F384693

General Info

Members Datasets Scaffolds Average Seq Length
282 188 564 219

Family's Representative Sequence

Representative Sequence 3300003775|Ga0055524_1000814|Ga0055524_100081410
Length 229
Sequence MQSVLFPLLAVVAGYLIGSLSFAVIVSRLMGLSDPRSYGSGNPGATNVLRSGNKAAAILTLVFDALKGYVPVLLVLKFGAPYGLEEGTAALVGLAAFIGHLWPVFFKFVGGKGVATAAGVLLALNPWLGLAVVFRYSSLASLSAAVAAPLLQMLVWDVGPELPAIALMSLLLVWRHAANIKKLMAGTESKLGQKAAPAAAAPAVKSHRHEQSREKRDHKSSHKPKQHSK

Samples

Sample ID Description Type Environment
1 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
51 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
61 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
63 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
64 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
104 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
108 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
122 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
123 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
124 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
125 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
131 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
132 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
133 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
136 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
137 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
138 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
139 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
140 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
141 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
142 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
159 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
161 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
164 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
165 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
166 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
167 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
168 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
169 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
170 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
171 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
172 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
173 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
180 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
181 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
182 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
183 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
184 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
185 2738541337 Pelomonas sp. BT06 Isolate Unclassified
186 2831864461 Roseateles noduli HZ7 Isolate Nodule
187 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
188 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.16
Metatranscriptomes 0.35
Isolates 2.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.21
Nodule 1.42
Rhizoplane 0.35
Rhizosphere 71.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055524_1000814 3300003775 Bacteria 20618
2 JGI25153J46596_10001470 3300003215 Bacteria 14062
3 JGI25153J46596_10003347 3300003215 Bacteria 9000
4 rootH1_10085146 3300003316 Bacteria 3004
5 rootL2_10001692 3300003322 Bacteria 21923
6 rootH1_10039187 3300003323 Bacteria 2451
7 rootH1_10065520 3300003323 Bacteria 3632
8 rootH1_10102888 3300003323 Bacteria 5163
9 Ga0055526_1000906 3300003771 Bacteria 22039
10 Ga0055524_1003915 3300003775 Bacteria 7054
11 Ga0055530_10025787 3300003791 Bacteria 1635
12 Ga0055531_10000168 3300003794 Bacteria 73798
13 Ga0055531_10001544 3300003794 Bacteria 16864
14 Ga0055531_10021052 3300003794 Bacteria 2547
15 Ga0055543_1005136 3300004625 Bacteria 3401
16 Ga0055543_1015394 3300004625 Bacteria 1473
17 Ga0065165_1000153 3300005262 Bacteria 120209
18 Ga0065165_1000569 3300005262 Bacteria 54781
19 Ga0070658_10092344 3300005327 Bacteria 2496
20 Ga0070670_100000939 3300005331 Bacteria 22858
21 Ga0070670_100013197 3300005331 Bacteria 7077
22 Ga0070670_100138578 3300005331 Bacteria 2103
23 Ga0070670_100155779 3300005331 Bacteria 1978
24 Ga0070670_100160020 3300005331 Bacteria 1951
25 Ga0070677_10010653 3300005333 Bacteria 3149
26 Ga0070682_100163667 3300005337 Bacteria 1539
27 Ga0070661_100171235 3300005344 Bacteria 1649
28 Ga0070669_100091062 3300005353 Bacteria 2287
29 Ga0070675_100022972 3300005354 Bacteria 4983
30 Ga0070675_100033069 3300005354 Bacteria 4190
31 Ga0070675_100360133 3300005354 Bacteria 1291
32 Ga0070671_100541039 3300005355 Bacteria 1004
33 Ga0070674_100218489 3300005356 Bacteria 1481
34 Ga0070673_100030704 3300005364 Bacteria 4026
35 Ga0070673_100035657 3300005364 Bacteria 3773
36 Ga0070659_100001171 3300005366 Bacteria 19137
37 Ga0070678_100075685 3300005456 Bacteria 2533
38 Ga0068867_100477425 3300005459 Bacteria 1067
39 Ga0068853_100091695 3300005539 Bacteria 2673
40 Ga0070672_100008536 3300005543 Bacteria 7018
41 Ga0070672_100095570 3300005543 Bacteria 2403
42 Ga0070672_100200747 3300005543 Bacteria 1668
43 Ga0070665_100021752 3300005548 Bacteria 6448
44 Ga0070665_100849293 3300005548 Bacteria 926
45 Ga0070664_100049271 3300005564 Bacteria 3562
46 Ga0070664_100408129 3300005564 Bacteria 1243
47 Ga0068857_100136538 3300005577 Bacteria 2214
48 Ga0068859_100149091 3300005617 Bacteria 2415
49 Ga0068864_100001313 3300005618 Bacteria 20690
50 Ga0068870_10160177 3300005840 Bacteria 1334
51 Ga0068870_10185708 3300005840 Bacteria 1251
52 Ga0068863_100120827 3300005841 Bacteria 2498
53 Ga0068863_100145143 3300005841 Bacteria 2269
54 Ga0075368_10097952 3300006042 Bacteria 1203
55 Ga0075363_100023888 3300006048 Bacteria 3103
56 Ga0075363_100070542 3300006048 Bacteria 1898
57 Ga0075362_10004339 3300006177 Bacteria 5080
58 Ga0075367_10153795 3300006178 Bacteria 1428
59 Ga0075366_10002041 3300006195 Bacteria 10246
60 Ga0075366_10002708 3300006195 Bacteria 9145
61 Ga0075370_10001548 3300006353 Bacteria 10068
62 Ga0075370_10002794 3300006353 Bacteria 8184
63 Ga0075370_10029590 3300006353 Bacteria 3051
64 Ga0068871_100010518 3300006358 Bacteria 6758
65 Ga0068865_100005385 3300006881 Bacteria 7754
66 Ga0068865_100114648 3300006881 Bacteria 1994
67 Ga0097620_100149095 3300006931 Bacteria 2415
68 Ga0099823_1000031 3300006944 Bacteria 69036
69 Ga0105240_10003836 3300009093 Bacteria 23255
70 Ga0105240_10078978 3300009093 Bacteria 4051
71 Ga0105243_10148861 3300009148 Bacteria 2006
72 Ga0105243_10462746 3300009148 Bacteria 1193
73 Ga0105242_10049100 3300009176 Bacteria 3433
74 Ga0105248_10128535 3300009177 Bacteria 2858
75 Ga0105237_10001634 3300009545 Bacteria 29121
76 Ga0105237_10006422 3300009545 Bacteria 13044
77 Ga0105238_10014859 3300009551 Bacteria 7877
78 Ga0105238_10094218 3300009551 Bacteria 2982
79 Ga0105239_10002435 3300010375 Bacteria 23714
80 Ga0157317_1000308 3300012475 Bacteria 1901
81 Ga0157319_1000016 3300012497 Bacteria 127256
82 Ga0157374_10415011 3300013296 Bacteria 1344
83 Ga0157374_10485696 3300013296 Bacteria 1239
84 Ga0163162_10473449 3300013306 Bacteria 1384
85 Ga0157375_10110571 3300013308 Bacteria 2845
86 Ga0163163_10478903 3300014325 Bacteria 1306
87 Ga0163163_10563467 3300014325 Bacteria 1202
88 Ga0157380_10202231 3300014326 Bacteria 1763
89 Ga0157379_10009506 3300014968 Bacteria 8467
90 Ga0157379_10159173 3300014968 Bacteria 2038
91 Ga0157376_10022790 3300014969 Bacteria 4889
92 Ga0163161_10004685 3300017792 Bacteria 9509
93 Ga0163161_10066139 3300017792 Bacteria 2639
94 Ga0213872_10000058 3300021361 Bacteria 100531
95 Ga0213872_10000150 3300021361 Bacteria 63730
96 Ga0213872_10022852 3300021361 Bacteria 2877
97 Ga0209563_100013 3300025230 Bacteria 941463
98 Ga0207425_1000332 3300025245 Bacteria 33095
99 Ga0209129_1000012 3300025258 Bacteria 541516
100 Ga0209673_1016267 3300025273 Bacteria 2790
101 Ga0209564_1000008 3300025295 Bacteria 953227
102 Ga0209564_1000022 3300025295 Bacteria 555109
103 Ga0209758_1000233 3300025297 Bacteria 116640
104 Ga0209758_1000708 3300025297 Bacteria 49463
105 Ga0209050_1002766 3300025298 Bacteria 14090
106 Ga0209050_1004633 3300025298 Bacteria 9174
107 Ga0209256_1000579 3300025299 Bacteria 52079
108 Ga0209256_1001555 3300025299 Bacteria 22789
109 Ga0209051_1002778 3300025303 Bacteria 12067
110 Ga0209051_1003056 3300025303 Bacteria 11318
111 Ga0209257_1000021 3300025304 Bacteria 771986
112 Ga0209257_1000984 3300025304 Bacteria 38671
113 Ga0209257_1004760 3300025304 Bacteria 10135
114 Ga0209257_1012593 3300025304 Bacteria 3887
115 Ga0207682_10006107 3300025893 Bacteria 4869
116 Ga0207645_10078670 3300025907 Bacteria 2113
117 Ga0207643_10170029 3300025908 Bacteria 1315
118 Ga0207705_10155090 3300025909 Bacteria 1718
119 Ga0207695_10020987 3300025913 Bacteria 7463
120 Ga0207649_10183800 3300025920 Bacteria 1465
121 Ga0207694_10004971 3300025924 Bacteria 10292
122 Ga0207650_10002396 3300025925 Bacteria 13054
123 Ga0207650_10004068 3300025925 Bacteria 9996
124 Ga0207650_10099095 3300025925 Bacteria 2240
125 Ga0207659_10020272 3300025926 Bacteria 4393
126 Ga0207659_10517821 3300025926 Bacteria 1011
127 Ga0207659_10564444 3300025926 Bacteria 968
128 Ga0207644_10420893 3300025931 Bacteria 1094
129 Ga0207690_10002213 3300025932 Bacteria 11851
130 Ga0207706_10066961 3300025933 Bacteria 3160
131 Ga0207686_10045969 3300025934 Bacteria 2689
132 Ga0207709_10296717 3300025935 Bacteria 1200
133 Ga0207669_10407031 3300025937 Bacteria 1067
134 Ga0207704_10295010 3300025938 Bacteria 1239
135 Ga0207691_10009020 3300025940 Bacteria 9565
136 Ga0207691_10127287 3300025940 Bacteria 2252
137 Ga0207691_10133089 3300025940 Bacteria 2195
138 Ga0207691_10243451 3300025940 Bacteria 1554
139 Ga0207711_10026741 3300025941 Bacteria 4843
140 Ga0207689_10086097 3300025942 Bacteria 2583
141 Ga0207689_10659618 3300025942 Bacteria 882
142 Ga0207679_10033418 3300025945 Bacteria 3619
143 Ga0207679_10306737 3300025945 Bacteria 1370
144 Ga0207651_10041808 3300025960 Bacteria 3045
145 Ga0207651_10123618 3300025960 Bacteria 1967
146 Ga0207640_10216789 3300025981 Bacteria 1462
147 Ga0207658_10525989 3300025986 Bacteria 1056
148 Ga0207677_10255727 3300026023 Bacteria 1425
149 Ga0207703_10294336 3300026035 Bacteria 1478
150 Ga0207639_10073981 3300026041 Bacteria 2673
151 Ga0207678_10166846 3300026067 Bacteria 1880
152 Ga0207648_10118292 3300026089 Bacteria 2329
153 Ga0207676_10012947 3300026095 Bacteria 5991
154 Ga0207676_10022460 3300026095 Bacteria 4641
155 Ga0207676_10807750 3300026095 Bacteria 915
156 Ga0207674_10071549 3300026116 Bacteria 3485
157 Ga0207675_100106248 3300026118 Bacteria 2647
158 Ga0207683_10017159 3300026121 Bacteria 6164
159 Ga0207683_10058726 3300026121 Bacteria 3378
160 Ga0207683_10606339 3300026121 Bacteria 1013
161 Ga0209389_1006709 3300027296 Bacteria 10042
162 Ga0209371_1024836 3300027312 Bacteria 1387
163 Ga0209813_10063674 3300027866 Bacteria 1183
164 Ga0268266_10036691 3300028379 Bacteria 4174
165 Ga0268266_10105872 3300028379 Bacteria 2486
166 Ga0265324_10000340 3300029957 Bacteria 34285
167 Ga0268256_1028259 3300030500 Bacteria 1387
168 Ga0265332_10013560 3300031238 Bacteria 3611
169 Ga0265331_10011355 3300031250 Bacteria 4882
170 Ga0265327_10000328 3300031251 Bacteria 90489
171 Ga0265327_10008189 3300031251 Bacteria 7845
172 Ga0307509_10102432 3300031507 Bacteria 2895
173 Ga0307408_100000008 3300031548 Bacteria 456355
174 Ga0307408_100002197 3300031548 Bacteria 13950
175 Ga0316575_10000494 3300031665 Bacteria 11406
176 Ga0265314_10017040 3300031711 Bacteria 5712
177 Ga0265314_10048401 3300031711 Bacteria 2984
178 Ga0307516_10089625 3300031730 Bacteria 2906
179 Ga0307416_100708647 3300032002 Bacteria 1096
180 Ga0307414_10087682 3300032004 Bacteria 2301
181 Ga0307414_10635765 3300032004 Bacteria 961
182 Ga0307411_10000169 3300032005 Bacteria 20966
183 Ga0307415_100304481 3300032126 Bacteria 1322
184 Ga0373950_0013777 3300034818 Bacteria 1353
185 Ga0373959_0008736 3300034820 Bacteria 1732
186 Ga0373940_0024687 3300035088 Bacteria 1560
187 Ga0373939_0000033 3300035114 Bacteria 49449
188 Ga0373960_0001741 3300035121 Bacteria 4875
189 Ga0373931_0001499 3300035691 Bacteria 10052
190 Ga0373937_0157628 3300036401 Bacteria 2128
191 Ga0395905_0014100 3300037471 Bacteria 7640
192 Ga0395905_0029320 3300037471 Bacteria 5184
193 Ga0395905_0048798 3300037471 Bacteria 3966
194 Ga0436361_0018388 3300039447 Bacteria 44345
195 Ga0436361_0068556 3300039447 Bacteria 100895
196 Ga0436361_0152681 3300039447 Bacteria 12488
197 Ga0436361_0351372 3300039447 Bacteria 183069
198 Ga0436361_0390231 3300039447 Bacteria 2508
199 Ga0436361_0775466 3300039447 Bacteria 5078
200 Ga0436361_1020551 3300039447 Bacteria 6817
201 Ga0451835_0117327 3300041492 Bacteria 967
202 Ga0451845_0080066 3300041501 Bacteria 1012
203 Ga0451847_0617575 3300041503 Bacteria 896
204 Ga0451849_0043162 3300041505 Bacteria 941
205 Ga0451853_0437136 3300041512 Bacteria 1083
206 Ga0439457_081943 3300042014 Bacteria 742
207 Ga0450913_001263 3300042117 Bacteria 1353
208 Ga0450888_001074 3300042126 Bacteria 2585
209 Ga0450890_001514 3300042127 Bacteria 3339
210 Ga0450891_003572 3300042129 Bacteria 1490
211 Ga0450889_000464 3300042144 Bacteria 4496
212 Ga0439459_0000160 3300042438 Bacteria 7069
213 Ga0450893_0003664 3300042532 Bacteria 2427
214 Ga0451577_0001784 3300042876 Bacteria 27608
215 Ga0451577_0006011 3300042876 Bacteria 12221
216 Ga0451577_0013731 3300042876 Bacteria 7569
217 Ga0451577_0130371 3300042876 Bacteria 2255
218 Ga0451577_0314828 3300042876 Bacteria 1419
219 Ga0453683_0001495 3300044673 Bacteria 19992
220 Ga0466965_0045122 3300044683 Bacteria 2179
221 Ga0466966_0009504 3300044684 Bacteria 6438
222 Ga0466961_0025566 3300044693 Bacteria 3796
223 Ga0453684_0004595 3300044712 Bacteria 28783
224 Ga0453684_0041033 3300044712 Bacteria 6268
225 Ga0453684_0051471 3300044712 Bacteria 5398
226 Ga0453684_0084533 3300044712 Bacteria 3945
227 Ga0453684_0228931 3300044712 Bacteria 2147
228 Ga0466970_0068273 3300044765 Bacteria 1910
229 Ga0466959_0190039 3300045049 Bacteria 1433
230 Ga0451576_0000006 3300045051 Bacteria 949698
231 Ga0451576_0002326 3300045051 Bacteria 28783
232 Ga0451576_0003496 3300045051 Bacteria 21499
233 Ga0451576_0012633 3300045051 Bacteria 9481
234 Ga0451576_0287539 3300045051 Bacteria 1719
235 Ga0451576_0410952 3300045051 Bacteria 1419
236 Ga0451576_0505860 3300045051 Bacteria 1269
237 Ga0466958_0332406 3300045836 Bacteria 977
238 Ga0495580_0083804 3300046472 Bacteria 2221
239 Ga0495633_0001129 3300046558 Bacteria 21463
240 Ga0495658_0219689 3300046683 Bacteria 1189
241 Ga0495686_0009098 3300047472 Bacteria 7198
242 Ga0496102_0032492 3300048905 Bacteria 4688
243 Ga0496121_0040685 3300048924 Bacteria 4073
244 Ga0501310_002888 3300049130 Bacteria 1656
245 Ga0501300_001359 3300049523 Bacteria 3681
246 Ga0501300_012756 3300049523 Bacteria 1225
247 Ga0501303_001338 3300049526 Bacteria 1839
248 Ga0501077_0155301 3300049593 Bacteria 1452
249 Ga0501198_000008 3300049649 Bacteria 129023
250 Ga0501211_000242 3300049658 Bacteria 4810
251 Ga0501222_000006 3300049662 Bacteria 129030
252 Ga0501222_004897 3300049662 Bacteria 1818
253 Ga0501222_024354 3300049662 Bacteria 818
254 Ga0501235_004216 3300049669 Bacteria 3115
255 Ga0501258_009157 3300049687 Bacteria 1030
256 Ga0501221_000379 3300049704 Bacteria 6823
257 Ga0501229_001910 3300049706 Bacteria 2443
258 Ga0501262_008879 3300049759 Bacteria 1235
259 Ga0501267_000037 3300049764 Bacteria 7315
260 Ga0501272_001063 3300049769 Bacteria 2529
261 nmdc:mga03683_41754_c1 3300050489 Bacteria 1885
262 nmdc:mga00v17_64153_c1 3300050491 Bacteria 2263
263 nmdc:mga0k408_1071_c1 3300050493 Bacteria 15060
264 nmdc:mga0k408_34376_c1 3300050493 Bacteria 2902
265 nmdc:mga06z11_127356_c1 3300050494 Bacteria 1426
266 nmdc:mga06z11_50999_c1 3300050494 Bacteria 2117
267 nmdc:mga04h51_78476_c1 3300050495 Bacteria 1167
268 nmdc:mga07m45_20550_c1 3300050496 Bacteria 3587
269 nmdc:mga07m45_25418_c1 3300050496 Bacteria 1460
270 nmdc:mga07m45_54822_c1 3300050496 Bacteria 2253
271 nmdc:mga07m45_75_c1 3300050496 Bacteria 29787
272 nmdc:mga07m45_79318_c1 3300050496 Bacteria 1874
273 Ga0500618_002679 3300053125 Bacteria 6522
274 Ga0500590_001540 3300053148 Bacteria 9564
275 Ga0500622_0001845 3300053156 Bacteria 16037
276 2643742862 2643221544 Bacteria 5886209
277 2644217502 2643221639 Bacteria 6649903
278 2644258767 2643221646 Bacteria 6433402
279 2739055526 2738541337 Bacteria 6183410
280 2831865528 2831864461 Bacteria 6502356
281 2886851170 2886848708 Bacteria 5632523
282 2894026061 2894023352 Bacteria 5167372
283 Ga0055524_1000814
284 JGI25153J46596_10001470
285 JGI25153J46596_10003347
286 rootH1_10085146
287 rootL2_10001692
288 rootH1_10039187
289 rootH1_10065520
290 rootH1_10102888
291 Ga0055526_1000906
292 Ga0055524_1003915
293 Ga0055530_10025787
294 Ga0055531_10000168
295 Ga0055531_10001544
296 Ga0055531_10021052
297 Ga0055543_1005136
298 Ga0055543_1015394
299 Ga0065165_1000153
300 Ga0065165_1000569
301 Ga0070658_10092344
302 Ga0070670_100000939
303 Ga0070670_100013197
304 Ga0070670_100138578
305 Ga0070670_100155779
306 Ga0070670_100160020
307 Ga0070677_10010653
308 Ga0070682_100163667
309 Ga0070661_100171235
310 Ga0070669_100091062
311 Ga0070675_100022972
312 Ga0070675_100033069
313 Ga0070675_100360133
314 Ga0070671_100541039
315 Ga0070674_100218489
316 Ga0070673_100030704
317 Ga0070673_100035657
318 Ga0070659_100001171
319 Ga0070678_100075685
320 Ga0068867_100477425
321 Ga0068853_100091695
322 Ga0070672_100008536
323 Ga0070672_100095570
324 Ga0070672_100200747
325 Ga0070665_100021752
326 Ga0070665_100849293
327 Ga0070664_100049271
328 Ga0070664_100408129
329 Ga0068857_100136538
330 Ga0068859_100149091
331 Ga0068864_100001313
332 Ga0068870_10160177
333 Ga0068870_10185708
334 Ga0068863_100120827
335 Ga0068863_100145143
336 Ga0075368_10097952
337 Ga0075363_100023888
338 Ga0075363_100070542
339 Ga0075362_10004339
340 Ga0075367_10153795
341 Ga0075366_10002041
342 Ga0075366_10002708
343 Ga0075370_10001548
344 Ga0075370_10002794
345 Ga0075370_10029590
346 Ga0068871_100010518
347 Ga0068865_100005385
348 Ga0068865_100114648
349 Ga0097620_100149095
350 Ga0099823_1000031
351 Ga0105240_10003836
352 Ga0105240_10078978
353 Ga0105243_10148861
354 Ga0105243_10462746
355 Ga0105242_10049100
356 Ga0105248_10128535
357 Ga0105237_10001634
358 Ga0105237_10006422
359 Ga0105238_10014859
360 Ga0105238_10094218
361 Ga0105239_10002435
362 Ga0157317_1000308
363 Ga0157319_1000016
364 Ga0157374_10415011
365 Ga0157374_10485696
366 Ga0163162_10473449
367 Ga0157375_10110571
368 Ga0163163_10478903
369 Ga0163163_10563467
370 Ga0157380_10202231
371 Ga0157379_10009506
372 Ga0157379_10159173
373 Ga0157376_10022790
374 Ga0163161_10004685
375 Ga0163161_10066139
376 Ga0213872_10000058
377 Ga0213872_10000150
378 Ga0213872_10022852
379 Ga0209563_100013
380 Ga0207425_1000332
381 Ga0209129_1000012
382 Ga0209673_1016267
383 Ga0209564_1000008
384 Ga0209564_1000022
385 Ga0209758_1000233
386 Ga0209758_1000708
387 Ga0209050_1002766
388 Ga0209050_1004633
389 Ga0209256_1000579
390 Ga0209256_1001555
391 Ga0209051_1002778
392 Ga0209051_1003056
393 Ga0209257_1000021
394 Ga0209257_1000984
395 Ga0209257_1004760
396 Ga0209257_1012593
397 Ga0207682_10006107
398 Ga0207645_10078670
399 Ga0207643_10170029
400 Ga0207705_10155090
401 Ga0207695_10020987
402 Ga0207649_10183800
403 Ga0207694_10004971
404 Ga0207650_10002396
405 Ga0207650_10004068
406 Ga0207650_10099095
407 Ga0207659_10020272
408 Ga0207659_10517821
409 Ga0207659_10564444
410 Ga0207644_10420893
411 Ga0207690_10002213
412 Ga0207706_10066961
413 Ga0207686_10045969
414 Ga0207709_10296717
415 Ga0207669_10407031
416 Ga0207704_10295010
417 Ga0207691_10009020
418 Ga0207691_10127287
419 Ga0207691_10133089
420 Ga0207691_10243451
421 Ga0207711_10026741
422 Ga0207689_10086097
423 Ga0207689_10659618
424 Ga0207679_10033418
425 Ga0207679_10306737
426 Ga0207651_10041808
427 Ga0207651_10123618
428 Ga0207640_10216789
429 Ga0207658_10525989
430 Ga0207677_10255727
431 Ga0207703_10294336
432 Ga0207639_10073981
433 Ga0207678_10166846
434 Ga0207648_10118292
435 Ga0207676_10012947
436 Ga0207676_10022460
437 Ga0207676_10807750
438 Ga0207674_10071549
439 Ga0207675_100106248
440 Ga0207683_10017159
441 Ga0207683_10058726
442 Ga0207683_10606339
443 Ga0209389_1006709
444 Ga0209371_1024836
445 Ga0209813_10063674
446 Ga0268266_10036691
447 Ga0268266_10105872
448 Ga0265324_10000340
449 Ga0268256_1028259
450 Ga0265332_10013560
451 Ga0265331_10011355
452 Ga0265327_10000328
453 Ga0265327_10008189
454 Ga0307509_10102432
455 Ga0307408_100000008
456 Ga0307408_100002197
457 Ga0316575_10000494
458 Ga0265314_10017040
459 Ga0265314_10048401
460 Ga0307516_10089625
461 Ga0307416_100708647
462 Ga0307414_10087682
463 Ga0307414_10635765
464 Ga0307411_10000169
465 Ga0307415_100304481
466 Ga0373950_0013777
467 Ga0373959_0008736
468 Ga0373940_0024687
469 Ga0373939_0000033
470 Ga0373960_0001741
471 Ga0373931_0001499
472 Ga0373937_0157628
473 Ga0395905_0014100
474 Ga0395905_0029320
475 Ga0395905_0048798
476 Ga0436361_0018388
477 Ga0436361_0068556
478 Ga0436361_0152681
479 Ga0436361_0351372
480 Ga0436361_0390231
481 Ga0436361_0775466
482 Ga0436361_1020551
483 Ga0451835_0117327
484 Ga0451845_0080066
485 Ga0451847_0617575
486 Ga0451849_0043162
487 Ga0451853_0437136
488 Ga0439457_081943
489 Ga0450913_001263
490 Ga0450888_001074
491 Ga0450890_001514
492 Ga0450891_003572
493 Ga0450889_000464
494 Ga0439459_0000160
495 Ga0450893_0003664
496 Ga0451577_0001784
497 Ga0451577_0006011
498 Ga0451577_0013731
499 Ga0451577_0130371
500 Ga0451577_0314828
501 Ga0453683_0001495
502 Ga0466965_0045122
503 Ga0466966_0009504
504 Ga0466961_0025566
505 Ga0453684_0004595
506 Ga0453684_0041033
507 Ga0453684_0051471
508 Ga0453684_0084533
509 Ga0453684_0228931
510 Ga0466970_0068273
511 Ga0466959_0190039
512 Ga0451576_0000006
513 Ga0451576_0002326
514 Ga0451576_0003496
515 Ga0451576_0012633
516 Ga0451576_0287539
517 Ga0451576_0410952
518 Ga0451576_0505860
519 Ga0466958_0332406
520 Ga0495580_0083804
521 Ga0495633_0001129
522 Ga0495658_0219689
523 Ga0495686_0009098
524 Ga0496102_0032492
525 Ga0496121_0040685
526 Ga0501310_002888
527 Ga0501300_001359
528 Ga0501300_012756
529 Ga0501303_001338
530 Ga0501077_0155301
531 Ga0501198_000008
532 Ga0501211_000242
533 Ga0501222_000006
534 Ga0501222_004897
535 Ga0501222_024354
536 Ga0501235_004216
537 Ga0501258_009157
538 Ga0501221_000379
539 Ga0501229_001910
540 Ga0501262_008879
541 Ga0501267_000037
542 Ga0501272_001063
543 nmdc:mga03683_41754_c1
544 nmdc:mga00v17_64153_c1
545 nmdc:mga0k408_1071_c1
546 nmdc:mga0k408_34376_c1
547 nmdc:mga06z11_127356_c1
548 nmdc:mga06z11_50999_c1
549 nmdc:mga04h51_78476_c1
550 nmdc:mga07m45_20550_c1
551 nmdc:mga07m45_25418_c1
552 nmdc:mga07m45_54822_c1
553 nmdc:mga07m45_75_c1
554 nmdc:mga07m45_79318_c1
555 Ga0500618_002679
556 Ga0500590_001540
557 Ga0500622_0001845
558 2643742862
559 2644217502
560 2644258767
561 2739055526
562 2831865528
563 2886851170
564 2894026061

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02660

G3P_acyltransf

Glycerol-3-phosphate acyltransferase

13

183

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.9197 5 200
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.91 5 202
5xj5-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the monoacylglycerol form 0.884 5 202
5xj8-assembly1.cif.gz_A crystal structure of plsy (ygih), an integral membrane glycerol 3-phosphate acyltransferase - the lysphosphatidic acid form 0.8797 5 200
7cfg-assembly1.cif.gz_A-2 structure of the transmembrane domain of the bacterial cnnm/corc family mg2+ transporter in complex with mg2+ 0.2865 6 199
ID Description Score Start End Superfamily
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8863 13 190 1.10.1760.20
af_P60782_11_184_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8723 13 190 1.10.1760.20
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8624 13 190 1.10.1760.20
af_Q2FYS6_9_191_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8364 13 190 1.10.1760.20
af_Q4DMF5_143_245_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5617 123 194 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A3A0E6M6-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.9668 1 188 GO:0005886
GO:0008654
GO:0043772
AF-A0A3D3PR66-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.9642 63 204 GO:0005886
GO:0008654
GO:0043772
AF-A0A011P9M5-F1-model_v4 Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) 0.9617 2 203 GO:0005886
GO:0008654
GO:0043772
AF-A0A5C8P548-F1-model_v4 Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.275) (Lysophosphatidic acid synthase) (LPA synthase) 0.9588 1 202 GO:0005886
GO:0008654
GO:0043772
AF-E6MXG3-F1-model_v4 Glycerol-3-phosphate acyltransferase 0.9579 63 203 GO:0005886
GO:0008654
GO:0043772

Map