Ga0068867_100170741 | 3300005459 | Bacteria | 1722 |
| 52 | Ga0068867_101285601 | 3300005459 | Bacteria | 675 |
| 53 | Ga0070707_101402347 | 3300005468 | Bacteria | 665 |
| 54 | Ga0070698_100149048 | 3300005471 | Bacteria | 2288 |
| 55 | Ga0070698_100210326 | 3300005471 | Bacteria | 1880 |
| 56 | Ga0070684_100000384 | 3300005535 | Bacteria | 30726 |
| 57 | Ga0070684_100273759 | 3300005535 | Bacteria | 1546 |
| 58 | Ga0068853_100537883 | 3300005539 | Bacteria | 1106 |
| 59 | Ga0070672_100495642 | 3300005543 | Unclassified | 1056 |
| 60 | Ga0070686_100001857 | 3300005544 | Bacteria | 11778 |
| 61 | Ga0070695_100007402 | 3300005545 | Bacteria | 6512 |
| 62 | Ga0070695_100567610 | 3300005545 | Bacteria | 887 |
| 63 | Ga0070665_100183153 | 3300005548 | Bacteria | 2095 |
| 64 | Ga0070665_100388118 | 3300005548 | Bacteria | 1404 |
| 65 | Ga0070704_100160057 | 3300005549 | Bacteria | 1780 |
| 66 | Ga0070704_100339352 | 3300005549 | Bacteria | 1265 |
| 67 | Ga0068855_100264049 | 3300005563 | Bacteria | 1917 |
| 68 | Ga0070664_100000442 | 3300005564 | Bacteria | 31212 |
| 69 | Ga0070664_100419190 | 3300005564 | Bacteria | 1226 |
| 70 | Ga0068857_100022947 | 3300005577 | Bacteria | 5490 |
| 71 | Ga0068854_100010165 | 3300005578 | Bacteria | 6097 |
| 72 | Ga0070702_100028656 | 3300005615 | Bacteria | 3019 |
| 73 | Ga0068859_100047722 | 3300005617 | Bacteria | 4303 |
| 74 | Ga0068859_100478212 | 3300005617 | Bacteria | 1341 |
| 75 | Ga0068859_101577788 | 3300005617 | Bacteria | 725 |
| 76 | Ga0068864_100596605 | 3300005618 | Bacteria | 1071 |
| 77 | Ga0068864_101432021 | 3300005618 | Bacteria | 693 |
| 78 | Ga0068866_10010088 | 3300005718 | Bacteria | 4039 |
| 79 | Ga0068861_100001397 | 3300005719 | Bacteria | 15173 |
| 80 | Ga0068861_100271056 | 3300005719 | Bacteria | 1457 |
| 81 | Ga0068861_100451583 | 3300005719 | Bacteria | 1152 |
| 82 | Ga0068861_100499179 | 3300005719 | Bacteria | 1100 |
| 83 | Ga0068861_100581006 | 3300005719 | Bacteria | 1025 |
| 84 | Ga0068861_100748458 | 3300005719 | Bacteria | 913 |
| 85 | Ga0068851_10276489 | 3300005834 | Bacteria | 959 |
| 86 | Ga0068858_101058596 | 3300005842 | Bacteria | 796 |
| 87 | Ga0068860_100012227 | 3300005843 | Bacteria | 8458 |
| 88 | Ga0068860_100176456 | 3300005843 | Bacteria | 2065 |
| 89 | Ga0068860_100324627 | 3300005843 | Bacteria | 1511 |
| 90 | Ga0068862_100025130 | 3300005844 | Bacteria | 5000 |
| 91 | Ga0068862_100043714 | 3300005844 | Bacteria | 3819 |
| 92 | Ga0068862_100348449 | 3300005844 | Bacteria | 1373 |
| 93 | Ga0068862_100798380 | 3300005844 | Bacteria | 921 |
| 94 | Ga0075428_100016132 | 3300006844 | Bacteria | 8257 |
| 95 | Ga0075428_100022183 | 3300006844 | Bacteria | 7030 |
| 96 | Ga0075428_101065670 | 3300006844 | Bacteria | 854 |
| 97 | Ga0075430_100004147 | 3300006846 | Bacteria | 12229 |
| 98 | Ga0075430_100049134 | 3300006846 | Bacteria | 3561 |
| 99 | Ga0075431_100030516 | 3300006847 | Bacteria | 5553 |
| 100 | Ga0075431_100054613 | 3300006847 | Bacteria | 4119 |
| 101 | Ga0075433_10039685 | 3300006852 | Bacteria | 4072 |
| 102 | Ga0075433_10190940 | 3300006852 | Unclassified | 1822 |
| 103 | Ga0075433_10913507 | 3300006852 | Bacteria | 766 |
| 104 | Ga0075434_101154432 | 3300006871 | Bacteria | 787 |
| 105 | Ga0075429_100022466 | 3300006880 | Bacteria | 5470 |
| 106 | Ga0075429_100026882 | 3300006880 | Bacteria | 4996 |
| 107 | Ga0075429_100502948 | 3300006880 | Bacteria | 1062 |
| 108 | Ga0075429_100761136 | 3300006880 | Bacteria | 848 |
| 109 | Ga0068865_100084700 | 3300006881 | Bacteria | 2285 |
| 110 | Ga0068865_100254617 | 3300006881 | Bacteria | 1387 |
| 111 | Ga0068865_100309660 | 3300006881 | Bacteria | 1267 |
| 112 | Ga0075436_100111220 | 3300006914 | Bacteria | 1912 |
| 113 | Ga0075436_100289017 | 3300006914 | Bacteria | 1173 |
| 114 | Ga0097620_100047721 | 3300006931 | Bacteria | 4303 |
| 115 | Ga0097620_100478191 | 3300006931 | Bacteria | 1341 |
| 116 | Ga0097620_101577949 | 3300006931 | Bacteria | 725 |
| 117 | Ga0075435_100801274 | 3300007076 | Bacteria | 820 |
| 118 | Ga0111539_10002104 | 3300009094 | Bacteria | 26607 |
| 119 | Ga0111539_10004657 | 3300009094 | Bacteria | 17928 |
| 120 | Ga0111539_10273862 | 3300009094 | Bacteria | 1965 |
| 121 | Ga0111539_11073298 | 3300009094 | Bacteria | 936 |
| 122 | Ga0114129_10008634 | 3300009147 | Bacteria | 14527 |
| 123 | Ga0114129_10011193 | 3300009147 | Bacteria | 12788 |
| 124 | Ga0114129_10018670 | 3300009147 | Bacteria | 9874 |
| 125 | Ga0105243_10011387 | 3300009148 | Bacteria | 6731 |
| 126 | Ga0105243_10029935 | 3300009148 | Bacteria | 4189 |
| 127 | Ga0105243_10307117 | 3300009148 | Bacteria | 1440 |
| 128 | Ga0105243_10964398 | 3300009148 | Bacteria | 853 |
| 129 | Ga0105248_10582558 | 3300009177 | Bacteria | 1262 |
| 130 | Ga0105248_11242569 | 3300009177 | Bacteria | 842 |
| 131 | Ga0105249_10054836 | 3300009553 | Bacteria | 3645 |
| 132 | Ga0105249_10247342 | 3300009553 | Bacteria | 1766 |
| 133 | Ga0105249_10424104 | 3300009553 | Unclassified | 1365 |
| 134 | Ga0105249_10566527 | 3300009553 | Bacteria | 1188 |
| 135 | Ga0105249_10600058 | 3300009553 | Bacteria | 1156 |
| 136 | Ga0105249_10657139 | 3300009553 | Bacteria | 1106 |
| 137 | Ga0105249_11200254 | 3300009553 | Bacteria | 830 |
| 138 | Ga0105239_11577159 | 3300010375 | Unclassified | 759 |
| 139 | Ga0105246_10251852 | 3300011119 | Unclassified | 1402 |
| 140 | Ga0105246_10362933 | 3300011119 | Bacteria | 1191 |
| 141 | Ga0157374_10168457 | 3300013296 | Bacteria | 2136 |
| 142 | Ga0157375_10153538 | 3300013308 | Bacteria | 2439 |
| 143 | Ga0157375_10272953 | 3300013308 | Bacteria | 1853 |
| 144 | Ga0157375_10591973 | 3300013308 | Bacteria | 1269 |
| 145 | Ga0157375_11655436 | 3300013308 | Bacteria | 757 |
| 146 | Ga0163163_10054390 | 3300014325 | Bacteria | 3955 |
| 147 | Ga0157380_10146225 | 3300014326 | Bacteria | 2037 |
| 148 | Ga0157380_10197531 | 3300014326 | Bacteria | 1782 |
| 149 | Ga0157377_10502797 | 3300014745 | Bacteria | 847 |
| 150 | Ga0163161_11043070 | 3300017792 | Bacteria | 700 |
| 151 | Ga0207697_10001012 | 3300025315 | Bacteria | 15720 |
| 152 | Ga0207656_10290463 | 3300025321 | Bacteria | 808 |
| 153 | Ga0207642_10047615 | 3300025899 | Unclassified | 1917 |
| 154 | Ga0207642_10502777 | 3300025899 | Bacteria | 742 |
| 155 | Ga0207688_10026205 | 3300025901 | Bacteria | 3204 |
| 156 | Ga0207688_10077400 | 3300025901 | Bacteria | 1895 |
| 157 | Ga0207680_10406953 | 3300025903 | Bacteria | 962 |
| 158 | Ga0207645_10000802 | 3300025907 | Bacteria | 26290 |
| 159 | Ga0207645_10070943 | 3300025907 | Bacteria | 2229 |
| 160 | Ga0207660_10489169 | 3300025917 | Bacteria | 998 |
| 161 | Ga0207662_10051424 | 3300025918 | Bacteria | 2452 |
| 162 | Ga0207681_10014159 | 3300025923 | Bacteria | 4949 |
| 163 | Ga0207681_10874721 | 3300025923 | Bacteria | 752 |
| 164 | Ga0207650_10435064 | 3300025925 | Bacteria | 1090 |
| 165 | Ga0207659_10391404 | 3300025926 | Bacteria | 1161 |
| 166 | Ga0207659_10678883 | 3300025926 | Bacteria | 881 |
| 167 | Ga0207644_10083791 | 3300025931 | Bacteria | 2362 |
| 168 | Ga0207644_10504016 | 3300025931 | Bacteria | 999 |
| 169 | Ga0207706_10051795 | 3300025933 | Bacteria | 3625 |
| 170 | Ga0207709_10026775 | 3300025935 | Bacteria | 3315 |
| 171 | Ga0207709_10351405 | 3300025935 | Bacteria | 1113 |
| 172 | Ga0207670_10134091 | 3300025936 | Bacteria | 1818 |
| 173 | Ga0207669_10254082 | 3300025937 | Bacteria | 1310 |
| 174 | Ga0207669_10313785 | 3300025937 | Bacteria | 1197 |
| 175 | Ga0207704_10030247 | 3300025938 | Bacteria | 3033 |
| 176 | Ga0207704_10049656 | 3300025938 | Bacteria | 2526 |
| 177 | Ga0207704_10096767 | 3300025938 | Bacteria | 1956 |
| 178 | Ga0207704_10146454 | 3300025938 | Bacteria | 1660 |
| 179 | Ga0207691_10377412 | 3300025940 | Bacteria | 1211 |
| 180 | Ga0207711_10119569 | 3300025941 | Bacteria | 2351 |
| 181 | Ga0207711_10566698 | 3300025941 | Bacteria | 1059 |
| 182 | Ga0207661_10000600 | 3300025944 | Bacteria | 22994 |
| 183 | Ga0207661_10112959 | 3300025944 | Bacteria | 2301 |
| 184 | Ga0207651_10098551 | 3300025960 | Unclassified | 2162 |
| 185 | Ga0207651_10826367 | 3300025960 | Bacteria | 822 |
| 186 | Ga0207712_10128588 | 3300025961 | Bacteria | 1927 |
| 187 | Ga0207712_10501644 | 3300025961 | Bacteria | 1037 |
| 188 | Ga0207712_10664458 | 3300025961 | Bacteria | 907 |
| 189 | Ga0207712_10846068 | 3300025961 | Bacteria | 806 |
| 190 | Ga0207668_10493996 | 3300025972 | Bacteria | 1052 |
| 191 | Ga0207640_10001184 | 3300025981 | Bacteria | 14256 |
| 192 | Ga0207703_10088906 | 3300026035 | Bacteria | 2593 |
| 193 | Ga0207703_10389192 | 3300026035 | Bacteria | 1291 |
| 194 | Ga0207639_10290776 | 3300026041 | Bacteria | 1441 |
| 195 | Ga0207678_10065112 | 3300026067 | Bacteria | 3130 |
| 196 | Ga0207708_10003693 | 3300026075 | Bacteria | 11298 |
| 197 | Ga0207708_10032219 | 3300026075 | Bacteria | 3981 |
| 198 | Ga0207648_10017009 | 3300026089 | Bacteria | 6627 |
| 199 | Ga0207648_10041242 | 3300026089 | Bacteria | 4053 |
| 200 | Ga0207676_10195897 | 3300026095 | Bacteria | 1782 |
| 201 | Ga0207676_10255323 | 3300026095 | Bacteria | 1580 |
| 202 | Ga0207676_10405019 | 3300026095 | Bacteria | 1276 |
| 203 | Ga0207676_11007299 | 3300026095 | Unclassified | 821 |
| 204 | Ga0207674_10020785 | 3300026116 | Bacteria | 7084 |
| 205 | Ga0207675_100004573 | 3300026118 | Bacteria | 13347 |
| 206 | Ga0207675_100036702 | 3300026118 | Bacteria | 4571 |
| 207 | Ga0207675_100174319 | 3300026118 | Bacteria | 2057 |
| 208 | Ga0207675_100681295 | 3300026118 | Bacteria | 1036 |
| 209 | Ga0207675_100990674 | 3300026118 | Bacteria | 859 |
| 210 | Ga0207683_10020548 | 3300026121 | Bacteria | 5649 |
| 211 | Ga0207683_10775829 | 3300026121 | Bacteria | 889 |
| 212 | Ga0207428_10016216 | 3300027907 | Bacteria | 6415 |
| 213 | Ga0207428_10016482 | 3300027907 | Bacteria | 6355 |
| 214 | Ga0207428_10085010 | 3300027907 | Bacteria | 2465 |
| 215 | Ga0268266_10591685 | 3300028379 | Bacteria | 1065 |
| 216 | Ga0268265_10025473 | 3300028380 | Bacteria | 4199 |
| 217 | Ga0268265_10054392 | 3300028380 | Bacteria | 3037 |
| 218 | Ga0268265_10326076 | 3300028380 | Unclassified | 1393 |
| 219 | Ga0268265_11777510 | 3300028380 | Bacteria | 623 |
| 220 | Ga0268264_10007844 | 3300028381 | Bacteria | 8886 |
| 221 | Ga0268264_10051074 | 3300028381 | Bacteria | 3445 |
| 222 | Ga0268264_10913117 | 3300028381 | Bacteria | 882 |
| 223 | Ga0307413_11240635 | 3300031824 | Bacteria | 650 |
| 224 | Ga0373943_0218928 | 3300035170 | Bacteria | 1060 |
| 225 | Ga0451851_0637157 | 3300041507 | Bacteria | 1015 |
| 226 | Ga0451577_0150839 | 3300042876 | Bacteria | 2091 |
| 227 | Ga0451577_0155216 | 3300042876 | Bacteria | 2060 |
| 228 | Ga0453684_0143673 | 3300044712 | Bacteria | 2845 |
| 229 | Ga0451576_0003645 | 3300045051 | Bacteria | 20903 |
| 230 | Ga0451576_0161748 | 3300045051 | Bacteria | 2337 |
| 231 | Ga0495653_0067418 | 3300046463 | Bacteria | 2688 |
| 232 | Ga0495594_0065394 | 3300046499 | Bacteria | 2017 |
| 233 | Ga0495586_0317348 | 3300046535 | Bacteria | 893 |
| 234 | Ga0495622_0264310 | 3300046557 | Bacteria | 755 |
| 235 | Ga0495676_0468067 | 3300047321 | Bacteria | 830 |
| 236 | Ga0496102_0188464 | 3300048905 | Bacteria | 1944 |
| 237 | Ga0496104_0004899 | 3300048907 | Bacteria | 11674 |
| 238 | Ga0496106_0543896 | 3300048909 | Bacteria | 932 |
| 239 | Ga0496107_0095698 | 3300048910 | Bacteria | 2173 |
| 240 | Ga0496108_0001072 | 3300048911 | Bacteria | 21340 |
| 241 | Ga0496109_0001229 | 3300048912 | Bacteria | 21283 |
| 242 | Ga0496109_0299698 | 3300048912 | Unclassified | 1516 |
| 243 | Ga0496109_0739527 | 3300048912 | Bacteria | 921 |
| 244 | Ga0496110_0001039 | 3300048913 | Bacteria | 19543 |
| 245 | Ga0496110_0160461 | 3300048913 | Bacteria | 2038 |
| 246 | Ga0496111_0019595 | 3300048914 | Bacteria | 4704 |
| 247 | Ga0496112_0001561 | 3300048915 | Bacteria | 17703 |
| 248 | Ga0496113_0219161 | 3300048916 | Unclassified | 1516 |
| 249 | Ga0496114_0262640 | 3300048917 | Bacteria | 1520 |
| 250 | Ga0496115_0107220 | 3300048918 | Bacteria | 2294 |
| 251 | Ga0501038_0376237 | 3300049574 | Bacteria | 1102 |
| 252 | Ga0501072_0204987 | 3300049588 | Bacteria | 1572 |
| 253 | Ga0501075_0611674 | 3300049591 | Bacteria | 831 |
| 254 | Ga0501079_0585658 | 3300049741 | Bacteria | 878 |
| 255 | Ga0501080_1410626 | 3300049742 | Bacteria | 594 |
| 256 | Ga0501045_0589222 | 3300049824 | Bacteria | 824 |
| 257 | nmdc:mga05p37_16708_c1 | 3300050507 | Bacteria | 8844 |
| 258 | nmdc:mga05p37_24305_c1 | 3300050507 | Bacteria | 6494 |
| 259 | nmdc:mga05p37_31481_c1 | 3300050507 | Bacteria | 6479 |
| 260 | nmdc:mga09592_17447_c1 | 3300050508 | Bacteria | 5881 |
| 261 | nmdc:mga09592_455854_c1 | 3300050508 | Bacteria | 1103 |
| 262 | nmdc:mga09592_68573_c1 | 3300050508 | Bacteria | 3008 |
| 263 | nmdc:mga0qj67_19822_c1 | 3300050509 | Bacteria | 5144 |
| 264 | nmdc:mga0qj67_96221_c1 | 3300050509 | Bacteria | 2384 |
| 265 | nmdc:mga06r32_150686_c1 | 3300050510 | Bacteria | 2304 |
| 266 | nmdc:mga06r32_46524_c1 | 3300050510 | Bacteria | 4140 |
| 267 | nmdc:mga06r32_869027_c1 | 3300050510 | Bacteria | 860 |
| 268 | nmdc:mga08y16_132148_c1 | 3300050511 | Bacteria | 2595 |
| 269 | nmdc:mga08y16_143245_c1 | 3300050511 | Bacteria | 2485 |
| 270 | nmdc:mga08y16_3591_c1 | 3300050511 | Bacteria | 16109 |
| 271 | nmdc:mga08y16_373097_c1 | 3300050511 | Bacteria | 1463 |
| 272 | nmdc:mga08y16_81224_c1 | 3300050511 | Bacteria | 3380 |
| 273 | nmdc:mga0n895_1031102_c1 | 3300050512 | Bacteria | 803 |
| 274 | nmdc:mga0rr50_111258_c1 | 3300050513 | Bacteria | 2167 |
| 275 | nmdc:mga0rr50_164070_c1 | 3300050513 | Bacteria | 1805 |
| 276 | nmdc:mga08x19_174383_c1 | 3300050514 | Bacteria | 1465 |
| 277 | nmdc:mga08x19_312535_c1 | 3300050514 | Bacteria | 1093 |
| 278 | nmdc:mga0a205_150242_c1 | 3300050515 | Bacteria | 2229 |
| 279 | nmdc:mga0a205_154759_c1 | 3300050515 | Unclassified | 2191 |
| 280 | nmdc:mga0a205_48666_c1 | 3300050515 | Bacteria | 4092 |
| 281 | Ga0501082_0294528 | 3300060353 | Bacteria | 1413 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006914 | Ga0075436_100289017 | Ga0075436_1002890172 | 162 |
| 2 | 3300005471 | Ga0070698_100210326 | Ga0070698_1002103262 | 165 |
| 3 | 3300006852 | Ga0075433_10913507 | Ga0075433_109135071 | 165 |
| 4 | 3300050515 | nmdc:mga0a205_150242_c1 | nmdc:mga0a205_150242_c1_854_1369 | 165 |
| 5 | 3300048907 | Ga0496104_0004899 | Ga0496104_0004899_4949_5554 | 167 |
| 6 | 3300048914 | Ga0496111_0019595 | Ga0496111_0019595_2121_2726 | 168 |
| 7 | 3300005549 | Ga0070704_100339352 | Ga0070704_1003393522 | 169 |
| 8 | 3300009148 | Ga0105243_10307117 | Ga0105243_103071172 | 170 |
| 9 | 3300025926 | Ga0207659_10678883 | Ga0207659_106788832 | 170 |
| 10 | 3300025972 | Ga0207668_10493996 | Ga0207668_104939962 | 170 |
| 11 | 3300042876 | Ga0451577_0150839 | Ga0451577_0150839_1218_1751 | 170 |
| 12 | 3300044712 | Ga0453684_0143673 | Ga0453684_0143673_926_1459 | 170 |
| 13 | 3300005545 | Ga0070695_100567610 | Ga0070695_1005676101 | 171 |
| 14 | 3300005617 | Ga0068859_100478212 | Ga0068859_1004782122 | 171 |
| 15 | 3300005843 | Ga0068860_100176456 | Ga0068860_1001764561 | 171 |
| 16 | 3300005843 | Ga0068860_100324627 | Ga0068860_1003246272 | 171 |
| 17 | 3300006931 | Ga0097620_100478191 | Ga0097620_1004781912 | 171 |
| 18 | 3300025899 | Ga0207642_10047615 | Ga0207642_100476152 | 171 |
| 19 | 3300026035 | Ga0207703_10088906 | Ga0207703_100889062 | 171 |
| 20 | 3300026035 | Ga0207703_10389192 | Ga0207703_103891922 | 171 |
| 21 | 3300026095 | Ga0207676_11007299 | Ga0207676_110072992 | 171 |
| 22 | 3300028381 | Ga0268264_10051074 | Ga0268264_100510742 | 171 |
| 23 | 3300046535 | Ga0495586_0317348 | Ga0495586_0317348_297_857 | 171 |
| 24 | 3300047321 | Ga0495676_0468067 | Ga0495676_0468067_260_820 | 171 |
| 25 | 3300005330 | Ga0070690_100491485 | Ga0070690_1004914852 | 172 |
| 26 | 3300013308 | Ga0157375_10272953 | Ga0157375_102729532 | 172 |
| 27 | 3300014325 | Ga0163163_10054390 | Ga0163163_100543904 | 172 |
| 28 | 3300005330 | Ga0070690_100024967 | Ga0070690_1000249672 | 173 |
| 29 | 3300005331 | Ga0070670_100384336 | Ga0070670_1003843362 | 173 |
| 30 | 3300005335 | Ga0070666_10016739 | Ga0070666_100167393 | 173 |
| 31 | 3300005343 | Ga0070687_100154589 | Ga0070687_1001545892 | 173 |
| 32 | 3300005353 | Ga0070669_101030748 | Ga0070669_1010307482 | 173 |
| 33 | 3300005354 | Ga0070675_101485961 | Ga0070675_1014859611 | 173 |
| 34 | 3300005471 | Ga0070698_100149048 | Ga0070698_1001490482 | 173 |
| 35 | 3300005539 | Ga0068853_100537883 | Ga0068853_1005378832 | 173 |
| 36 | 3300005544 | Ga0070686_100001857 | Ga0070686_1000018579 | 173 |
| 37 | 3300005563 | Ga0068855_100264049 | Ga0068855_1002640492 | 173 |
| 38 | 3300005578 | Ga0068854_100010165 | Ga0068854_1000101654 | 173 |
| 39 | 3300005617 | Ga0068859_100047722 | Ga0068859_1000477225 | 173 |
| 40 | 3300005834 | Ga0068851_10276489 | Ga0068851_102764892 | 173 |
| 41 | 3300006931 | Ga0097620_100047721 | Ga0097620_1000477212 | 173 |
| 42 | 3300009147 | Ga0114129_10008634 | Ga0114129_1000863413 | 173 |
| 43 | 3300009177 | Ga0105248_10582558 | Ga0105248_105825582 | 173 |
| 44 | 3300010375 | Ga0105239_11577159 | Ga0105239_115771592 | 173 |
| 45 | 3300025321 | Ga0207656_10290463 | Ga0207656_102904632 | 173 |
| 46 | 3300025903 | Ga0207680_10406953 | Ga0207680_104069532 | 173 |
| 47 | 3300025918 | Ga0207662_10051424 | Ga0207662_100514243 | 173 |
| 48 | 3300025925 | Ga0207650_10435064 | Ga0207650_104350642 | 173 |
| 49 | 3300025941 | Ga0207711_10119569 | Ga0207711_101195692 | 173 |
| 50 | 3300025941 | Ga0207711_10566698 | Ga0207711_105666982 | 173 |
| 51 | 3300025981 | Ga0207640_10001184 | Ga0207640_100011847 | 173 |
| 52 | 3300026041 | Ga0207639_10290776 | Ga0207639_102907762 | 173 |
| 53 | 3300026095 | Ga0207676_10405019 | Ga0207676_104050191 | 173 |
| 54 | 3300027907 | Ga0207428_10085010 | Ga0207428_100850102 | 173 |
| 55 | 3300046463 | Ga0495653_0067418 | Ga0495653_0067418_1905_2444 | 173 |
| 56 | 3300048917 | Ga0496114_0262640 | Ga0496114_0262640_799_1338 | 173 |
| 57 | 3300049588 | Ga0501072_0204987 | Ga0501072_0204987_950_1477 | 173 |
| 58 | 3300050507 | nmdc:mga05p37_16708_c1 | nmdc:mga05p37_16708_c1_3078_3611 | 173 |
| 59 | 3300050511 | nmdc:mga08y16_81224_c1 | nmdc:mga08y16_81224_c1_2078_2605 | 173 |
| 60 | 3300050514 | nmdc:mga08x19_312535_c1 | nmdc:mga08x19_312535_c1_270_809 | 173 |
| 61 | 2162886012 | MBSR1b_contig_13990851 | MBSR1b_0178.00003100 | 174 |
| 62 | 3300005290 | Ga0065712_10000485 | Ga0065712_100004859 | 174 |
| 63 | 3300005290 | Ga0065712_10071100 | Ga0065712_100711004 | 174 |
| 64 | 3300005293 | Ga0065715_10099963 | Ga0065715_100999633 | 174 |
| 65 | 3300005293 | Ga0065715_10184816 | Ga0065715_101848161 | 174 |
| 66 | 3300005293 | Ga0065715_10190788 | Ga0065715_101907882 | 174 |
| 67 | 3300005295 | Ga0065707_10109901 | Ga0065707_101099013 | 174 |
| 68 | 3300005328 | Ga0070676_10064728 | Ga0070676_100647282 | 174 |
| 69 | 3300005329 | Ga0070683_100000857 | Ga0070683_10000085723 | 174 |
| 70 | 3300005329 | Ga0070683_100334396 | Ga0070683_1003343962 | 174 |
| 71 | 3300005331 | Ga0070670_100041349 | Ga0070670_1000413492 | 174 |
| 72 | 3300005331 | Ga0070670_100088314 | Ga0070670_1000883141 | 174 |
| 73 | 3300005331 | Ga0070670_100575934 | Ga0070670_1005759342 | 174 |
| 74 | 3300005336 | Ga0070680_100068639 | Ga0070680_1000686392 | 174 |
| 75 | 3300005338 | Ga0068868_100084575 | Ga0068868_1000845751 | 174 |
| 76 | 3300005341 | Ga0070691_10001081 | Ga0070691_100010816 | 174 |
| 77 | 3300005344 | Ga0070661_100343902 | Ga0070661_1003439022 | 174 |
| 78 | 3300005347 | Ga0070668_100055676 | Ga0070668_1000556763 | 174 |
| 79 | 3300005347 | Ga0070668_100304617 | Ga0070668_1003046172 | 174 |
| 80 | 3300005353 | Ga0070669_100002972 | Ga0070669_1000029725 | 174 |
| 81 | 3300005353 | Ga0070669_100073654 | Ga0070669_1000736543 | 174 |
| 82 | 3300005353 | Ga0070669_100125922 | Ga0070669_1001259222 | 174 |
| 83 | 3300005354 | Ga0070675_100171758 | Ga0070675_1001717582 | 174 |
| 84 | 3300005354 | Ga0070675_100256572 | Ga0070675_1002565722 | 174 |
| 85 | 3300005355 | Ga0070671_100026542 | Ga0070671_1000265424 | 174 |
| 86 | 3300005355 | Ga0070671_100215002 | Ga0070671_1002150022 | 174 |
| 87 | 3300005356 | Ga0070674_100002729 | Ga0070674_1000027294 | 174 |
| 88 | 3300005356 | Ga0070674_100181191 | Ga0070674_1001811912 | 174 |
| 89 | 3300005356 | Ga0070674_100512441 | Ga0070674_1005124412 | 174 |
| 90 | 3300005364 | Ga0070673_100886248 | Ga0070673_1008862481 | 174 |
| 91 | 3300005365 | Ga0070688_100114836 | Ga0070688_1001148362 | 174 |
| 92 | 3300005365 | Ga0070688_100299297 | Ga0070688_1002992972 | 174 |
| 93 | 3300005366 | Ga0070659_100699730 | Ga0070659_1006997302 | 174 |
| 94 | 3300005438 | Ga0070701_10001830 | Ga0070701_100018304 | 174 |
| 95 | 3300005438 | Ga0070701_10141606 | Ga0070701_101416062 | 174 |
| 96 | 3300005438 | Ga0070701_10427646 | Ga0070701_104276462 | 174 |
| 97 | 3300005440 | Ga0070705_100001314 | Ga0070705_1000013143 | 174 |
| 98 | 3300005441 | Ga0070700_100001496 | Ga0070700_1000014962 | 174 |
| 99 | 3300005441 | Ga0070700_100713663 | Ga0070700_1007136632 | 174 |
| 100 | 3300005444 | Ga0070694_100003841 | Ga0070694_1000038414 | 174 |
| 101 | 3300005456 | Ga0070678_100114481 | Ga0070678_1001144812 | 174 |
| 102 | 3300005456 | Ga0070678_100427987 | Ga0070678_1004279872 | 174 |
| 103 | 3300005459 | Ga0068867_100024164 | Ga0068867_1000241641 | 174 |
| 104 | 3300005459 | Ga0068867_100170741 | Ga0068867_1001707412 | 174 |
| 105 | 3300005459 | Ga0068867_101285601 | Ga0068867_1012856011 | 174 |
| 106 | 3300005468 | Ga0070707_101402347 | Ga0070707_1014023471 | 174 |
| 107 | 3300005535 | Ga0070684_100000384 | Ga0070684_10000038410 | 174 |
| 108 | 3300005535 | Ga0070684_100273759 | Ga0070684_1002737592 | 174 |
| 109 | 3300005543 | Ga0070672_100495642 | Ga0070672_1004956422 | 174 |
| 110 | 3300005545 | Ga0070695_100007402 | Ga0070695_1000074024 | 174 |
| 111 | 3300005548 | Ga0070665_100183153 | Ga0070665_1001831532 | 174 |
| 112 | 3300005548 | Ga0070665_100388118 | Ga0070665_1003881182 | 174 |
| 113 | 3300005549 | Ga0070704_100160057 | Ga0070704_1001600571 | 174 |
| 114 | 3300005564 | Ga0070664_100000442 | Ga0070664_10000044226 | 174 |
| 115 | 3300005564 | Ga0070664_100419190 | Ga0070664_1004191902 | 174 |
| 116 | 3300005577 | Ga0068857_100022947 | Ga0068857_1000229473 | 174 |
| 117 | 3300005615 | Ga0070702_100028656 | Ga0070702_1000286561 | 174 |
| 118 | 3300005617 | Ga0068859_101577788 | Ga0068859_1015777882 | 174 |
| 119 | 3300005618 | Ga0068864_100596605 | Ga0068864_1005966052 | 174 |
| 120 | 3300005618 | Ga0068864_101432021 | Ga0068864_1014320212 | 174 |
| 121 | 3300005718 | Ga0068866_10010088 | Ga0068866_100100884 | 174 |
| 122 | 3300005719 | Ga0068861_100001397 | Ga0068861_10000139711 | 174 |
| 123 | 3300005719 | Ga0068861_100271056 | Ga0068861_1002710561 | 174 |
| 124 | 3300005719 | Ga0068861_100451583 | Ga0068861_1004515832 | 174 |
| 125 | 3300005719 | Ga0068861_100499179 | Ga0068861_1004991792 | 174 |
| 126 | 3300005719 | Ga0068861_100581006 | Ga0068861_1005810061 | 174 |
| 127 | 3300005719 | Ga0068861_100748458 | Ga0068861_1007484582 | 174 |
| 128 | 3300005842 | Ga0068858_101058596 | Ga0068858_1010585962 | 174 |
| 129 | 3300005843 | Ga0068860_100012227 | Ga0068860_1000122276 | 174 |
| 130 | 3300005844 | Ga0068862_100025130 | Ga0068862_1000251303 | 174 |
| 131 | 3300005844 | Ga0068862_100043714 | Ga0068862_1000437144 | 174 |
| 132 | 3300005844 | Ga0068862_100348449 | Ga0068862_1003484492 | 174 |
| 133 | 3300005844 | Ga0068862_100798380 | Ga0068862_1007983802 | 174 |
| 134 | 3300006844 | Ga0075428_100016132 | Ga0075428_1000161326 | 174 |
| 135 | 3300006844 | Ga0075428_100022183 | Ga0075428_1000221837 | 174 |
| 136 | 3300006844 | Ga0075428_101065670 | Ga0075428_1010656701 | 174 |
| 137 | 3300006846 | Ga0075430_100004147 | Ga0075430_1000041478 | 174 |
| 138 | 3300006846 | Ga0075430_100049134 | Ga0075430_1000491342 | 174 |
| 139 | 3300006847 | Ga0075431_100030516 | Ga0075431_1000305163 | 174 |
| 140 | 3300006847 | Ga0075431_100054613 | Ga0075431_1000546132 | 174 |
| 141 | 3300006852 | Ga0075433_10039685 | Ga0075433_100396852 | 174 |
| 142 | 3300006852 | Ga0075433_10190940 | Ga0075433_101909402 | 174 |
| 143 | 3300006871 | Ga0075434_101154432 | Ga0075434_1011544322 | 174 |
| 144 | 3300006880 | Ga0075429_100022466 | Ga0075429_1000224662 | 174 |
| 145 | 3300006880 | Ga0075429_100026882 | Ga0075429_1000268824 | 174 |
| 146 | 3300006880 | Ga0075429_100502948 | Ga0075429_1005029481 | 174 |
| 147 | 3300006880 | Ga0075429_100761136 | Ga0075429_1007611362 | 174 |
| 148 | 3300006881 | Ga0068865_100084700 | Ga0068865_1000847002 | 174 |
| 149 | 3300006881 | Ga0068865_100254617 | Ga0068865_1002546171 | 174 |
| 150 | 3300006881 | Ga0068865_100309660 | Ga0068865_1003096602 | 174 |
| 151 | 3300006914 | Ga0075436_100111220 | Ga0075436_1001112202 | 174 |
| 152 | 3300006931 | Ga0097620_101577949 | Ga0097620_1015779492 | 174 |
| 153 | 3300007076 | Ga0075435_100801274 | Ga0075435_1008012742 | 174 |
| 154 | 3300009094 | Ga0111539_10002104 | Ga0111539_1000210426 | 174 |
| 155 | 3300009094 | Ga0111539_10004657 | Ga0111539_1000465716 | 174 |
| 156 | 3300009094 | Ga0111539_10273862 | Ga0111539_102738622 | 174 |
| 157 | 3300009094 | Ga0111539_11073298 | Ga0111539_110732981 | 174 |
| 158 | 3300009147 | Ga0114129_10011193 | Ga0114129_100111939 | 174 |
| 159 | 3300009147 | Ga0114129_10018670 | Ga0114129_100186703 | 174 |
| 160 | 3300009148 | Ga0105243_10011387 | Ga0105243_100113874 | 174 |
| 161 | 3300009148 | Ga0105243_10029935 | Ga0105243_100299353 | 174 |
| 162 | 3300009148 | Ga0105243_10964398 | Ga0105243_109643982 | 174 |
| 163 | 3300009177 | Ga0105248_11242569 | Ga0105248_112425691 | 174 |
| 164 | 3300009553 | Ga0105249_10054836 | Ga0105249_100548363 | 174 |
| 165 | 3300009553 | Ga0105249_10247342 | Ga0105249_102473422 | 174 |
| 166 | 3300009553 | Ga0105249_10424104 | Ga0105249_104241041 | 174 |
| 167 | 3300009553 | Ga0105249_10566527 | Ga0105249_105665272 | 174 |
| 168 | 3300009553 | Ga0105249_10600058 | Ga0105249_106000581 | 174 |
| 169 | 3300009553 | Ga0105249_10657139 | Ga0105249_106571392 | 174 |
| 170 | 3300009553 | Ga0105249_11200254 | Ga0105249_112002541 | 174 |
| 171 | 3300011119 | Ga0105246_10251852 | Ga0105246_102518522 | 174 |
| 172 | 3300011119 | Ga0105246_10362933 | Ga0105246_103629332 | 174 |
| 173 | 3300013296 | Ga0157374_10168457 | Ga0157374_101684573 | 174 |
| 174 | 3300013308 | Ga0157375_10153538 | Ga0157375_101535382 | 174 |
| 175 | 3300013308 | Ga0157375_10591973 | Ga0157375_105919732 | 174 |
| 176 | 3300013308 | Ga0157375_11655436 | Ga0157375_116554362 | 174 |
| 177 | 3300014326 | Ga0157380_10146225 | Ga0157380_101462252 | 174 |
| 178 | 3300014326 | Ga0157380_10197531 | Ga0157380_101975311 | 174 |
| 179 | 3300014745 | Ga0157377_10502797 | Ga0157377_105027971 | 174 |
| 180 | 3300017792 | Ga0163161_11043070 | Ga0163161_110430701 | 174 |
| 181 | 3300025315 | Ga0207697_10001012 | Ga0207697_100010125 | 174 |
| 182 | 3300025899 | Ga0207642_10502777 | Ga0207642_105027772 | 174 |
| 183 | 3300025901 | Ga0207688_10026205 | Ga0207688_100262053 | 174 |
| 184 | 3300025901 | Ga0207688_10077400 | Ga0207688_100774002 | 174 |
| 185 | 3300025907 | Ga0207645_10000802 | Ga0207645_100008029 | 174 |
| 186 | 3300025907 | Ga0207645_10070943 | Ga0207645_100709432 | 174 |
| 187 | 3300025917 | Ga0207660_10489169 | Ga0207660_104891692 | 174 |
| 188 | 3300025923 | Ga0207681_10014159 | Ga0207681_100141594 | 174 |
| 189 | 3300025923 | Ga0207681_10874721 | Ga0207681_108747212 | 174 |
| 190 | 3300025926 | Ga0207659_10391404 | Ga0207659_103914042 | 174 |
| 191 | 3300025931 | Ga0207644_10083791 | Ga0207644_100837912 | 174 |
| 192 | 3300025931 | Ga0207644_10504016 | Ga0207644_105040162 | 174 |
| 193 | 3300025933 | Ga0207706_10051795 | Ga0207706_100517952 | 174 |
| 194 | 3300025935 | Ga0207709_10026775 | Ga0207709_100267754 | 174 |
| 195 | 3300025935 | Ga0207709_10351405 | Ga0207709_103514051 | 174 |
| 196 | 3300025936 | Ga0207670_10134091 | Ga0207670_101340912 | 174 |
| 197 | 3300025937 | Ga0207669_10254082 | Ga0207669_102540822 | 174 |
| 198 | 3300025937 | Ga0207669_10313785 | Ga0207669_103137852 | 174 |
| 199 | 3300025938 | Ga0207704_10030247 | Ga0207704_100302472 | 174 |
| 200 | 3300025938 | Ga0207704_10049656 | Ga0207704_100496563 | 174 |
| 201 | 3300025938 | Ga0207704_10096767 | Ga0207704_100967672 | 174 |
| 202 | 3300025938 | Ga0207704_10146454 | Ga0207704_101464542 | 174 |
| 203 | 3300025940 | Ga0207691_10377412 | Ga0207691_103774122 | 174 |
| 204 | 3300025944 | Ga0207661_10000600 | Ga0207661_100006008 | 174 |
| 205 | 3300025944 | Ga0207661_10112959 | Ga0207661_101129592 | 174 |
| 206 | 3300025960 | Ga0207651_10098551 | Ga0207651_100985512 | 174 |
| 207 | 3300025960 | Ga0207651_10826367 | Ga0207651_108263672 | 174 |
| 208 | 3300025961 | Ga0207712_10128588 | Ga0207712_101285881 | 174 |
| 209 | 3300025961 | Ga0207712_10501644 | Ga0207712_105016442 | 174 |
| 210 | 3300025961 | Ga0207712_10664458 | Ga0207712_106644582 | 174 |
| 211 | 3300025961 | Ga0207712_10846068 | Ga0207712_108460682 | 174 |
| 212 | 3300026067 | Ga0207678_10065112 | Ga0207678_100651124 | 174 |
| 213 | 3300026075 | Ga0207708_10003693 | Ga0207708_1000369311 | 174 |
| 214 | 3300026075 | Ga0207708_10032219 | Ga0207708_100322192 | 174 |
| 215 | 3300026089 | Ga0207648_10017009 | Ga0207648_100170094 | 174 |
| 216 | 3300026089 | Ga0207648_10041242 | Ga0207648_100412424 | 174 |
| 217 | 3300026095 | Ga0207676_10195897 | Ga0207676_101958972 | 174 |
| 218 | 3300026095 | Ga0207676_10255323 | Ga0207676_102553232 | 174 |
| 219 | 3300026116 | Ga0207674_10020785 | Ga0207674_100207856 | 174 |
| 220 | 3300026118 | Ga0207675_100004573 | Ga0207675_10000457310 | 174 |
| 221 | 3300026118 | Ga0207675_100036702 | Ga0207675_1000367023 | 174 |
| 222 | 3300026118 | Ga0207675_100174319 | Ga0207675_1001743192 | 174 |
| 223 | 3300026118 | Ga0207675_100681295 | Ga0207675_1006812952 | 174 |
| 224 | 3300026118 | Ga0207675_100990674 | Ga0207675_1009906741 | 174 |
| 225 | 3300026121 | Ga0207683_10020548 | Ga0207683_100205486 | 174 |
| 226 | 3300026121 | Ga0207683_10775829 | Ga0207683_107758291 | 174 |
| 227 | 3300027907 | Ga0207428_10016216 | Ga0207428_100162164 | 174 |
| 228 | 3300027907 | Ga0207428_10016482 | Ga0207428_100164824 | 174 |
| 229 | 3300028379 | Ga0268266_10591685 | Ga0268266_105916852 | 174 |
| 230 | 3300028380 | Ga0268265_10025473 | Ga0268265_100254733 | 174 |
| 231 | 3300028380 | Ga0268265_10054392 | Ga0268265_100543923 | 174 |
| 232 | 3300028380 | Ga0268265_10326076 | Ga0268265_103260762 | 174 |
| 233 | 3300028380 | Ga0268265_11777510 | Ga0268265_117775101 | 174 |
| 234 | 3300028381 | Ga0268264_10007844 | Ga0268264_100078444 | 174 |
| 235 | 3300028381 | Ga0268264_10913117 | Ga0268264_109131172 | 174 |
| 236 | 3300031824 | Ga0307413_11240635 | Ga0307413_112406351 | 174 |
| 237 | 3300035170 | Ga0373943_0218928 | Ga0373943_0218928_442_969 | 174 |
| 238 | 3300041507 | Ga0451851_0637157 | Ga0451851_0637157_198_758 | 174 |
| 239 | 3300042876 | Ga0451577_0155216 | Ga0451577_0155216_78_611 | 174 |
| 240 | 3300045051 | Ga0451576_0003645 | Ga0451576_0003645_6223_6756 | 174 |
| 241 | 3300045051 | Ga0451576_0161748 | Ga0451576_0161748_281_823 | 174 |
| 242 | 3300046499 | Ga0495594_0065394 | Ga0495594_0065394_824_1351 | 174 |
| 243 | 3300046557 | Ga0495622_0264310 | Ga0495622_0264310_124_651 | 174 |
| 244 | 3300048905 | Ga0496102_0188464 | Ga0496102_0188464_707_1234 | 174 |
| 245 | 3300048909 | Ga0496106_0543896 | Ga0496106_0543896_119_646 | 174 |
| 246 | 3300048910 | Ga0496107_0095698 | Ga0496107_0095698_906_1433 | 174 |
| 247 | 3300048911 | Ga0496108_0001072 | Ga0496108_0001072_2289_2873 | 174 |
| 248 | 3300048912 | Ga0496109_0001229 | Ga0496109_0001229_10328_10912 | 174 |
| 249 | 3300048912 | Ga0496109_0299698 | Ga0496109_0299698_537_1079 | 174 |
| 250 | 3300048912 | Ga0496109_0739527 | Ga0496109_0739527_65_589 | 174 |
| 251 | 3300048913 | Ga0496110_0001039 | Ga0496110_0001039_8667_9272 | 174 |
| 252 | 3300048913 | Ga0496110_0160461 | Ga0496110_0160461_482_1006 | 174 |
| 253 | 3300048915 | Ga0496112_0001561 | Ga0496112_0001561_8805_9389 | 174 |
| 254 | 3300048916 | Ga0496113_0219161 | Ga0496113_0219161_289_873 | 174 |
| 255 | 3300048918 | Ga0496115_0107220 | Ga0496115_0107220_190_744 | 174 |
| 256 | 3300049574 | Ga0501038_0376237 | Ga0501038_0376237_262_798 | 174 |
| 257 | 3300049591 | Ga0501075_0611674 | Ga0501075_0611674_37_570 | 174 |
| 258 | 3300049741 | Ga0501079_0585658 | Ga0501079_0585658_284_820 | 174 |
| 259 | 3300049742 | Ga0501080_1410626 | Ga0501080_1410626_23_556 | 174 |
| 260 | 3300049824 | Ga0501045_0589222 | Ga0501045_0589222_71_607 | 174 |
| 261 | 3300050507 | nmdc:mga05p37_24305_c1 | nmdc:mga05p37_24305_c1_2824_3351 | 174 |
| 262 | 3300050507 | nmdc:mga05p37_31481_c1 | nmdc:mga05p37_31481_c1_416_958 | 174 |
| 263 | 3300050508 | nmdc:mga09592_17447_c1 | nmdc:mga09592_17447_c1_866_1393 | 174 |
| 264 | 3300050508 | nmdc:mga09592_455854_c1 | nmdc:mga09592_455854_c1_472_999 | 174 |
| 265 | 3300050508 | nmdc:mga09592_68573_c1 | nmdc:mga09592_68573_c1_2212_2754 | 174 |
| 266 | 3300050509 | nmdc:mga0qj67_19822_c1 | nmdc:mga0qj67_19822_c1_3889_4431 | 174 |
| 267 | 3300050509 | nmdc:mga0qj67_96221_c1 | nmdc:mga0qj67_96221_c1_1830_2372 | 174 |
| 268 | 3300050510 | nmdc:mga06r32_150686_c1 | nmdc:mga06r32_150686_c1_81_608 | 174 |
| 269 | 3300050510 | nmdc:mga06r32_46524_c1 | nmdc:mga06r32_46524_c1_912_1445 | 174 |
| 270 | 3300050510 | nmdc:mga06r32_869027_c1 | nmdc:mga06r32_869027_c1_178_720 | 174 |
| 271 | 3300050511 | nmdc:mga08y16_132148_c1 | nmdc:mga08y16_132148_c1_949_1476 | 174 |
| 272 | 3300050511 | nmdc:mga08y16_143245_c1 | nmdc:mga08y16_143245_c1_480_1007 | 174 |
| 273 | 3300050511 | nmdc:mga08y16_3591_c1 | nmdc:mga08y16_3591_c1_2971_3513 | 174 |
| 274 | 3300050511 | nmdc:mga08y16_373097_c1 | nmdc:mga08y16_373097_c1_894_1436 | 174 |
| 275 | 3300050512 | nmdc:mga0n895_1031102_c1 | nmdc:mga0n895_1031102_c1_146_673 | 174 |
| 276 | 3300050513 | nmdc:mga0rr50_111258_c1 | nmdc:mga0rr50_111258_c1_1613_2140 | 174 |
| 277 | 3300050513 | nmdc:mga0rr50_164070_c1 | nmdc:mga0rr50_164070_c1_1217_1744 | 174 |
| 278 | 3300050514 | nmdc:mga08x19_174383_c1 | nmdc:mga08x19_174383_c1_339_866 | 174 |
| 279 | 3300050515 | nmdc:mga0a205_154759_c1 | nmdc:mga0a205_154759_c1_1231_1758 | 174 |
| 280 | 3300050515 | nmdc:mga0a205_48666_c1 | nmdc:mga0a205_48666_c1_1804_2331 | 174 |
| 281 | 3300060353 | Ga0501082_0294528 | Ga0501082_0294528_549_1082 | 174 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ij5-assembly1.cif.gz_A | 1.95 angstrom resolution crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from yersinia pestis | 0.986 | 3 | 165 |
| 3hyc-assembly3.cif.gz_E | crystal structure of e. coli phosphatase yrbi, with mg, tetragonal form | 0.9806 | 3 | 166 |
| 4umf-assembly1.cif.gz_C | crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from moraxella catarrhalis in complex with magnesium ion, phosphate ion and kdo molecule | 0.9767 | 3 | 171 |
| 3nrj-assembly3.cif.gz_I | crystal structure of probable yrbi family phosphatase from pseudomonas syringae pv.phaseolica 1448a complexed with magnesium | 0.9747 | 3 | 171 |
| 3n07-assembly1.cif.gz_A-1 | structure of putative 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from vibrio cholerae | 0.9725 | 3 | 163 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ij5D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9816 | 3 | 163 | 3.40.50.1000 |
| 4um7A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9746 | 3 | 171 | 3.40.50.1000 |
| 4navA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9674 | 3 | 172 | 3.40.50.1000 |
| 1j8dB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9588 | 5 | 162 | 3.40.50.1000 |
| 3mmzB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9584 | 7 | 158 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0FM05-F1-model_v4 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) (KDO 8-P phosphatase) | 0.9932 | 3 | 174 |
GO:0008781
GO:0009103 GO:0016788 GO:0046872 |
| AF-A0A2E4WAY8-F1-model_v4 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) (KDO 8-P phosphatase) | 0.9927 | 3 | 164 |
GO:0008781
GO:0009103 GO:0016788 GO:0046872 |
| AF-A0A7C7L7L6-F1-model_v4 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) (KDO 8-P phosphatase) | 0.9918 | 3 | 168 |
GO:0008781
GO:0009103 GO:0016788 |
| AF-A0A317HV95-F1-model_v4 | Phenylphosphate carboxylase subunit delta | 0.9914 | 4 | 171 |
GO:0008781
GO:0009103 GO:0016788 GO:0046872 |
| AF-A0A7V9AW43-F1-model_v4 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (EC 3.1.3.45) (KDO 8-P phosphatase) | 0.9909 | 2 | 172 |
GO:0008781
GO:0009103 GO:0016788 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar