F384586
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 281 | 197 | 281 | 108 |
Family's Representative Sequence
| Representative Sequence | 3300049593|Ga0501077_0125296|Ga0501077_0125296_917_1246 |
| Length | 109 |
| Sequence | MLHELRIYRCLPGRLPALNKRFETITLKLWEKHGIRQVAFWTVEIGGSSNTELYYLLEWENLAEREQRWNAFQSDPEWIAKRAETEKDGPILREIANLILKPTSYSKLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 74 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 75 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 86 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013875 | Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 98 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 99 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 100 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 101 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 102 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 151 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 153 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 154 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 156 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 157 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 158 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 159 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 160 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 161 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 162 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 163 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 164 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 165 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 166 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 167 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 168 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 169 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 173 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 190 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 191 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 192 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 193 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 194 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 195 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.64 |
| Metatranscriptomes | 0.36 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.41 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 82.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10007389 | 3300001979 | Bacteria | 4470 |
| 2 | JGI24739J22299_10023465 | 3300001989 | Unclassified | 2181 |
| 3 | JGI24739J22299_10178351 | 3300001989 | Bacteria | 625 |
| 4 | JGI24735J21928_10022222 | 3300002067 | Bacteria | 1933 |
| 5 | JGI24738J21930_10006014 | 3300002075 | Bacteria | 2877 |
| 6 | JGI25151J46595_10000474 | 3300003187 | Bacteria | 38089 |
| 7 | JGI25153J46596_10040089 | 3300003215 | Bacteria | 1456 |
| 8 | rootL2_10240124 | 3300003322 | Unclassified | 1037 |
| 9 | rootH1_10244251 | 3300003323 | Bacteria | 1056 |
| 10 | Ga0070658_10022923 | 3300005327 | Bacteria | 5012 |
| 11 | Ga0070658_10060852 | 3300005327 | Bacteria | 3076 |
| 12 | Ga0070676_10100708 | 3300005328 | Bacteria | 1784 |
| 13 | Ga0070690_100000486 | 3300005330 | Bacteria | 19952 |
| 14 | Ga0068869_100002903 | 3300005334 | Bacteria | 10409 |
| 15 | Ga0070680_100055708 | 3300005336 | Bacteria | 3231 |
| 16 | Ga0070680_100206749 | 3300005336 | Bacteria | 1656 |
| 17 | Ga0070682_100029880 | 3300005337 | Bacteria | 3285 |
| 18 | Ga0070682_100698746 | 3300005337 | Unclassified | 813 |
| 19 | Ga0068868_100309179 | 3300005338 | Bacteria | 1344 |
| 20 | Ga0070660_100106851 | 3300005339 | Unclassified | 2223 |
| 21 | Ga0070660_100417961 | 3300005339 | Bacteria | 1110 |
| 22 | Ga0070689_100026759 | 3300005340 | Bacteria | 4344 |
| 23 | Ga0070691_10014865 | 3300005341 | Bacteria | 3574 |
| 24 | Ga0070661_100172820 | 3300005344 | Bacteria | 1641 |
| 25 | Ga0070661_100733553 | 3300005344 | Bacteria | 807 |
| 26 | Ga0070692_10021021 | 3300005345 | Bacteria | 3172 |
| 27 | Ga0070692_10051305 | 3300005345 | Bacteria | 2145 |
| 28 | Ga0070674_101825404 | 3300005356 | Unclassified | 551 |
| 29 | Ga0070673_102409340 | 3300005364 | Unclassified | 500 |
| 30 | Ga0070688_100024186 | 3300005365 | Bacteria | 3580 |
| 31 | Ga0070659_100036271 | 3300005366 | Bacteria | 3843 |
| 32 | Ga0070659_101797155 | 3300005366 | Bacteria | 549 |
| 33 | Ga0070709_10138967 | 3300005434 | Bacteria | 1667 |
| 34 | Ga0070714_100202869 | 3300005435 | Bacteria | 1815 |
| 35 | Ga0070713_100125662 | 3300005436 | Bacteria | 2255 |
| 36 | Ga0070713_100571696 | 3300005436 | Bacteria | 1072 |
| 37 | Ga0070710_10165451 | 3300005437 | Bacteria | 1374 |
| 38 | Ga0070710_11127810 | 3300005437 | Unclassified | 577 |
| 39 | Ga0070701_10000955 | 3300005438 | Bacteria | 10480 |
| 40 | Ga0070711_100274911 | 3300005439 | Bacteria | 1330 |
| 41 | Ga0070705_100164106 | 3300005440 | Bacteria | 1488 |
| 42 | Ga0070700_100000199 | 3300005441 | Bacteria | 34018 |
| 43 | Ga0070700_100288810 | 3300005441 | Bacteria | 1192 |
| 44 | Ga0070694_100005329 | 3300005444 | Bacteria | 7779 |
| 45 | Ga0070678_100005618 | 3300005456 | Bacteria | 7280 |
| 46 | Ga0070662_100107313 | 3300005457 | Unclassified | 2122 |
| 47 | Ga0070681_10090705 | 3300005458 | Bacteria | 3006 |
| 48 | Ga0070681_10333284 | 3300005458 | Bacteria | 1427 |
| 49 | Ga0070681_10876934 | 3300005458 | Bacteria | 815 |
| 50 | Ga0068867_100108372 | 3300005459 | Bacteria | 2130 |
| 51 | Ga0068867_100563869 | 3300005459 | Bacteria | 988 |
| 52 | Ga0070685_10021973 | 3300005466 | Bacteria | 3472 |
| 53 | Ga0070698_100434274 | 3300005471 | Bacteria | 1248 |
| 54 | Ga0070679_100137494 | 3300005530 | Bacteria | 2424 |
| 55 | Ga0070679_100203067 | 3300005530 | Bacteria | 1947 |
| 56 | Ga0070684_100122945 | 3300005535 | Bacteria | 2336 |
| 57 | Ga0070686_100006610 | 3300005544 | Bacteria | 6453 |
| 58 | Ga0070695_100032293 | 3300005545 | Bacteria | 3272 |
| 59 | Ga0070696_100189531 | 3300005546 | Bacteria | 1530 |
| 60 | Ga0070696_100507873 | 3300005546 | Bacteria | 960 |
| 61 | Ga0070696_100528673 | 3300005546 | Bacteria | 942 |
| 62 | Ga0070693_100010995 | 3300005547 | Bacteria | 4549 |
| 63 | Ga0070704_100083557 | 3300005549 | Bacteria | 2358 |
| 64 | Ga0068855_100086138 | 3300005563 | Bacteria | 3633 |
| 65 | Ga0070664_100044596 | 3300005564 | Bacteria | 3744 |
| 66 | Ga0068854_100026339 | 3300005578 | Bacteria | 3996 |
| 67 | Ga0070702_100000107 | 3300005615 | Bacteria | 24776 |
| 68 | Ga0068852_101462377 | 3300005616 | Bacteria | 706 |
| 69 | Ga0068859_100018985 | 3300005617 | Bacteria | 6905 |
| 70 | Ga0068866_10000721 | 3300005718 | Bacteria | 15007 |
| 71 | Ga0068861_100003333 | 3300005719 | Bacteria | 10631 |
| 72 | Ga0068851_10255873 | 3300005834 | Bacteria | 994 |
| 73 | Ga0068870_10001416 | 3300005840 | Bacteria | 9692 |
| 74 | Ga0068858_100009133 | 3300005842 | Bacteria | 9478 |
| 75 | Ga0068860_100086645 | 3300005843 | Bacteria | 2981 |
| 76 | Ga0068862_100009109 | 3300005844 | Bacteria | 8218 |
| 77 | Ga0081540_1004167 | 3300005983 | Bacteria | 11127 |
| 78 | Ga0070717_10718549 | 3300006028 | Bacteria | 908 |
| 79 | Ga0075365_10488930 | 3300006038 | Bacteria | 870 |
| 80 | Ga0075364_10652161 | 3300006051 | Bacteria | 719 |
| 81 | Ga0070712_100222365 | 3300006175 | Bacteria | 1495 |
| 82 | Ga0070712_101547165 | 3300006175 | Bacteria | 580 |
| 83 | Ga0075367_10561809 | 3300006178 | Bacteria | 725 |
| 84 | Ga0075366_10016005 | 3300006195 | Bacteria | 4306 |
| 85 | Ga0075366_10051367 | 3300006195 | Bacteria | 2449 |
| 86 | Ga0097621_100047379 | 3300006237 | Bacteria | 3483 |
| 87 | Ga0068871_100003553 | 3300006358 | Bacteria | 10731 |
| 88 | Ga0068871_101704412 | 3300006358 | Bacteria | 598 |
| 89 | Ga0075429_101491688 | 3300006880 | Unclassified | 588 |
| 90 | Ga0068865_100000840 | 3300006881 | Bacteria | 17335 |
| 91 | Ga0068865_100096968 | 3300006881 | Bacteria | 2151 |
| 92 | Ga0068865_100997704 | 3300006881 | Unclassified | 733 |
| 93 | Ga0075436_100617190 | 3300006914 | Bacteria | 800 |
| 94 | Ga0097620_100018985 | 3300006931 | Bacteria | 6905 |
| 95 | Ga0099794_10198235 | 3300007265 | Unclassified | 1028 |
| 96 | Ga0099794_10348317 | 3300007265 | Bacteria | 770 |
| 97 | Ga0099795_10246315 | 3300007788 | Unclassified | 769 |
| 98 | Ga0105250_10303551 | 3300009092 | Unclassified | 691 |
| 99 | Ga0105240_10014843 | 3300009093 | Bacteria | 10619 |
| 100 | Ga0105245_10010542 | 3300009098 | Bacteria | 8042 |
| 101 | Ga0105247_10173446 | 3300009101 | Bacteria | 1435 |
| 102 | Ga0105243_10017398 | 3300009148 | Bacteria | 5434 |
| 103 | Ga0105243_10074168 | 3300009148 | Bacteria | 2759 |
| 104 | Ga0105241_10347540 | 3300009174 | Bacteria | 1287 |
| 105 | Ga0105241_10886661 | 3300009174 | Bacteria | 827 |
| 106 | Ga0105242_10006095 | 3300009176 | Bacteria | 9294 |
| 107 | Ga0105248_10322132 | 3300009177 | Bacteria | 1741 |
| 108 | Ga0105238_10251818 | 3300009551 | Bacteria | 1745 |
| 109 | Ga0105238_11032817 | 3300009551 | Bacteria | 843 |
| 110 | Ga0105249_10006422 | 3300009553 | Bacteria | 10221 |
| 111 | Ga0105033_123656 | 3300009986 | Unclassified | 563 |
| 112 | Ga0105035_100626 | 3300009988 | Bacteria | 2201 |
| 113 | Ga0157373_10127175 | 3300013100 | Bacteria | 1792 |
| 114 | Ga0157371_10079482 | 3300013102 | Bacteria | 2323 |
| 115 | Ga0157371_10354302 | 3300013102 | Unclassified | 1069 |
| 116 | Ga0157369_10151475 | 3300013105 | Bacteria | 2451 |
| 117 | Ga0157369_10212694 | 3300013105 | Bacteria | 2026 |
| 118 | Ga0157378_10004190 | 3300013297 | Bacteria | 12724 |
| 119 | Ga0157378_10508517 | 3300013297 | Bacteria | 1204 |
| 120 | Ga0157378_12275640 | 3300013297 | Unclassified | 593 |
| 121 | Ga0163162_10045892 | 3300013306 | Bacteria | 4379 |
| 122 | Ga0157372_10052537 | 3300013307 | Bacteria | 4538 |
| 123 | Ga0157375_10044743 | 3300013308 | Bacteria | 4304 |
| 124 | Ga0157515_115462 | 3300013875 | Bacteria | 521 |
| 125 | Ga0157380_10005168 | 3300014326 | Bacteria | 9125 |
| 126 | Ga0157380_10095321 | 3300014326 | Bacteria | 2465 |
| 127 | Ga0157379_10024471 | 3300014968 | Bacteria | 5360 |
| 128 | Ga0213873_10052172 | 3300021358 | Bacteria | 1086 |
| 129 | Ga0213872_10125962 | 3300021361 | Bacteria | 1131 |
| 130 | Ga0213874_10016514 | 3300021377 | Bacteria | 1966 |
| 131 | Ga0213876_10004601 | 3300021384 | Bacteria | 7691 |
| 132 | Ga0213876_10095903 | 3300021384 | Bacteria | 1571 |
| 133 | Ga0213876_10105973 | 3300021384 | Bacteria | 1492 |
| 134 | Ga0213876_10632804 | 3300021384 | Bacteria | 569 |
| 135 | Ga0213875_10001344 | 3300021388 | Bacteria | 16189 |
| 136 | Ga0213875_10004429 | 3300021388 | Bacteria | 7714 |
| 137 | Ga0213875_10084830 | 3300021388 | Bacteria | 1478 |
| 138 | Ga0213875_10095590 | 3300021388 | Bacteria | 1385 |
| 139 | Ga0209025_1000582 | 3300025294 | Bacteria | 66224 |
| 140 | Ga0209758_1011019 | 3300025297 | Bacteria | 5300 |
| 141 | Ga0207656_10005388 | 3300025321 | Bacteria | 4519 |
| 142 | Ga0207692_11156727 | 3300025898 | Bacteria | 513 |
| 143 | Ga0207642_10004977 | 3300025899 | Bacteria | 4307 |
| 144 | Ga0207647_10003347 | 3300025904 | Bacteria | 12021 |
| 145 | Ga0207699_10098764 | 3300025906 | Bacteria | 1848 |
| 146 | Ga0207699_10418011 | 3300025906 | Bacteria | 957 |
| 147 | Ga0207645_10118737 | 3300025907 | Unclassified | 1716 |
| 148 | Ga0207643_10041218 | 3300025908 | Bacteria | 2601 |
| 149 | Ga0207705_10025425 | 3300025909 | Bacteria | 4227 |
| 150 | Ga0207654_10001932 | 3300025911 | Bacteria | 10735 |
| 151 | Ga0207654_10227444 | 3300025911 | Unclassified | 1241 |
| 152 | Ga0207707_10018787 | 3300025912 | Bacteria | 6028 |
| 153 | Ga0207695_10007515 | 3300025913 | Bacteria | 13825 |
| 154 | Ga0207695_10189308 | 3300025913 | Bacteria | 1976 |
| 155 | Ga0207671_10001159 | 3300025914 | Bacteria | 31442 |
| 156 | Ga0207693_10014010 | 3300025915 | Bacteria | 6456 |
| 157 | Ga0207693_10154325 | 3300025915 | Bacteria | 1806 |
| 158 | Ga0207663_10046628 | 3300025916 | Bacteria | 2671 |
| 159 | Ga0207660_10117726 | 3300025917 | Bacteria | 2008 |
| 160 | Ga0207660_10422477 | 3300025917 | Bacteria | 1075 |
| 161 | Ga0207660_10663319 | 3300025917 | Bacteria | 850 |
| 162 | Ga0207660_11551821 | 3300025917 | Bacteria | 534 |
| 163 | Ga0207657_10014888 | 3300025919 | Bacteria | 7566 |
| 164 | Ga0207657_10320180 | 3300025919 | Bacteria | 1226 |
| 165 | Ga0207649_10972974 | 3300025920 | Bacteria | 667 |
| 166 | Ga0207652_10037367 | 3300025921 | Bacteria | 4110 |
| 167 | Ga0207652_10651104 | 3300025921 | Unclassified | 942 |
| 168 | Ga0207694_10129467 | 3300025924 | Bacteria | 2022 |
| 169 | Ga0207687_10016734 | 3300025927 | Bacteria | 4820 |
| 170 | Ga0207700_10233260 | 3300025928 | Bacteria | 1565 |
| 171 | Ga0207664_10405248 | 3300025929 | Bacteria | 1213 |
| 172 | Ga0207664_10693720 | 3300025929 | Bacteria | 915 |
| 173 | Ga0207690_10138798 | 3300025932 | Unclassified | 1788 |
| 174 | Ga0207690_10239436 | 3300025932 | Bacteria | 1397 |
| 175 | Ga0207686_10000279 | 3300025934 | Bacteria | 38089 |
| 176 | Ga0207686_10026085 | 3300025934 | Bacteria | 3407 |
| 177 | Ga0207709_10124359 | 3300025935 | Bacteria | 1747 |
| 178 | Ga0207709_10157454 | 3300025935 | Bacteria | 1580 |
| 179 | Ga0207670_10004023 | 3300025936 | Bacteria | 7858 |
| 180 | Ga0207669_10029952 | 3300025937 | Bacteria | 3018 |
| 181 | Ga0207704_10003852 | 3300025938 | Bacteria | 6818 |
| 182 | Ga0207665_10294454 | 3300025939 | Bacteria | 1211 |
| 183 | Ga0207711_10400780 | 3300025941 | Bacteria | 1275 |
| 184 | Ga0207689_10003072 | 3300025942 | Bacteria | 15383 |
| 185 | Ga0207667_10028843 | 3300025949 | Bacteria | 6025 |
| 186 | Ga0207667_10223285 | 3300025949 | Bacteria | 1930 |
| 187 | Ga0207712_10019259 | 3300025961 | Bacteria | 4455 |
| 188 | Ga0207640_10306590 | 3300025981 | Bacteria | 1258 |
| 189 | Ga0207677_10244565 | 3300026023 | Bacteria | 1453 |
| 190 | Ga0207703_10003484 | 3300026035 | Bacteria | 13172 |
| 191 | Ga0207639_10037574 | 3300026041 | Bacteria | 3597 |
| 192 | Ga0207639_10901847 | 3300026041 | Unclassified | 826 |
| 193 | Ga0207678_10043961 | 3300026067 | Bacteria | 3865 |
| 194 | Ga0207708_10000067 | 3300026075 | Bacteria | 83659 |
| 195 | Ga0207708_10026036 | 3300026075 | Bacteria | 4425 |
| 196 | Ga0207702_10005873 | 3300026078 | Bacteria | 10672 |
| 197 | Ga0207702_10170085 | 3300026078 | Bacteria | 1997 |
| 198 | Ga0207702_11519068 | 3300026078 | Bacteria | 663 |
| 199 | Ga0207648_10000232 | 3300026089 | Bacteria | 59568 |
| 200 | Ga0207648_11232617 | 3300026089 | Bacteria | 703 |
| 201 | Ga0207675_100000258 | 3300026118 | Bacteria | 50669 |
| 202 | Ga0207683_10024478 | 3300026121 | Bacteria | 5201 |
| 203 | Ga0207698_10077171 | 3300026142 | Bacteria | 2670 |
| 204 | Ga0207698_10173952 | 3300026142 | Unclassified | 1899 |
| 205 | Ga0207698_10742811 | 3300026142 | Bacteria | 979 |
| 206 | Ga0268265_10085033 | 3300028380 | Bacteria | 2509 |
| 207 | Ga0268264_10009377 | 3300028381 | Bacteria | 8102 |
| 208 | Ga0265325_10000821 | 3300031241 | Bacteria | 22542 |
| 209 | Ga0265313_10016125 | 3300031595 | Bacteria | 4312 |
| 210 | Ga0307410_11284372 | 3300031852 | Bacteria | 640 |
| 211 | Ga0307407_10749952 | 3300031903 | Bacteria | 739 |
| 212 | Ga0373937_1443962 | 3300036401 | Bacteria | 636 |
| 213 | Ga0395900_0808479 | 3300037418 | Bacteria | 865 |
| 214 | Ga0395905_0069619 | 3300037471 | Bacteria | 3296 |
| 215 | Ga0436364_0177728 | 3300037853 | Bacteria | 960 |
| 216 | Ga0436364_0197130 | 3300037853 | Bacteria | 17743 |
| 217 | Ga0436364_0461387 | 3300037853 | Bacteria | 1074 |
| 218 | Ga0436364_0617972 | 3300037853 | Bacteria | 7054 |
| 219 | Ga0436364_0740264 | 3300037853 | Bacteria | 4806 |
| 220 | Ga0436364_1155216 | 3300037853 | Unclassified | 506 |
| 221 | Ga0395901_1251538 | 3300038443 | Bacteria | 706 |
| 222 | Ga0436365_0306156 | 3300039437 | Bacteria | 1100 |
| 223 | Ga0436365_0364034 | 3300039437 | Bacteria | 67701 |
| 224 | Ga0436365_0773905 | 3300039437 | Bacteria | 4279 |
| 225 | Ga0436365_1078535 | 3300039437 | Bacteria | 2251 |
| 226 | Ga0436365_1140355 | 3300039437 | Bacteria | 554 |
| 227 | Ga0436365_1231871 | 3300039437 | Bacteria | 735 |
| 228 | Ga0436365_1424493 | 3300039437 | Bacteria | 16000 |
| 229 | Ga0436365_1651533 | 3300039437 | Bacteria | 1401 |
| 230 | Ga0436360_0929109 | 3300039438 | Unclassified | 522 |
| 231 | Ga0436361_0314021 | 3300039447 | Bacteria | 2862 |
| 232 | Ga0436363_0145876 | 3300039450 | Bacteria | 588 |
| 233 | Ga0436363_0239262 | 3300039450 | Bacteria | 9304 |
| 234 | Ga0436363_0880288 | 3300039450 | Bacteria | 1128 |
| 235 | Ga0436363_0922216 | 3300039450 | Bacteria | 4051 |
| 236 | Ga0436362_0104926 | 3300039453 | Bacteria | 807 |
| 237 | Ga0436362_0362206 | 3300039453 | Bacteria | 4670 |
| 238 | Ga0451839_0187830 | 3300041496 | Unclassified | 542 |
| 239 | Ga0466965_0357591 | 3300044683 | Bacteria | 801 |
| 240 | Ga0466963_0324048 | 3300044694 | Bacteria | 1084 |
| 241 | Ga0466960_0029446 | 3300044901 | Bacteria | 2520 |
| 242 | Ga0466960_0068014 | 3300044901 | Bacteria | 1766 |
| 243 | Ga0466960_0526391 | 3300044901 | Bacteria | 695 |
| 244 | Ga0466958_0184625 | 3300045836 | Bacteria | 1324 |
| 245 | Ga0495610_0063777 | 3300046512 | Bacteria | 1743 |
| 246 | Ga0495587_0014893 | 3300046536 | Bacteria | 4865 |
| 247 | Ga0495686_0355705 | 3300047472 | Unclassified | 795 |
| 248 | Ga0496121_0395853 | 3300048924 | Bacteria | 906 |
| 249 | Ga0501032_0079530 | 3300049569 | Unclassified | 2183 |
| 250 | Ga0501034_0103020 | 3300049571 | Bacteria | 2847 |
| 251 | Ga0501034_0200129 | 3300049571 | Archaea | 1956 |
| 252 | Ga0501034_1347132 | 3300049571 | Unclassified | 590 |
| 253 | Ga0501036_1556133 | 3300049572 | Archaea | 534 |
| 254 | Ga0501038_1355369 | 3300049574 | Bacteria | 512 |
| 255 | Ga0501039_0256164 | 3300049575 | Archaea | 1376 |
| 256 | Ga0501047_0431403 | 3300049581 | Archaea | 1149 |
| 257 | Ga0501070_0039383 | 3300049586 | Bacteria | 3943 |
| 258 | Ga0501070_0074393 | 3300049586 | Bacteria | 2812 |
| 259 | Ga0501071_0470939 | 3300049587 | Bacteria | 962 |
| 260 | Ga0501071_0871566 | 3300049587 | Unclassified | 694 |
| 261 | Ga0501072_0342077 | 3300049588 | Unclassified | 1188 |
| 262 | Ga0501073_0694278 | 3300049589 | Bacteria | 702 |
| 263 | Ga0501073_1182847 | 3300049589 | Unclassified | 525 |
| 264 | Ga0501076_1021038 | 3300049592 | Bacteria | 681 |
| 265 | Ga0501077_0125296 | 3300049593 | Bacteria | 1628 |
| 266 | Ga0501083_0081241 | 3300049744 | Bacteria | 2149 |
| 267 | Ga0501035_0070173 | 3300049822 | Bacteria | 3104 |
| 268 | Ga0501044_0376794 | 3300049823 | Bacteria | 1335 |
| 269 | Ga0501045_0285736 | 3300049824 | Bacteria | 1228 |
| 270 | nmdc:mga03683_164868_c1 | 3300050489 | Bacteria | 1005 |
| 271 | nmdc:mga03683_89974_c1 | 3300050489 | Bacteria | 1337 |
| 272 | nmdc:mga03n38_233849_c1 | 3300050490 | Bacteria | 964 |
| 273 | nmdc:mga00v17_361327_c1 | 3300050491 | Bacteria | 944 |
| 274 | nmdc:mga0yw44_1074059_c1 | 3300050492 | Bacteria | 544 |
| 275 | nmdc:mga0k408_12326_c1 | 3300050493 | Bacteria | 4671 |
| 276 | nmdc:mga0k408_27719_c1 | 3300050493 | Bacteria | 3218 |
| 277 | nmdc:mga06z11_791703_c1 | 3300050494 | Bacteria | 578 |
| 278 | nmdc:mga06z11_986977_c1 | 3300050494 | Bacteria | 513 |
| 279 | nmdc:mga08x19_641904_c1 | 3300050514 | Bacteria | 753 |
| 280 | Ga0587071_161660 | 3300060344 | Bacteria | 564 |
| 281 | Ga0501082_0325216 | 3300060353 | Bacteria | 1340 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300001989 | JGI24739J22299_10178351 | JGI24739J22299_101783511 | 108 |
| 2 | 3300003187 | JGI25151J46595_10000474 | JGI25151J46595_1000047423 | 108 |
| 3 | 3300003215 | JGI25153J46596_10040089 | JGI25153J46596_100400892 | 108 |
| 4 | 3300003322 | rootL2_10240124 | rootL2_102401242 | 108 |
| 5 | 3300003323 | rootH1_10244251 | rootH1_102442511 | 108 |
| 6 | 3300005327 | Ga0070658_10022923 | Ga0070658_100229232 | 108 |
| 7 | 3300005328 | Ga0070676_10100708 | Ga0070676_101007083 | 108 |
| 8 | 3300005330 | Ga0070690_100000486 | Ga0070690_10000048620 | 108 |
| 9 | 3300005334 | Ga0068869_100002903 | Ga0068869_1000029038 | 108 |
| 10 | 3300005336 | Ga0070680_100055708 | Ga0070680_1000557084 | 108 |
| 11 | 3300005336 | Ga0070680_100206749 | Ga0070680_1002067492 | 108 |
| 12 | 3300005337 | Ga0070682_100029880 | Ga0070682_1000298804 | 108 |
| 13 | 3300005338 | Ga0068868_100309179 | Ga0068868_1003091792 | 108 |
| 14 | 3300005339 | Ga0070660_100417961 | Ga0070660_1004179613 | 108 |
| 15 | 3300005340 | Ga0070689_100026759 | Ga0070689_1000267594 | 108 |
| 16 | 3300005341 | Ga0070691_10014865 | Ga0070691_100148652 | 108 |
| 17 | 3300005344 | Ga0070661_100733553 | Ga0070661_1007335531 | 108 |
| 18 | 3300005345 | Ga0070692_10021021 | Ga0070692_100210212 | 108 |
| 19 | 3300005345 | Ga0070692_10051305 | Ga0070692_100513051 | 108 |
| 20 | 3300005356 | Ga0070674_101825404 | Ga0070674_1018254041 | 108 |
| 21 | 3300005364 | Ga0070673_102409340 | Ga0070673_1024093401 | 108 |
| 22 | 3300005365 | Ga0070688_100024186 | Ga0070688_1000241862 | 108 |
| 23 | 3300005366 | Ga0070659_101797155 | Ga0070659_1017971551 | 108 |
| 24 | 3300005434 | Ga0070709_10138967 | Ga0070709_101389672 | 108 |
| 25 | 3300005435 | Ga0070714_100202869 | Ga0070714_1002028693 | 108 |
| 26 | 3300005436 | Ga0070713_100125662 | Ga0070713_1001256623 | 108 |
| 27 | 3300005436 | Ga0070713_100571696 | Ga0070713_1005716961 | 108 |
| 28 | 3300005437 | Ga0070710_10165451 | Ga0070710_101654513 | 108 |
| 29 | 3300005437 | Ga0070710_11127810 | Ga0070710_111278102 | 108 |
| 30 | 3300005438 | Ga0070701_10000955 | Ga0070701_100009552 | 108 |
| 31 | 3300005439 | Ga0070711_100274911 | Ga0070711_1002749111 | 108 |
| 32 | 3300005440 | Ga0070705_100164106 | Ga0070705_1001641061 | 108 |
| 33 | 3300005441 | Ga0070700_100000199 | Ga0070700_10000019912 | 108 |
| 34 | 3300005441 | Ga0070700_100288810 | Ga0070700_1002888101 | 108 |
| 35 | 3300005444 | Ga0070694_100005329 | Ga0070694_1000053298 | 108 |
| 36 | 3300005456 | Ga0070678_100005618 | Ga0070678_1000056186 | 108 |
| 37 | 3300005458 | Ga0070681_10090705 | Ga0070681_100907054 | 108 |
| 38 | 3300005458 | Ga0070681_10333284 | Ga0070681_103332842 | 108 |
| 39 | 3300005458 | Ga0070681_10876934 | Ga0070681_108769342 | 108 |
| 40 | 3300005459 | Ga0068867_100108372 | Ga0068867_1001083723 | 108 |
| 41 | 3300005459 | Ga0068867_100563869 | Ga0068867_1005638691 | 108 |
| 42 | 3300005466 | Ga0070685_10021973 | Ga0070685_100219733 | 108 |
| 43 | 3300005471 | Ga0070698_100434274 | Ga0070698_1004342743 | 108 |
| 44 | 3300005530 | Ga0070679_100137494 | Ga0070679_1001374944 | 108 |
| 45 | 3300005530 | Ga0070679_100203067 | Ga0070679_1002030672 | 108 |
| 46 | 3300005544 | Ga0070686_100006610 | Ga0070686_1000066106 | 108 |
| 47 | 3300005545 | Ga0070695_100032293 | Ga0070695_1000322934 | 108 |
| 48 | 3300005546 | Ga0070696_100189531 | Ga0070696_1001895312 | 108 |
| 49 | 3300005546 | Ga0070696_100528673 | Ga0070696_1005286732 | 108 |
| 50 | 3300005547 | Ga0070693_100010995 | Ga0070693_1000109953 | 108 |
| 51 | 3300005549 | Ga0070704_100083557 | Ga0070704_1000835574 | 108 |
| 52 | 3300005563 | Ga0068855_100086138 | Ga0068855_1000861383 | 108 |
| 53 | 3300005578 | Ga0068854_100026339 | Ga0068854_1000263395 | 108 |
| 54 | 3300005615 | Ga0070702_100000107 | Ga0070702_10000010712 | 108 |
| 55 | 3300005616 | Ga0068852_101462377 | Ga0068852_1014623771 | 108 |
| 56 | 3300005617 | Ga0068859_100018985 | Ga0068859_1000189856 | 108 |
| 57 | 3300005718 | Ga0068866_10000721 | Ga0068866_1000072115 | 108 |
| 58 | 3300005719 | Ga0068861_100003333 | Ga0068861_1000033332 | 108 |
| 59 | 3300005840 | Ga0068870_10001416 | Ga0068870_100014168 | 108 |
| 60 | 3300005842 | Ga0068858_100009133 | Ga0068858_1000091337 | 108 |
| 61 | 3300005843 | Ga0068860_100086645 | Ga0068860_1000866452 | 108 |
| 62 | 3300005844 | Ga0068862_100009109 | Ga0068862_10000910911 | 108 |
| 63 | 3300005983 | Ga0081540_1004167 | Ga0081540_10041677 | 108 |
| 64 | 3300006028 | Ga0070717_10718549 | Ga0070717_107185491 | 108 |
| 65 | 3300006038 | Ga0075365_10488930 | Ga0075365_104889302 | 108 |
| 66 | 3300006051 | Ga0075364_10652161 | Ga0075364_106521612 | 108 |
| 67 | 3300006175 | Ga0070712_100222365 | Ga0070712_1002223652 | 108 |
| 68 | 3300006175 | Ga0070712_101547165 | Ga0070712_1015471651 | 108 |
| 69 | 3300006178 | Ga0075367_10561809 | Ga0075367_105618092 | 108 |
| 70 | 3300006195 | Ga0075366_10016005 | Ga0075366_100160055 | 108 |
| 71 | 3300006195 | Ga0075366_10051367 | Ga0075366_100513674 | 108 |
| 72 | 3300006237 | Ga0097621_100047379 | Ga0097621_1000473795 | 108 |
| 73 | 3300006358 | Ga0068871_100003553 | Ga0068871_1000035532 | 108 |
| 74 | 3300006358 | Ga0068871_101704412 | Ga0068871_1017044122 | 108 |
| 75 | 3300006880 | Ga0075429_101491688 | Ga0075429_1014916881 | 108 |
| 76 | 3300006881 | Ga0068865_100000840 | Ga0068865_10000084010 | 108 |
| 77 | 3300006881 | Ga0068865_100096968 | Ga0068865_1000969682 | 108 |
| 78 | 3300006881 | Ga0068865_100997704 | Ga0068865_1009977042 | 108 |
| 79 | 3300006914 | Ga0075436_100617190 | Ga0075436_1006171902 | 108 |
| 80 | 3300006931 | Ga0097620_100018985 | Ga0097620_1000189854 | 108 |
| 81 | 3300007265 | Ga0099794_10198235 | Ga0099794_101982352 | 108 |
| 82 | 3300007265 | Ga0099794_10348317 | Ga0099794_103483172 | 108 |
| 83 | 3300007788 | Ga0099795_10246315 | Ga0099795_102463152 | 108 |
| 84 | 3300009092 | Ga0105250_10303551 | Ga0105250_103035511 | 108 |
| 85 | 3300009093 | Ga0105240_10014843 | Ga0105240_100148435 | 108 |
| 86 | 3300009098 | Ga0105245_10010542 | Ga0105245_100105425 | 108 |
| 87 | 3300009101 | Ga0105247_10173446 | Ga0105247_101734462 | 108 |
| 88 | 3300009148 | Ga0105243_10017398 | Ga0105243_100173983 | 108 |
| 89 | 3300009148 | Ga0105243_10074168 | Ga0105243_100741683 | 108 |
| 90 | 3300009174 | Ga0105241_10886661 | Ga0105241_108866611 | 108 |
| 91 | 3300009176 | Ga0105242_10006095 | Ga0105242_100060955 | 108 |
| 92 | 3300009177 | Ga0105248_10322132 | Ga0105248_103221322 | 108 |
| 93 | 3300009551 | Ga0105238_11032817 | Ga0105238_110328171 | 108 |
| 94 | 3300009553 | Ga0105249_10006422 | Ga0105249_100064226 | 108 |
| 95 | 3300009986 | Ga0105033_123656 | Ga0105033_1236561 | 108 |
| 96 | 3300009988 | Ga0105035_100626 | Ga0105035_1006262 | 108 |
| 97 | 3300013102 | Ga0157371_10079482 | Ga0157371_100794823 | 108 |
| 98 | 3300013105 | Ga0157369_10212694 | Ga0157369_102126942 | 108 |
| 99 | 3300013297 | Ga0157378_10004190 | Ga0157378_1000419012 | 108 |
| 100 | 3300013297 | Ga0157378_10508517 | Ga0157378_105085171 | 108 |
| 101 | 3300013297 | Ga0157378_12275640 | Ga0157378_122756402 | 108 |
| 102 | 3300013306 | Ga0163162_10045892 | Ga0163162_100458926 | 108 |
| 103 | 3300013308 | Ga0157375_10044743 | Ga0157375_100447433 | 108 |
| 104 | 3300013875 | Ga0157515_115462 | Ga0157515_1154621 | 108 |
| 105 | 3300014326 | Ga0157380_10005168 | Ga0157380_100051686 | 108 |
| 106 | 3300014326 | Ga0157380_10095321 | Ga0157380_100953213 | 108 |
| 107 | 3300014968 | Ga0157379_10024471 | Ga0157379_100244715 | 108 |
| 108 | 3300021358 | Ga0213873_10052172 | Ga0213873_100521722 | 108 |
| 109 | 3300021361 | Ga0213872_10125962 | Ga0213872_101259622 | 108 |
| 110 | 3300021377 | Ga0213874_10016514 | Ga0213874_100165142 | 108 |
| 111 | 3300021384 | Ga0213876_10004601 | Ga0213876_100046012 | 108 |
| 112 | 3300021384 | Ga0213876_10095903 | Ga0213876_100959032 | 108 |
| 113 | 3300021384 | Ga0213876_10105973 | Ga0213876_101059731 | 108 |
| 114 | 3300021384 | Ga0213876_10632804 | Ga0213876_106328041 | 108 |
| 115 | 3300021388 | Ga0213875_10001344 | Ga0213875_1000134412 | 108 |
| 116 | 3300021388 | Ga0213875_10004429 | Ga0213875_100044293 | 108 |
| 117 | 3300021388 | Ga0213875_10084830 | Ga0213875_100848302 | 108 |
| 118 | 3300021388 | Ga0213875_10095590 | Ga0213875_100955902 | 108 |
| 119 | 3300025294 | Ga0209025_1000582 | Ga0209025_100058234 | 108 |
| 120 | 3300025297 | Ga0209758_1011019 | Ga0209758_10110194 | 108 |
| 121 | 3300025898 | Ga0207692_11156727 | Ga0207692_111567271 | 108 |
| 122 | 3300025899 | Ga0207642_10004977 | Ga0207642_100049775 | 108 |
| 123 | 3300025906 | Ga0207699_10098764 | Ga0207699_100987642 | 108 |
| 124 | 3300025906 | Ga0207699_10418011 | Ga0207699_104180112 | 108 |
| 125 | 3300025907 | Ga0207645_10118737 | Ga0207645_101187371 | 108 |
| 126 | 3300025908 | Ga0207643_10041218 | Ga0207643_100412184 | 108 |
| 127 | 3300025912 | Ga0207707_10018787 | Ga0207707_100187873 | 108 |
| 128 | 3300025913 | Ga0207695_10189308 | Ga0207695_101893082 | 108 |
| 129 | 3300025915 | Ga0207693_10014010 | Ga0207693_100140102 | 108 |
| 130 | 3300025915 | Ga0207693_10154325 | Ga0207693_101543252 | 108 |
| 131 | 3300025916 | Ga0207663_10046628 | Ga0207663_100466282 | 108 |
| 132 | 3300025917 | Ga0207660_10117726 | Ga0207660_101177263 | 108 |
| 133 | 3300025917 | Ga0207660_10422477 | Ga0207660_104224772 | 108 |
| 134 | 3300025917 | Ga0207660_10663319 | Ga0207660_106633192 | 108 |
| 135 | 3300025917 | Ga0207660_11551821 | Ga0207660_115518212 | 108 |
| 136 | 3300025919 | Ga0207657_10320180 | Ga0207657_103201803 | 108 |
| 137 | 3300025920 | Ga0207649_10972974 | Ga0207649_109729741 | 108 |
| 138 | 3300025921 | Ga0207652_10037367 | Ga0207652_100373674 | 108 |
| 139 | 3300025921 | Ga0207652_10651104 | Ga0207652_106511042 | 108 |
| 140 | 3300025927 | Ga0207687_10016734 | Ga0207687_100167346 | 108 |
| 141 | 3300025928 | Ga0207700_10233260 | Ga0207700_102332603 | 108 |
| 142 | 3300025929 | Ga0207664_10405248 | Ga0207664_104052482 | 108 |
| 143 | 3300025929 | Ga0207664_10693720 | Ga0207664_106937202 | 108 |
| 144 | 3300025932 | Ga0207690_10239436 | Ga0207690_102394362 | 108 |
| 145 | 3300025934 | Ga0207686_10000279 | Ga0207686_100002797 | 108 |
| 146 | 3300025934 | Ga0207686_10026085 | Ga0207686_100260852 | 108 |
| 147 | 3300025935 | Ga0207709_10124359 | Ga0207709_101243592 | 108 |
| 148 | 3300025935 | Ga0207709_10157454 | Ga0207709_101574542 | 108 |
| 149 | 3300025936 | Ga0207670_10004023 | Ga0207670_100040235 | 108 |
| 150 | 3300025937 | Ga0207669_10029952 | Ga0207669_100299525 | 108 |
| 151 | 3300025938 | Ga0207704_10003852 | Ga0207704_100038524 | 108 |
| 152 | 3300025939 | Ga0207665_10294454 | Ga0207665_102944542 | 108 |
| 153 | 3300025941 | Ga0207711_10400780 | Ga0207711_104007802 | 108 |
| 154 | 3300025942 | Ga0207689_10003072 | Ga0207689_100030728 | 108 |
| 155 | 3300025949 | Ga0207667_10223285 | Ga0207667_102232853 | 108 |
| 156 | 3300025961 | Ga0207712_10019259 | Ga0207712_100192596 | 108 |
| 157 | 3300025981 | Ga0207640_10306590 | Ga0207640_103065903 | 108 |
| 158 | 3300026023 | Ga0207677_10244565 | Ga0207677_102445652 | 108 |
| 159 | 3300026035 | Ga0207703_10003484 | Ga0207703_1000348412 | 108 |
| 160 | 3300026075 | Ga0207708_10000067 | Ga0207708_1000006745 | 108 |
| 161 | 3300026075 | Ga0207708_10026036 | Ga0207708_100260362 | 108 |
| 162 | 3300026078 | Ga0207702_10170085 | Ga0207702_101700853 | 108 |
| 163 | 3300026078 | Ga0207702_11519068 | Ga0207702_115190681 | 108 |
| 164 | 3300026089 | Ga0207648_10000232 | Ga0207648_1000023242 | 108 |
| 165 | 3300026089 | Ga0207648_11232617 | Ga0207648_112326172 | 108 |
| 166 | 3300026118 | Ga0207675_100000258 | Ga0207675_10000025837 | 108 |
| 167 | 3300026121 | Ga0207683_10024478 | Ga0207683_100244786 | 108 |
| 168 | 3300026142 | Ga0207698_10742811 | Ga0207698_107428111 | 108 |
| 169 | 3300028380 | Ga0268265_10085033 | Ga0268265_100850332 | 108 |
| 170 | 3300028381 | Ga0268264_10009377 | Ga0268264_100093777 | 108 |
| 171 | 3300031241 | Ga0265325_10000821 | Ga0265325_1000082119 | 108 |
| 172 | 3300031595 | Ga0265313_10016125 | Ga0265313_100161253 | 108 |
| 173 | 3300031852 | Ga0307410_11284372 | Ga0307410_112843722 | 108 |
| 174 | 3300031903 | Ga0307407_10749952 | Ga0307407_107499522 | 108 |
| 175 | 3300036401 | Ga0373937_1443962 | Ga0373937_1443962_107_433 | 108 |
| 176 | 3300037418 | Ga0395900_0808479 | Ga0395900_0808479_210_536 | 108 |
| 177 | 3300037471 | Ga0395905_0069619 | Ga0395905_0069619_2529_2855 | 108 |
| 178 | 3300037853 | Ga0436364_0177728 | Ga0436364_0177728_36_362 | 108 |
| 179 | 3300037853 | Ga0436364_0197130 | Ga0436364_0197130_10223_10549 | 108 |
| 180 | 3300037853 | Ga0436364_0461387 | Ga0436364_0461387_661_987 | 108 |
| 181 | 3300037853 | Ga0436364_0617972 | Ga0436364_0617972_2719_3045 | 108 |
| 182 | 3300037853 | Ga0436364_0740264 | Ga0436364_0740264_1383_1709 | 108 |
| 183 | 3300037853 | Ga0436364_1155216 | Ga0436364_1155216_22_348 | 108 |
| 184 | 3300038443 | Ga0395901_1251538 | Ga0395901_1251538_37_363 | 108 |
| 185 | 3300039437 | Ga0436365_0306156 | Ga0436365_0306156_101_427 | 108 |
| 186 | 3300039437 | Ga0436365_0364034 | Ga0436365_0364034_64495_64821 | 108 |
| 187 | 3300039437 | Ga0436365_0773905 | Ga0436365_0773905_2277_2603 | 108 |
| 188 | 3300039437 | Ga0436365_1078535 | Ga0436365_1078535_1901_2227 | 108 |
| 189 | 3300039437 | Ga0436365_1140355 | Ga0436365_1140355_57_383 | 108 |
| 190 | 3300039437 | Ga0436365_1231871 | Ga0436365_1231871_151_477 | 108 |
| 191 | 3300039437 | Ga0436365_1424493 | Ga0436365_1424493_4879_5205 | 108 |
| 192 | 3300039437 | Ga0436365_1651533 | Ga0436365_1651533_879_1205 | 108 |
| 193 | 3300039438 | Ga0436360_0929109 | Ga0436360_0929109_100_426 | 108 |
| 194 | 3300039447 | Ga0436361_0314021 | Ga0436361_0314021_2325_2651 | 108 |
| 195 | 3300039450 | Ga0436363_0145876 | Ga0436363_0145876_51_377 | 108 |
| 196 | 3300039450 | Ga0436363_0239262 | Ga0436363_0239262_1648_1974 | 108 |
| 197 | 3300039450 | Ga0436363_0880288 | Ga0436363_0880288_413_739 | 108 |
| 198 | 3300039450 | Ga0436363_0922216 | Ga0436363_0922216_3146_3472 | 108 |
| 199 | 3300039453 | Ga0436362_0104926 | Ga0436362_0104926_309_635 | 108 |
| 200 | 3300039453 | Ga0436362_0362206 | Ga0436362_0362206_696_1022 | 108 |
| 201 | 3300041496 | Ga0451839_0187830 | Ga0451839_0187830_41_367 | 108 |
| 202 | 3300044683 | Ga0466965_0357591 | Ga0466965_0357591_444_770 | 108 |
| 203 | 3300044694 | Ga0466963_0324048 | Ga0466963_0324048_469_795 | 108 |
| 204 | 3300044901 | Ga0466960_0029446 | Ga0466960_0029446_1888_2214 | 108 |
| 205 | 3300044901 | Ga0466960_0068014 | Ga0466960_0068014_24_350 | 108 |
| 206 | 3300044901 | Ga0466960_0526391 | Ga0466960_0526391_288_671 | 108 |
| 207 | 3300045836 | Ga0466958_0184625 | Ga0466958_0184625_232_558 | 108 |
| 208 | 3300046512 | Ga0495610_0063777 | Ga0495610_0063777_1350_1676 | 108 |
| 209 | 3300046536 | Ga0495587_0014893 | Ga0495587_0014893_1469_1795 | 108 |
| 210 | 3300047472 | Ga0495686_0355705 | Ga0495686_0355705_274_600 | 108 |
| 211 | 3300048924 | Ga0496121_0395853 | Ga0496121_0395853_361_687 | 108 |
| 212 | 3300049569 | Ga0501032_0079530 | Ga0501032_0079530_1353_1679 | 108 |
| 213 | 3300049571 | Ga0501034_0103020 | Ga0501034_0103020_2441_2767 | 108 |
| 214 | 3300049571 | Ga0501034_0200129 | Ga0501034_0200129_1095_1421 | 108 |
| 215 | 3300049571 | Ga0501034_1347132 | Ga0501034_1347132_25_351 | 108 |
| 216 | 3300049572 | Ga0501036_1556133 | Ga0501036_1556133_195_521 | 108 |
| 217 | 3300049574 | Ga0501038_1355369 | Ga0501038_1355369_34_360 | 108 |
| 218 | 3300049575 | Ga0501039_0256164 | Ga0501039_0256164_943_1269 | 108 |
| 219 | 3300049581 | Ga0501047_0431403 | Ga0501047_0431403_396_722 | 108 |
| 220 | 3300049586 | Ga0501070_0039383 | Ga0501070_0039383_3083_3409 | 108 |
| 221 | 3300049586 | Ga0501070_0074393 | Ga0501070_0074393_1083_1409 | 108 |
| 222 | 3300049587 | Ga0501071_0470939 | Ga0501071_0470939_515_841 | 108 |
| 223 | 3300049587 | Ga0501071_0871566 | Ga0501071_0871566_45_371 | 108 |
| 224 | 3300049588 | Ga0501072_0342077 | Ga0501072_0342077_734_1060 | 108 |
| 225 | 3300049589 | Ga0501073_0694278 | Ga0501073_0694278_239_565 | 108 |
| 226 | 3300049589 | Ga0501073_1182847 | Ga0501073_1182847_10_336 | 108 |
| 227 | 3300049592 | Ga0501076_1021038 | Ga0501076_1021038_123_452 | 108 |
| 228 | 3300049593 | Ga0501077_0125296 | Ga0501077_0125296_917_1246 | 108 |
| 229 | 3300049744 | Ga0501083_0081241 | Ga0501083_0081241_451_777 | 108 |
| 230 | 3300049822 | Ga0501035_0070173 | Ga0501035_0070173_1059_1385 | 108 |
| 231 | 3300049823 | Ga0501044_0376794 | Ga0501044_0376794_586_912 | 108 |
| 232 | 3300049824 | Ga0501045_0285736 | Ga0501045_0285736_206_532 | 108 |
| 233 | 3300050489 | nmdc:mga03683_164868_c1 | nmdc:mga03683_164868_c1_192_518 | 108 |
| 234 | 3300050489 | nmdc:mga03683_89974_c1 | nmdc:mga03683_89974_c1_333_659 | 108 |
| 235 | 3300050490 | nmdc:mga03n38_233849_c1 | nmdc:mga03n38_233849_c1_338_664 | 108 |
| 236 | 3300050491 | nmdc:mga00v17_361327_c1 | nmdc:mga00v17_361327_c1_405_731 | 108 |
| 237 | 3300050492 | nmdc:mga0yw44_1074059_c1 | nmdc:mga0yw44_1074059_c1_17_343 | 108 |
| 238 | 3300050493 | nmdc:mga0k408_12326_c1 | nmdc:mga0k408_12326_c1_4332_4658 | 108 |
| 239 | 3300050493 | nmdc:mga0k408_27719_c1 | nmdc:mga0k408_27719_c1_2235_2657 | 108 |
| 240 | 3300050494 | nmdc:mga06z11_791703_c1 | nmdc:mga06z11_791703_c1_232_558 | 108 |
| 241 | 3300050494 | nmdc:mga06z11_986977_c1 | nmdc:mga06z11_986977_c1_129_455 | 108 |
| 242 | 3300050514 | nmdc:mga08x19_641904_c1 | nmdc:mga08x19_641904_c1_340_666 | 108 |
| 243 | 3300060344 | Ga0587071_161660 | Ga0587071_161660_193_519 | 108 |
| 244 | 3300060353 | Ga0501082_0325216 | Ga0501082_0325216_876_1202 | 108 |
| 245 | 3300001979 | JGI24740J21852_10007389 | JGI24740J21852_100073891 | 110 |
| 246 | 3300001989 | JGI24739J22299_10023465 | JGI24739J22299_100234652 | 110 |
| 247 | 3300002067 | JGI24735J21928_10022222 | JGI24735J21928_100222224 | 110 |
| 248 | 3300002075 | JGI24738J21930_10006014 | JGI24738J21930_100060143 | 110 |
| 249 | 3300005327 | Ga0070658_10060852 | Ga0070658_100608521 | 110 |
| 250 | 3300005337 | Ga0070682_100698746 | Ga0070682_1006987461 | 110 |
| 251 | 3300005339 | Ga0070660_100106851 | Ga0070660_1001068513 | 110 |
| 252 | 3300005344 | Ga0070661_100172820 | Ga0070661_1001728202 | 110 |
| 253 | 3300005366 | Ga0070659_100036271 | Ga0070659_1000362711 | 110 |
| 254 | 3300005457 | Ga0070662_100107313 | Ga0070662_1001073132 | 110 |
| 255 | 3300005535 | Ga0070684_100122945 | Ga0070684_1001229452 | 110 |
| 256 | 3300005546 | Ga0070696_100507873 | Ga0070696_1005078732 | 110 |
| 257 | 3300005564 | Ga0070664_100044596 | Ga0070664_1000445962 | 110 |
| 258 | 3300005834 | Ga0068851_10255873 | Ga0068851_102558732 | 110 |
| 259 | 3300009174 | Ga0105241_10347540 | Ga0105241_103475402 | 110 |
| 260 | 3300009551 | Ga0105238_10251818 | Ga0105238_102518182 | 110 |
| 261 | 3300013100 | Ga0157373_10127175 | Ga0157373_101271752 | 110 |
| 262 | 3300013102 | Ga0157371_10354302 | Ga0157371_103543022 | 110 |
| 263 | 3300013105 | Ga0157369_10151475 | Ga0157369_101514754 | 110 |
| 264 | 3300013307 | Ga0157372_10052537 | Ga0157372_100525374 | 110 |
| 265 | 3300025321 | Ga0207656_10005388 | Ga0207656_100053882 | 110 |
| 266 | 3300025904 | Ga0207647_10003347 | Ga0207647_100033474 | 110 |
| 267 | 3300025909 | Ga0207705_10025425 | Ga0207705_100254254 | 110 |
| 268 | 3300025911 | Ga0207654_10001932 | Ga0207654_100019326 | 110 |
| 269 | 3300025911 | Ga0207654_10227444 | Ga0207654_102274442 | 110 |
| 270 | 3300025913 | Ga0207695_10007515 | Ga0207695_100075154 | 110 |
| 271 | 3300025914 | Ga0207671_10001159 | Ga0207671_1000115921 | 110 |
| 272 | 3300025919 | Ga0207657_10014888 | Ga0207657_100148883 | 110 |
| 273 | 3300025924 | Ga0207694_10129467 | Ga0207694_101294671 | 110 |
| 274 | 3300025932 | Ga0207690_10138798 | Ga0207690_101387983 | 110 |
| 275 | 3300025949 | Ga0207667_10028843 | Ga0207667_100288435 | 110 |
| 276 | 3300026041 | Ga0207639_10037574 | Ga0207639_100375742 | 110 |
| 277 | 3300026041 | Ga0207639_10901847 | Ga0207639_109018471 | 110 |
| 278 | 3300026067 | Ga0207678_10043961 | Ga0207678_100439611 | 110 |
| 279 | 3300026078 | Ga0207702_10005873 | Ga0207702_100058732 | 110 |
| 280 | 3300026142 | Ga0207698_10077171 | Ga0207698_100771712 | 110 |
| 281 | 3300026142 | Ga0207698_10173952 | Ga0207698_101739522 | 110 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vqy-assembly1.cif.gz_C | crystal structure of a nipsnap family protein (atu5224) from agrobacterium tumefaciens str. c58 at 2.40 a resolution | 0.9098 | 2 | 107 |
| 5ixu-assembly1.cif.gz_A | crystal structure of an uncharacterized nipsnap domain protein from burkholderia xenovorans | 0.9092 | 1 | 104 |
| 5k9f-assembly1.cif.gz_A | crystal structure of a nipsnap domain protein from burkholderia xenovorans | 0.9086 | 1 | 107 |
| 5kak-assembly1.cif.gz_E | crystal structure of an uncharacterized nipsnap-like domain protein from burkholderia xenovorans | 0.9015 | 2 | 104 |
| 5k9f-assembly1.cif.gz_A | crystal structure of a nipsnap domain protein from burkholderia xenovorans | 0.9005 | 1 | 107 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ixuA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9093 | 1 | 104 | 3.30.70.100 |
| 5k9fA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9086 | 1 | 107 | 3.30.70.100 |
| 5kakE00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9015 | 2 | 104 | 3.30.70.100 |
| 5k9fA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9005 | 1 | 107 | 3.30.70.100 |
| 1vqyA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8879 | 1 | 107 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S2DZA0-F1-model_v4 | deleted | 0.9914 | 1 | 92 |
|
| AF-A0A444IJ71-F1-model_v4 | NIPSNAP family protein | 0.9911 | 1 | 104 |
|
| AF-A0A2S6MR02-F1-model_v4 | NIPSNAP family protein | 0.9904 | 1 | 106 |
|
| AF-A0A831Y7A0-F1-model_v4 | NIPSNAP family protein | 0.9902 | 1 | 104 |
|
| AF-A0A418V2S2-F1-model_v4 | NIPSNAP family protein | 0.9867 | 1 | 107 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar