F384586

General Info

Members Datasets Scaffolds Average Seq Length
281 197 281 108

Family's Representative Sequence

Representative Sequence 3300049593|Ga0501077_0125296|Ga0501077_0125296_917_1246
Length 109
Sequence MLHELRIYRCLPGRLPALNKRFETITLKLWEKHGIRQVAFWTVEIGGSSNTELYYLLEWENLAEREQRWNAFQSDPEWIAKRAETEKDGPILREIANLILKPTSYSKLR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
86 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
164 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
190 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.41
Nodule 0
Rhizoplane 0
Rhizosphere 82.56
Stem 0
Stem Tuber 0
Unclassified 11.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007389 3300001979 Bacteria 4470
2 JGI24739J22299_10023465 3300001989 Unclassified 2181
3 JGI24739J22299_10178351 3300001989 Bacteria 625
4 JGI24735J21928_10022222 3300002067 Bacteria 1933
5 JGI24738J21930_10006014 3300002075 Bacteria 2877
6 JGI25151J46595_10000474 3300003187 Bacteria 38089
7 JGI25153J46596_10040089 3300003215 Bacteria 1456
8 rootL2_10240124 3300003322 Unclassified 1037
9 rootH1_10244251 3300003323 Bacteria 1056
10 Ga0070658_10022923 3300005327 Bacteria 5012
11 Ga0070658_10060852 3300005327 Bacteria 3076
12 Ga0070676_10100708 3300005328 Bacteria 1784
13 Ga0070690_100000486 3300005330 Bacteria 19952
14 Ga0068869_100002903 3300005334 Bacteria 10409
15 Ga0070680_100055708 3300005336 Bacteria 3231
16 Ga0070680_100206749 3300005336 Bacteria 1656
17 Ga0070682_100029880 3300005337 Bacteria 3285
18 Ga0070682_100698746 3300005337 Unclassified 813
19 Ga0068868_100309179 3300005338 Bacteria 1344
20 Ga0070660_100106851 3300005339 Unclassified 2223
21 Ga0070660_100417961 3300005339 Bacteria 1110
22 Ga0070689_100026759 3300005340 Bacteria 4344
23 Ga0070691_10014865 3300005341 Bacteria 3574
24 Ga0070661_100172820 3300005344 Bacteria 1641
25 Ga0070661_100733553 3300005344 Bacteria 807
26 Ga0070692_10021021 3300005345 Bacteria 3172
27 Ga0070692_10051305 3300005345 Bacteria 2145
28 Ga0070674_101825404 3300005356 Unclassified 551
29 Ga0070673_102409340 3300005364 Unclassified 500
30 Ga0070688_100024186 3300005365 Bacteria 3580
31 Ga0070659_100036271 3300005366 Bacteria 3843
32 Ga0070659_101797155 3300005366 Bacteria 549
33 Ga0070709_10138967 3300005434 Bacteria 1667
34 Ga0070714_100202869 3300005435 Bacteria 1815
35 Ga0070713_100125662 3300005436 Bacteria 2255
36 Ga0070713_100571696 3300005436 Bacteria 1072
37 Ga0070710_10165451 3300005437 Bacteria 1374
38 Ga0070710_11127810 3300005437 Unclassified 577
39 Ga0070701_10000955 3300005438 Bacteria 10480
40 Ga0070711_100274911 3300005439 Bacteria 1330
41 Ga0070705_100164106 3300005440 Bacteria 1488
42 Ga0070700_100000199 3300005441 Bacteria 34018
43 Ga0070700_100288810 3300005441 Bacteria 1192
44 Ga0070694_100005329 3300005444 Bacteria 7779
45 Ga0070678_100005618 3300005456 Bacteria 7280
46 Ga0070662_100107313 3300005457 Unclassified 2122
47 Ga0070681_10090705 3300005458 Bacteria 3006
48 Ga0070681_10333284 3300005458 Bacteria 1427
49 Ga0070681_10876934 3300005458 Bacteria 815
50 Ga0068867_100108372 3300005459 Bacteria 2130
51 Ga0068867_100563869 3300005459 Bacteria 988
52 Ga0070685_10021973 3300005466 Bacteria 3472
53 Ga0070698_100434274 3300005471 Bacteria 1248
54 Ga0070679_100137494 3300005530 Bacteria 2424
55 Ga0070679_100203067 3300005530 Bacteria 1947
56 Ga0070684_100122945 3300005535 Bacteria 2336
57 Ga0070686_100006610 3300005544 Bacteria 6453
58 Ga0070695_100032293 3300005545 Bacteria 3272
59 Ga0070696_100189531 3300005546 Bacteria 1530
60 Ga0070696_100507873 3300005546 Bacteria 960
61 Ga0070696_100528673 3300005546 Bacteria 942
62 Ga0070693_100010995 3300005547 Bacteria 4549
63 Ga0070704_100083557 3300005549 Bacteria 2358
64 Ga0068855_100086138 3300005563 Bacteria 3633
65 Ga0070664_100044596 3300005564 Bacteria 3744
66 Ga0068854_100026339 3300005578 Bacteria 3996
67 Ga0070702_100000107 3300005615 Bacteria 24776
68 Ga0068852_101462377 3300005616 Bacteria 706
69 Ga0068859_100018985 3300005617 Bacteria 6905
70 Ga0068866_10000721 3300005718 Bacteria 15007
71 Ga0068861_100003333 3300005719 Bacteria 10631
72 Ga0068851_10255873 3300005834 Bacteria 994
73 Ga0068870_10001416 3300005840 Bacteria 9692
74 Ga0068858_100009133 3300005842 Bacteria 9478
75 Ga0068860_100086645 3300005843 Bacteria 2981
76 Ga0068862_100009109 3300005844 Bacteria 8218
77 Ga0081540_1004167 3300005983 Bacteria 11127
78 Ga0070717_10718549 3300006028 Bacteria 908
79 Ga0075365_10488930 3300006038 Bacteria 870
80 Ga0075364_10652161 3300006051 Bacteria 719
81 Ga0070712_100222365 3300006175 Bacteria 1495
82 Ga0070712_101547165 3300006175 Bacteria 580
83 Ga0075367_10561809 3300006178 Bacteria 725
84 Ga0075366_10016005 3300006195 Bacteria 4306
85 Ga0075366_10051367 3300006195 Bacteria 2449
86 Ga0097621_100047379 3300006237 Bacteria 3483
87 Ga0068871_100003553 3300006358 Bacteria 10731
88 Ga0068871_101704412 3300006358 Bacteria 598
89 Ga0075429_101491688 3300006880 Unclassified 588
90 Ga0068865_100000840 3300006881 Bacteria 17335
91 Ga0068865_100096968 3300006881 Bacteria 2151
92 Ga0068865_100997704 3300006881 Unclassified 733
93 Ga0075436_100617190 3300006914 Bacteria 800
94 Ga0097620_100018985 3300006931 Bacteria 6905
95 Ga0099794_10198235 3300007265 Unclassified 1028
96 Ga0099794_10348317 3300007265 Bacteria 770
97 Ga0099795_10246315 3300007788 Unclassified 769
98 Ga0105250_10303551 3300009092 Unclassified 691
99 Ga0105240_10014843 3300009093 Bacteria 10619
100 Ga0105245_10010542 3300009098 Bacteria 8042
101 Ga0105247_10173446 3300009101 Bacteria 1435
102 Ga0105243_10017398 3300009148 Bacteria 5434
103 Ga0105243_10074168 3300009148 Bacteria 2759
104 Ga0105241_10347540 3300009174 Bacteria 1287
105 Ga0105241_10886661 3300009174 Bacteria 827
106 Ga0105242_10006095 3300009176 Bacteria 9294
107 Ga0105248_10322132 3300009177 Bacteria 1741
108 Ga0105238_10251818 3300009551 Bacteria 1745
109 Ga0105238_11032817 3300009551 Bacteria 843
110 Ga0105249_10006422 3300009553 Bacteria 10221
111 Ga0105033_123656 3300009986 Unclassified 563
112 Ga0105035_100626 3300009988 Bacteria 2201
113 Ga0157373_10127175 3300013100 Bacteria 1792
114 Ga0157371_10079482 3300013102 Bacteria 2323
115 Ga0157371_10354302 3300013102 Unclassified 1069
116 Ga0157369_10151475 3300013105 Bacteria 2451
117 Ga0157369_10212694 3300013105 Bacteria 2026
118 Ga0157378_10004190 3300013297 Bacteria 12724
119 Ga0157378_10508517 3300013297 Bacteria 1204
120 Ga0157378_12275640 3300013297 Unclassified 593
121 Ga0163162_10045892 3300013306 Bacteria 4379
122 Ga0157372_10052537 3300013307 Bacteria 4538
123 Ga0157375_10044743 3300013308 Bacteria 4304
124 Ga0157515_115462 3300013875 Bacteria 521
125 Ga0157380_10005168 3300014326 Bacteria 9125
126 Ga0157380_10095321 3300014326 Bacteria 2465
127 Ga0157379_10024471 3300014968 Bacteria 5360
128 Ga0213873_10052172 3300021358 Bacteria 1086
129 Ga0213872_10125962 3300021361 Bacteria 1131
130 Ga0213874_10016514 3300021377 Bacteria 1966
131 Ga0213876_10004601 3300021384 Bacteria 7691
132 Ga0213876_10095903 3300021384 Bacteria 1571
133 Ga0213876_10105973 3300021384 Bacteria 1492
134 Ga0213876_10632804 3300021384 Bacteria 569
135 Ga0213875_10001344 3300021388 Bacteria 16189
136 Ga0213875_10004429 3300021388 Bacteria 7714
137 Ga0213875_10084830 3300021388 Bacteria 1478
138 Ga0213875_10095590 3300021388 Bacteria 1385
139 Ga0209025_1000582 3300025294 Bacteria 66224
140 Ga0209758_1011019 3300025297 Bacteria 5300
141 Ga0207656_10005388 3300025321 Bacteria 4519
142 Ga0207692_11156727 3300025898 Bacteria 513
143 Ga0207642_10004977 3300025899 Bacteria 4307
144 Ga0207647_10003347 3300025904 Bacteria 12021
145 Ga0207699_10098764 3300025906 Bacteria 1848
146 Ga0207699_10418011 3300025906 Bacteria 957
147 Ga0207645_10118737 3300025907 Unclassified 1716
148 Ga0207643_10041218 3300025908 Bacteria 2601
149 Ga0207705_10025425 3300025909 Bacteria 4227
150 Ga0207654_10001932 3300025911 Bacteria 10735
151 Ga0207654_10227444 3300025911 Unclassified 1241
152 Ga0207707_10018787 3300025912 Bacteria 6028
153 Ga0207695_10007515 3300025913 Bacteria 13825
154 Ga0207695_10189308 3300025913 Bacteria 1976
155 Ga0207671_10001159 3300025914 Bacteria 31442
156 Ga0207693_10014010 3300025915 Bacteria 6456
157 Ga0207693_10154325 3300025915 Bacteria 1806
158 Ga0207663_10046628 3300025916 Bacteria 2671
159 Ga0207660_10117726 3300025917 Bacteria 2008
160 Ga0207660_10422477 3300025917 Bacteria 1075
161 Ga0207660_10663319 3300025917 Bacteria 850
162 Ga0207660_11551821 3300025917 Bacteria 534
163 Ga0207657_10014888 3300025919 Bacteria 7566
164 Ga0207657_10320180 3300025919 Bacteria 1226
165 Ga0207649_10972974 3300025920 Bacteria 667
166 Ga0207652_10037367 3300025921 Bacteria 4110
167 Ga0207652_10651104 3300025921 Unclassified 942
168 Ga0207694_10129467 3300025924 Bacteria 2022
169 Ga0207687_10016734 3300025927 Bacteria 4820
170 Ga0207700_10233260 3300025928 Bacteria 1565
171 Ga0207664_10405248 3300025929 Bacteria 1213
172 Ga0207664_10693720 3300025929 Bacteria 915
173 Ga0207690_10138798 3300025932 Unclassified 1788
174 Ga0207690_10239436 3300025932 Bacteria 1397
175 Ga0207686_10000279 3300025934 Bacteria 38089
176 Ga0207686_10026085 3300025934 Bacteria 3407
177 Ga0207709_10124359 3300025935 Bacteria 1747
178 Ga0207709_10157454 3300025935 Bacteria 1580
179 Ga0207670_10004023 3300025936 Bacteria 7858
180 Ga0207669_10029952 3300025937 Bacteria 3018
181 Ga0207704_10003852 3300025938 Bacteria 6818
182 Ga0207665_10294454 3300025939 Bacteria 1211
183 Ga0207711_10400780 3300025941 Bacteria 1275
184 Ga0207689_10003072 3300025942 Bacteria 15383
185 Ga0207667_10028843 3300025949 Bacteria 6025
186 Ga0207667_10223285 3300025949 Bacteria 1930
187 Ga0207712_10019259 3300025961 Bacteria 4455
188 Ga0207640_10306590 3300025981 Bacteria 1258
189 Ga0207677_10244565 3300026023 Bacteria 1453
190 Ga0207703_10003484 3300026035 Bacteria 13172
191 Ga0207639_10037574 3300026041 Bacteria 3597
192 Ga0207639_10901847 3300026041 Unclassified 826
193 Ga0207678_10043961 3300026067 Bacteria 3865
194 Ga0207708_10000067 3300026075 Bacteria 83659
195 Ga0207708_10026036 3300026075 Bacteria 4425
196 Ga0207702_10005873 3300026078 Bacteria 10672
197 Ga0207702_10170085 3300026078 Bacteria 1997
198 Ga0207702_11519068 3300026078 Bacteria 663
199 Ga0207648_10000232 3300026089 Bacteria 59568
200 Ga0207648_11232617 3300026089 Bacteria 703
201 Ga0207675_100000258 3300026118 Bacteria 50669
202 Ga0207683_10024478 3300026121 Bacteria 5201
203 Ga0207698_10077171 3300026142 Bacteria 2670
204 Ga0207698_10173952 3300026142 Unclassified 1899
205 Ga0207698_10742811 3300026142 Bacteria 979
206 Ga0268265_10085033 3300028380 Bacteria 2509
207 Ga0268264_10009377 3300028381 Bacteria 8102
208 Ga0265325_10000821 3300031241 Bacteria 22542
209 Ga0265313_10016125 3300031595 Bacteria 4312
210 Ga0307410_11284372 3300031852 Bacteria 640
211 Ga0307407_10749952 3300031903 Bacteria 739
212 Ga0373937_1443962 3300036401 Bacteria 636
213 Ga0395900_0808479 3300037418 Bacteria 865
214 Ga0395905_0069619 3300037471 Bacteria 3296
215 Ga0436364_0177728 3300037853 Bacteria 960
216 Ga0436364_0197130 3300037853 Bacteria 17743
217 Ga0436364_0461387 3300037853 Bacteria 1074
218 Ga0436364_0617972 3300037853 Bacteria 7054
219 Ga0436364_0740264 3300037853 Bacteria 4806
220 Ga0436364_1155216 3300037853 Unclassified 506
221 Ga0395901_1251538 3300038443 Bacteria 706
222 Ga0436365_0306156 3300039437 Bacteria 1100
223 Ga0436365_0364034 3300039437 Bacteria 67701
224 Ga0436365_0773905 3300039437 Bacteria 4279
225 Ga0436365_1078535 3300039437 Bacteria 2251
226 Ga0436365_1140355 3300039437 Bacteria 554
227 Ga0436365_1231871 3300039437 Bacteria 735
228 Ga0436365_1424493 3300039437 Bacteria 16000
229 Ga0436365_1651533 3300039437 Bacteria 1401
230 Ga0436360_0929109 3300039438 Unclassified 522
231 Ga0436361_0314021 3300039447 Bacteria 2862
232 Ga0436363_0145876 3300039450 Bacteria 588
233 Ga0436363_0239262 3300039450 Bacteria 9304
234 Ga0436363_0880288 3300039450 Bacteria 1128
235 Ga0436363_0922216 3300039450 Bacteria 4051
236 Ga0436362_0104926 3300039453 Bacteria 807
237 Ga0436362_0362206 3300039453 Bacteria 4670
238 Ga0451839_0187830 3300041496 Unclassified 542
239 Ga0466965_0357591 3300044683 Bacteria 801
240 Ga0466963_0324048 3300044694 Bacteria 1084
241 Ga0466960_0029446 3300044901 Bacteria 2520
242 Ga0466960_0068014 3300044901 Bacteria 1766
243 Ga0466960_0526391 3300044901 Bacteria 695
244 Ga0466958_0184625 3300045836 Bacteria 1324
245 Ga0495610_0063777 3300046512 Bacteria 1743
246 Ga0495587_0014893 3300046536 Bacteria 4865
247 Ga0495686_0355705 3300047472 Unclassified 795
248 Ga0496121_0395853 3300048924 Bacteria 906
249 Ga0501032_0079530 3300049569 Unclassified 2183
250 Ga0501034_0103020 3300049571 Bacteria 2847
251 Ga0501034_0200129 3300049571 Archaea 1956
252 Ga0501034_1347132 3300049571 Unclassified 590
253 Ga0501036_1556133 3300049572 Archaea 534
254 Ga0501038_1355369 3300049574 Bacteria 512
255 Ga0501039_0256164 3300049575 Archaea 1376
256 Ga0501047_0431403 3300049581 Archaea 1149
257 Ga0501070_0039383 3300049586 Bacteria 3943
258 Ga0501070_0074393 3300049586 Bacteria 2812
259 Ga0501071_0470939 3300049587 Bacteria 962
260 Ga0501071_0871566 3300049587 Unclassified 694
261 Ga0501072_0342077 3300049588 Unclassified 1188
262 Ga0501073_0694278 3300049589 Bacteria 702
263 Ga0501073_1182847 3300049589 Unclassified 525
264 Ga0501076_1021038 3300049592 Bacteria 681
265 Ga0501077_0125296 3300049593 Bacteria 1628
266 Ga0501083_0081241 3300049744 Bacteria 2149
267 Ga0501035_0070173 3300049822 Bacteria 3104
268 Ga0501044_0376794 3300049823 Bacteria 1335
269 Ga0501045_0285736 3300049824 Bacteria 1228
270 nmdc:mga03683_164868_c1 3300050489 Bacteria 1005
271 nmdc:mga03683_89974_c1 3300050489 Bacteria 1337
272 nmdc:mga03n38_233849_c1 3300050490 Bacteria 964
273 nmdc:mga00v17_361327_c1 3300050491 Bacteria 944
274 nmdc:mga0yw44_1074059_c1 3300050492 Bacteria 544
275 nmdc:mga0k408_12326_c1 3300050493 Bacteria 4671
276 nmdc:mga0k408_27719_c1 3300050493 Bacteria 3218
277 nmdc:mga06z11_791703_c1 3300050494 Bacteria 578
278 nmdc:mga06z11_986977_c1 3300050494 Bacteria 513
279 nmdc:mga08x19_641904_c1 3300050514 Bacteria 753
280 Ga0587071_161660 3300060344 Bacteria 564
281 Ga0501082_0325216 3300060353 Bacteria 1340

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300001989 JGI24739J22299_10178351 JGI24739J22299_101783511 108
2 3300003187 JGI25151J46595_10000474 JGI25151J46595_1000047423 108
3 3300003215 JGI25153J46596_10040089 JGI25153J46596_100400892 108
4 3300003322 rootL2_10240124 rootL2_102401242 108
5 3300003323 rootH1_10244251 rootH1_102442511 108
6 3300005327 Ga0070658_10022923 Ga0070658_100229232 108
7 3300005328 Ga0070676_10100708 Ga0070676_101007083 108
8 3300005330 Ga0070690_100000486 Ga0070690_10000048620 108
9 3300005334 Ga0068869_100002903 Ga0068869_1000029038 108
10 3300005336 Ga0070680_100055708 Ga0070680_1000557084 108
11 3300005336 Ga0070680_100206749 Ga0070680_1002067492 108
12 3300005337 Ga0070682_100029880 Ga0070682_1000298804 108
13 3300005338 Ga0068868_100309179 Ga0068868_1003091792 108
14 3300005339 Ga0070660_100417961 Ga0070660_1004179613 108
15 3300005340 Ga0070689_100026759 Ga0070689_1000267594 108
16 3300005341 Ga0070691_10014865 Ga0070691_100148652 108
17 3300005344 Ga0070661_100733553 Ga0070661_1007335531 108
18 3300005345 Ga0070692_10021021 Ga0070692_100210212 108
19 3300005345 Ga0070692_10051305 Ga0070692_100513051 108
20 3300005356 Ga0070674_101825404 Ga0070674_1018254041 108
21 3300005364 Ga0070673_102409340 Ga0070673_1024093401 108
22 3300005365 Ga0070688_100024186 Ga0070688_1000241862 108
23 3300005366 Ga0070659_101797155 Ga0070659_1017971551 108
24 3300005434 Ga0070709_10138967 Ga0070709_101389672 108
25 3300005435 Ga0070714_100202869 Ga0070714_1002028693 108
26 3300005436 Ga0070713_100125662 Ga0070713_1001256623 108
27 3300005436 Ga0070713_100571696 Ga0070713_1005716961 108
28 3300005437 Ga0070710_10165451 Ga0070710_101654513 108
29 3300005437 Ga0070710_11127810 Ga0070710_111278102 108
30 3300005438 Ga0070701_10000955 Ga0070701_100009552 108
31 3300005439 Ga0070711_100274911 Ga0070711_1002749111 108
32 3300005440 Ga0070705_100164106 Ga0070705_1001641061 108
33 3300005441 Ga0070700_100000199 Ga0070700_10000019912 108
34 3300005441 Ga0070700_100288810 Ga0070700_1002888101 108
35 3300005444 Ga0070694_100005329 Ga0070694_1000053298 108
36 3300005456 Ga0070678_100005618 Ga0070678_1000056186 108
37 3300005458 Ga0070681_10090705 Ga0070681_100907054 108
38 3300005458 Ga0070681_10333284 Ga0070681_103332842 108
39 3300005458 Ga0070681_10876934 Ga0070681_108769342 108
40 3300005459 Ga0068867_100108372 Ga0068867_1001083723 108
41 3300005459 Ga0068867_100563869 Ga0068867_1005638691 108
42 3300005466 Ga0070685_10021973 Ga0070685_100219733 108
43 3300005471 Ga0070698_100434274 Ga0070698_1004342743 108
44 3300005530 Ga0070679_100137494 Ga0070679_1001374944 108
45 3300005530 Ga0070679_100203067 Ga0070679_1002030672 108
46 3300005544 Ga0070686_100006610 Ga0070686_1000066106 108
47 3300005545 Ga0070695_100032293 Ga0070695_1000322934 108
48 3300005546 Ga0070696_100189531 Ga0070696_1001895312 108
49 3300005546 Ga0070696_100528673 Ga0070696_1005286732 108
50 3300005547 Ga0070693_100010995 Ga0070693_1000109953 108
51 3300005549 Ga0070704_100083557 Ga0070704_1000835574 108
52 3300005563 Ga0068855_100086138 Ga0068855_1000861383 108
53 3300005578 Ga0068854_100026339 Ga0068854_1000263395 108
54 3300005615 Ga0070702_100000107 Ga0070702_10000010712 108
55 3300005616 Ga0068852_101462377 Ga0068852_1014623771 108
56 3300005617 Ga0068859_100018985 Ga0068859_1000189856 108
57 3300005718 Ga0068866_10000721 Ga0068866_1000072115 108
58 3300005719 Ga0068861_100003333 Ga0068861_1000033332 108
59 3300005840 Ga0068870_10001416 Ga0068870_100014168 108
60 3300005842 Ga0068858_100009133 Ga0068858_1000091337 108
61 3300005843 Ga0068860_100086645 Ga0068860_1000866452 108
62 3300005844 Ga0068862_100009109 Ga0068862_10000910911 108
63 3300005983 Ga0081540_1004167 Ga0081540_10041677 108
64 3300006028 Ga0070717_10718549 Ga0070717_107185491 108
65 3300006038 Ga0075365_10488930 Ga0075365_104889302 108
66 3300006051 Ga0075364_10652161 Ga0075364_106521612 108
67 3300006175 Ga0070712_100222365 Ga0070712_1002223652 108
68 3300006175 Ga0070712_101547165 Ga0070712_1015471651 108
69 3300006178 Ga0075367_10561809 Ga0075367_105618092 108
70 3300006195 Ga0075366_10016005 Ga0075366_100160055 108
71 3300006195 Ga0075366_10051367 Ga0075366_100513674 108
72 3300006237 Ga0097621_100047379 Ga0097621_1000473795 108
73 3300006358 Ga0068871_100003553 Ga0068871_1000035532 108
74 3300006358 Ga0068871_101704412 Ga0068871_1017044122 108
75 3300006880 Ga0075429_101491688 Ga0075429_1014916881 108
76 3300006881 Ga0068865_100000840 Ga0068865_10000084010 108
77 3300006881 Ga0068865_100096968 Ga0068865_1000969682 108
78 3300006881 Ga0068865_100997704 Ga0068865_1009977042 108
79 3300006914 Ga0075436_100617190 Ga0075436_1006171902 108
80 3300006931 Ga0097620_100018985 Ga0097620_1000189854 108
81 3300007265 Ga0099794_10198235 Ga0099794_101982352 108
82 3300007265 Ga0099794_10348317 Ga0099794_103483172 108
83 3300007788 Ga0099795_10246315 Ga0099795_102463152 108
84 3300009092 Ga0105250_10303551 Ga0105250_103035511 108
85 3300009093 Ga0105240_10014843 Ga0105240_100148435 108
86 3300009098 Ga0105245_10010542 Ga0105245_100105425 108
87 3300009101 Ga0105247_10173446 Ga0105247_101734462 108
88 3300009148 Ga0105243_10017398 Ga0105243_100173983 108
89 3300009148 Ga0105243_10074168 Ga0105243_100741683 108
90 3300009174 Ga0105241_10886661 Ga0105241_108866611 108
91 3300009176 Ga0105242_10006095 Ga0105242_100060955 108
92 3300009177 Ga0105248_10322132 Ga0105248_103221322 108
93 3300009551 Ga0105238_11032817 Ga0105238_110328171 108
94 3300009553 Ga0105249_10006422 Ga0105249_100064226 108
95 3300009986 Ga0105033_123656 Ga0105033_1236561 108
96 3300009988 Ga0105035_100626 Ga0105035_1006262 108
97 3300013102 Ga0157371_10079482 Ga0157371_100794823 108
98 3300013105 Ga0157369_10212694 Ga0157369_102126942 108
99 3300013297 Ga0157378_10004190 Ga0157378_1000419012 108
100 3300013297 Ga0157378_10508517 Ga0157378_105085171 108
101 3300013297 Ga0157378_12275640 Ga0157378_122756402 108
102 3300013306 Ga0163162_10045892 Ga0163162_100458926 108
103 3300013308 Ga0157375_10044743 Ga0157375_100447433 108
104 3300013875 Ga0157515_115462 Ga0157515_1154621 108
105 3300014326 Ga0157380_10005168 Ga0157380_100051686 108
106 3300014326 Ga0157380_10095321 Ga0157380_100953213 108
107 3300014968 Ga0157379_10024471 Ga0157379_100244715 108
108 3300021358 Ga0213873_10052172 Ga0213873_100521722 108
109 3300021361 Ga0213872_10125962 Ga0213872_101259622 108
110 3300021377 Ga0213874_10016514 Ga0213874_100165142 108
111 3300021384 Ga0213876_10004601 Ga0213876_100046012 108
112 3300021384 Ga0213876_10095903 Ga0213876_100959032 108
113 3300021384 Ga0213876_10105973 Ga0213876_101059731 108
114 3300021384 Ga0213876_10632804 Ga0213876_106328041 108
115 3300021388 Ga0213875_10001344 Ga0213875_1000134412 108
116 3300021388 Ga0213875_10004429 Ga0213875_100044293 108
117 3300021388 Ga0213875_10084830 Ga0213875_100848302 108
118 3300021388 Ga0213875_10095590 Ga0213875_100955902 108
119 3300025294 Ga0209025_1000582 Ga0209025_100058234 108
120 3300025297 Ga0209758_1011019 Ga0209758_10110194 108
121 3300025898 Ga0207692_11156727 Ga0207692_111567271 108
122 3300025899 Ga0207642_10004977 Ga0207642_100049775 108
123 3300025906 Ga0207699_10098764 Ga0207699_100987642 108
124 3300025906 Ga0207699_10418011 Ga0207699_104180112 108
125 3300025907 Ga0207645_10118737 Ga0207645_101187371 108
126 3300025908 Ga0207643_10041218 Ga0207643_100412184 108
127 3300025912 Ga0207707_10018787 Ga0207707_100187873 108
128 3300025913 Ga0207695_10189308 Ga0207695_101893082 108
129 3300025915 Ga0207693_10014010 Ga0207693_100140102 108
130 3300025915 Ga0207693_10154325 Ga0207693_101543252 108
131 3300025916 Ga0207663_10046628 Ga0207663_100466282 108
132 3300025917 Ga0207660_10117726 Ga0207660_101177263 108
133 3300025917 Ga0207660_10422477 Ga0207660_104224772 108
134 3300025917 Ga0207660_10663319 Ga0207660_106633192 108
135 3300025917 Ga0207660_11551821 Ga0207660_115518212 108
136 3300025919 Ga0207657_10320180 Ga0207657_103201803 108
137 3300025920 Ga0207649_10972974 Ga0207649_109729741 108
138 3300025921 Ga0207652_10037367 Ga0207652_100373674 108
139 3300025921 Ga0207652_10651104 Ga0207652_106511042 108
140 3300025927 Ga0207687_10016734 Ga0207687_100167346 108
141 3300025928 Ga0207700_10233260 Ga0207700_102332603 108
142 3300025929 Ga0207664_10405248 Ga0207664_104052482 108
143 3300025929 Ga0207664_10693720 Ga0207664_106937202 108
144 3300025932 Ga0207690_10239436 Ga0207690_102394362 108
145 3300025934 Ga0207686_10000279 Ga0207686_100002797 108
146 3300025934 Ga0207686_10026085 Ga0207686_100260852 108
147 3300025935 Ga0207709_10124359 Ga0207709_101243592 108
148 3300025935 Ga0207709_10157454 Ga0207709_101574542 108
149 3300025936 Ga0207670_10004023 Ga0207670_100040235 108
150 3300025937 Ga0207669_10029952 Ga0207669_100299525 108
151 3300025938 Ga0207704_10003852 Ga0207704_100038524 108
152 3300025939 Ga0207665_10294454 Ga0207665_102944542 108
153 3300025941 Ga0207711_10400780 Ga0207711_104007802 108
154 3300025942 Ga0207689_10003072 Ga0207689_100030728 108
155 3300025949 Ga0207667_10223285 Ga0207667_102232853 108
156 3300025961 Ga0207712_10019259 Ga0207712_100192596 108
157 3300025981 Ga0207640_10306590 Ga0207640_103065903 108
158 3300026023 Ga0207677_10244565 Ga0207677_102445652 108
159 3300026035 Ga0207703_10003484 Ga0207703_1000348412 108
160 3300026075 Ga0207708_10000067 Ga0207708_1000006745 108
161 3300026075 Ga0207708_10026036 Ga0207708_100260362 108
162 3300026078 Ga0207702_10170085 Ga0207702_101700853 108
163 3300026078 Ga0207702_11519068 Ga0207702_115190681 108
164 3300026089 Ga0207648_10000232 Ga0207648_1000023242 108
165 3300026089 Ga0207648_11232617 Ga0207648_112326172 108
166 3300026118 Ga0207675_100000258 Ga0207675_10000025837 108
167 3300026121 Ga0207683_10024478 Ga0207683_100244786 108
168 3300026142 Ga0207698_10742811 Ga0207698_107428111 108
169 3300028380 Ga0268265_10085033 Ga0268265_100850332 108
170 3300028381 Ga0268264_10009377 Ga0268264_100093777 108
171 3300031241 Ga0265325_10000821 Ga0265325_1000082119 108
172 3300031595 Ga0265313_10016125 Ga0265313_100161253 108
173 3300031852 Ga0307410_11284372 Ga0307410_112843722 108
174 3300031903 Ga0307407_10749952 Ga0307407_107499522 108
175 3300036401 Ga0373937_1443962 Ga0373937_1443962_107_433 108
176 3300037418 Ga0395900_0808479 Ga0395900_0808479_210_536 108
177 3300037471 Ga0395905_0069619 Ga0395905_0069619_2529_2855 108
178 3300037853 Ga0436364_0177728 Ga0436364_0177728_36_362 108
179 3300037853 Ga0436364_0197130 Ga0436364_0197130_10223_10549 108
180 3300037853 Ga0436364_0461387 Ga0436364_0461387_661_987 108
181 3300037853 Ga0436364_0617972 Ga0436364_0617972_2719_3045 108
182 3300037853 Ga0436364_0740264 Ga0436364_0740264_1383_1709 108
183 3300037853 Ga0436364_1155216 Ga0436364_1155216_22_348 108
184 3300038443 Ga0395901_1251538 Ga0395901_1251538_37_363 108
185 3300039437 Ga0436365_0306156 Ga0436365_0306156_101_427 108
186 3300039437 Ga0436365_0364034 Ga0436365_0364034_64495_64821 108
187 3300039437 Ga0436365_0773905 Ga0436365_0773905_2277_2603 108
188 3300039437 Ga0436365_1078535 Ga0436365_1078535_1901_2227 108
189 3300039437 Ga0436365_1140355 Ga0436365_1140355_57_383 108
190 3300039437 Ga0436365_1231871 Ga0436365_1231871_151_477 108
191 3300039437 Ga0436365_1424493 Ga0436365_1424493_4879_5205 108
192 3300039437 Ga0436365_1651533 Ga0436365_1651533_879_1205 108
193 3300039438 Ga0436360_0929109 Ga0436360_0929109_100_426 108
194 3300039447 Ga0436361_0314021 Ga0436361_0314021_2325_2651 108
195 3300039450 Ga0436363_0145876 Ga0436363_0145876_51_377 108
196 3300039450 Ga0436363_0239262 Ga0436363_0239262_1648_1974 108
197 3300039450 Ga0436363_0880288 Ga0436363_0880288_413_739 108
198 3300039450 Ga0436363_0922216 Ga0436363_0922216_3146_3472 108
199 3300039453 Ga0436362_0104926 Ga0436362_0104926_309_635 108
200 3300039453 Ga0436362_0362206 Ga0436362_0362206_696_1022 108
201 3300041496 Ga0451839_0187830 Ga0451839_0187830_41_367 108
202 3300044683 Ga0466965_0357591 Ga0466965_0357591_444_770 108
203 3300044694 Ga0466963_0324048 Ga0466963_0324048_469_795 108
204 3300044901 Ga0466960_0029446 Ga0466960_0029446_1888_2214 108
205 3300044901 Ga0466960_0068014 Ga0466960_0068014_24_350 108
206 3300044901 Ga0466960_0526391 Ga0466960_0526391_288_671 108
207 3300045836 Ga0466958_0184625 Ga0466958_0184625_232_558 108
208 3300046512 Ga0495610_0063777 Ga0495610_0063777_1350_1676 108
209 3300046536 Ga0495587_0014893 Ga0495587_0014893_1469_1795 108
210 3300047472 Ga0495686_0355705 Ga0495686_0355705_274_600 108
211 3300048924 Ga0496121_0395853 Ga0496121_0395853_361_687 108
212 3300049569 Ga0501032_0079530 Ga0501032_0079530_1353_1679 108
213 3300049571 Ga0501034_0103020 Ga0501034_0103020_2441_2767 108
214 3300049571 Ga0501034_0200129 Ga0501034_0200129_1095_1421 108
215 3300049571 Ga0501034_1347132 Ga0501034_1347132_25_351 108
216 3300049572 Ga0501036_1556133 Ga0501036_1556133_195_521 108
217 3300049574 Ga0501038_1355369 Ga0501038_1355369_34_360 108
218 3300049575 Ga0501039_0256164 Ga0501039_0256164_943_1269 108
219 3300049581 Ga0501047_0431403 Ga0501047_0431403_396_722 108
220 3300049586 Ga0501070_0039383 Ga0501070_0039383_3083_3409 108
221 3300049586 Ga0501070_0074393 Ga0501070_0074393_1083_1409 108
222 3300049587 Ga0501071_0470939 Ga0501071_0470939_515_841 108
223 3300049587 Ga0501071_0871566 Ga0501071_0871566_45_371 108
224 3300049588 Ga0501072_0342077 Ga0501072_0342077_734_1060 108
225 3300049589 Ga0501073_0694278 Ga0501073_0694278_239_565 108
226 3300049589 Ga0501073_1182847 Ga0501073_1182847_10_336 108
227 3300049592 Ga0501076_1021038 Ga0501076_1021038_123_452 108
228 3300049593 Ga0501077_0125296 Ga0501077_0125296_917_1246 108
229 3300049744 Ga0501083_0081241 Ga0501083_0081241_451_777 108
230 3300049822 Ga0501035_0070173 Ga0501035_0070173_1059_1385 108
231 3300049823 Ga0501044_0376794 Ga0501044_0376794_586_912 108
232 3300049824 Ga0501045_0285736 Ga0501045_0285736_206_532 108
233 3300050489 nmdc:mga03683_164868_c1 nmdc:mga03683_164868_c1_192_518 108
234 3300050489 nmdc:mga03683_89974_c1 nmdc:mga03683_89974_c1_333_659 108
235 3300050490 nmdc:mga03n38_233849_c1 nmdc:mga03n38_233849_c1_338_664 108
236 3300050491 nmdc:mga00v17_361327_c1 nmdc:mga00v17_361327_c1_405_731 108
237 3300050492 nmdc:mga0yw44_1074059_c1 nmdc:mga0yw44_1074059_c1_17_343 108
238 3300050493 nmdc:mga0k408_12326_c1 nmdc:mga0k408_12326_c1_4332_4658 108
239 3300050493 nmdc:mga0k408_27719_c1 nmdc:mga0k408_27719_c1_2235_2657 108
240 3300050494 nmdc:mga06z11_791703_c1 nmdc:mga06z11_791703_c1_232_558 108
241 3300050494 nmdc:mga06z11_986977_c1 nmdc:mga06z11_986977_c1_129_455 108
242 3300050514 nmdc:mga08x19_641904_c1 nmdc:mga08x19_641904_c1_340_666 108
243 3300060344 Ga0587071_161660 Ga0587071_161660_193_519 108
244 3300060353 Ga0501082_0325216 Ga0501082_0325216_876_1202 108
245 3300001979 JGI24740J21852_10007389 JGI24740J21852_100073891 110
246 3300001989 JGI24739J22299_10023465 JGI24739J22299_100234652 110
247 3300002067 JGI24735J21928_10022222 JGI24735J21928_100222224 110
248 3300002075 JGI24738J21930_10006014 JGI24738J21930_100060143 110
249 3300005327 Ga0070658_10060852 Ga0070658_100608521 110
250 3300005337 Ga0070682_100698746 Ga0070682_1006987461 110
251 3300005339 Ga0070660_100106851 Ga0070660_1001068513 110
252 3300005344 Ga0070661_100172820 Ga0070661_1001728202 110
253 3300005366 Ga0070659_100036271 Ga0070659_1000362711 110
254 3300005457 Ga0070662_100107313 Ga0070662_1001073132 110
255 3300005535 Ga0070684_100122945 Ga0070684_1001229452 110
256 3300005546 Ga0070696_100507873 Ga0070696_1005078732 110
257 3300005564 Ga0070664_100044596 Ga0070664_1000445962 110
258 3300005834 Ga0068851_10255873 Ga0068851_102558732 110
259 3300009174 Ga0105241_10347540 Ga0105241_103475402 110
260 3300009551 Ga0105238_10251818 Ga0105238_102518182 110
261 3300013100 Ga0157373_10127175 Ga0157373_101271752 110
262 3300013102 Ga0157371_10354302 Ga0157371_103543022 110
263 3300013105 Ga0157369_10151475 Ga0157369_101514754 110
264 3300013307 Ga0157372_10052537 Ga0157372_100525374 110
265 3300025321 Ga0207656_10005388 Ga0207656_100053882 110
266 3300025904 Ga0207647_10003347 Ga0207647_100033474 110
267 3300025909 Ga0207705_10025425 Ga0207705_100254254 110
268 3300025911 Ga0207654_10001932 Ga0207654_100019326 110
269 3300025911 Ga0207654_10227444 Ga0207654_102274442 110
270 3300025913 Ga0207695_10007515 Ga0207695_100075154 110
271 3300025914 Ga0207671_10001159 Ga0207671_1000115921 110
272 3300025919 Ga0207657_10014888 Ga0207657_100148883 110
273 3300025924 Ga0207694_10129467 Ga0207694_101294671 110
274 3300025932 Ga0207690_10138798 Ga0207690_101387983 110
275 3300025949 Ga0207667_10028843 Ga0207667_100288435 110
276 3300026041 Ga0207639_10037574 Ga0207639_100375742 110
277 3300026041 Ga0207639_10901847 Ga0207639_109018471 110
278 3300026067 Ga0207678_10043961 Ga0207678_100439611 110
279 3300026078 Ga0207702_10005873 Ga0207702_100058732 110
280 3300026142 Ga0207698_10077171 Ga0207698_100771712 110
281 3300026142 Ga0207698_10173952 Ga0207698_101739522 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07978

NIPSNAP

NIPSNAP

3

107

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vqy-assembly1.cif.gz_C crystal structure of a nipsnap family protein (atu5224) from agrobacterium tumefaciens str. c58 at 2.40 a resolution 0.9098 2 107
5ixu-assembly1.cif.gz_A crystal structure of an uncharacterized nipsnap domain protein from burkholderia xenovorans 0.9092 1 104
5k9f-assembly1.cif.gz_A crystal structure of a nipsnap domain protein from burkholderia xenovorans 0.9086 1 107
5kak-assembly1.cif.gz_E crystal structure of an uncharacterized nipsnap-like domain protein from burkholderia xenovorans 0.9015 2 104
5k9f-assembly1.cif.gz_A crystal structure of a nipsnap domain protein from burkholderia xenovorans 0.9005 1 107
ID Description Score Start End Superfamily
5ixuA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9093 1 104 3.30.70.100
5k9fA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9086 1 107 3.30.70.100
5kakE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9015 2 104 3.30.70.100
5k9fA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9005 1 107 3.30.70.100
1vqyA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8879 1 107 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A3S2DZA0-F1-model_v4 deleted 0.9914 1 92
AF-A0A444IJ71-F1-model_v4 NIPSNAP family protein 0.9911 1 104
AF-A0A2S6MR02-F1-model_v4 NIPSNAP family protein 0.9904 1 106
AF-A0A831Y7A0-F1-model_v4 NIPSNAP family protein 0.9902 1 104
AF-A0A418V2S2-F1-model_v4 NIPSNAP family protein 0.9867 1 107

Feature Viewer

pLDDT pTM Quality
92.73 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map