F384998

General Info

Members Datasets Scaffolds Average Seq Length
282 245 145 160

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10238108|Ga0207678_102381083
Length 195
Sequence MPLTIDRIPADFGRWDEVLALIMHAFAFMDGVIDPPSSAHLLTPDTLRDKARRETGFVALDGDRIVGCVFAEERADDLYVGKLAVAPDCQGQGIGRRLMRAVEILALDRGKAALELQTRIELTANHAAFARLGFQETGRTALRATHSVRGIRNRASQAARSVAVSAVIVMRGVSASAHPAAGGMLWLKRNTLSGS

Samples

Sample ID Description Type Environment
1 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
2 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
3 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
4 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
5 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
6 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
7 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
8 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
9 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
10 2738543024 Aminobacter sp. AP02 Isolate Unclassified
11 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
12 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
13 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
14 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
15 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
16 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
17 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
18 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
19 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
20 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
21 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
22 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
23 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
24 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
25 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
26 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
27 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
28 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
29 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
30 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
31 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
32 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
33 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
34 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
35 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
36 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
37 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
38 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
39 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
40 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
41 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
42 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
43 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
44 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
45 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
46 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
47 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
48 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
49 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
50 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
51 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
52 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
53 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
54 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
55 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
56 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
57 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
58 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
59 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
60 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
61 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
62 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
63 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
64 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
65 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
66 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
67 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
68 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
69 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
70 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
71 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
72 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
73 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
74 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
75 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
76 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
77 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
78 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
79 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
80 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
81 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
82 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
83 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
84 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
85 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
86 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
87 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
88 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
89 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
90 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
91 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
92 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
93 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
94 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
95 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
96 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
97 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
98 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
99 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
100 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
101 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
102 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
103 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
104 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
105 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
106 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
107 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
108 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
109 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
110 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
111 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
112 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
113 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
114 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
115 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
116 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
117 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
118 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
119 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
120 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
121 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
122 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
123 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
124 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
125 3004167301 Mesorhizobium loti 582 Isolate Unclassified
126 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
127 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
128 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
129 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
130 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
131 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
132 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
133 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
134 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
135 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
136 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
137 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
138 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
139 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
140 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
141 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
142 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
143 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
144 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
145 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
146 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
147 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
148 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
149 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
150 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
151 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
152 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
153 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
154 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
155 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
156 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
157 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
158 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
159 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
160 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
161 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
162 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
163 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
164 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
165 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
166 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
167 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
168 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
169 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
170 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
172 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
173 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
195 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
196 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
197 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
198 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
229 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
230 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
231 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
232 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
233 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
234 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
235 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
236 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
237 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
238 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
241 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
242 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
243 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
244 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
245 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 51.42
Metatranscriptomes 0
Isolates 48.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.25
Nodule 43.26
Rhizoplane 2.13
Rhizosphere 30.85
Stem 0
Stem Tuber 0
Unclassified 8.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1000916 3300002741 Bacteria 14076
2 JGI25165J46597_1001962 3300003214 Bacteria 8055
3 Ga0055529_1002345 3300003763 Bacteria 3746
4 Ga0068853_100165934 3300005539 Bacteria 1995
5 Ga0070665_100190395 3300005548 Bacteria 2052
6 Ga0070665_101128716 3300005548 Bacteria 795
7 Ga0068855_100240958 3300005563 Bacteria 2021
8 Ga0068855_100375949 3300005563 Bacteria 1561
9 Ga0070664_100790260 3300005564 Bacteria 887
10 Ga0068852_100488965 3300005616 Bacteria 1224
11 Ga0068861_101422336 3300005719 Bacteria 678
12 Ga0068860_101164516 3300005843 Bacteria 791
13 Ga0075365_10000182 3300006038 Bacteria 20490
14 Ga0075365_10009067 3300006038 Bacteria 5692
15 Ga0075365_10027756 3300006038 Bacteria 3605
16 Ga0075368_10009151 3300006042 Bacteria 3558
17 Ga0075363_100097091 3300006048 Bacteria 1628
18 Ga0075363_100097787 3300006048 Bacteria 1622
19 Ga0075362_10022875 3300006177 Bacteria 2638
20 Ga0075362_10082556 3300006177 Bacteria 1483
21 Ga0075367_10032280 3300006178 Bacteria 3012
22 Ga0075369_10015767 3300006186 Bacteria 3038
23 Ga0075366_10107595 3300006195 Bacteria 1676
24 Ga0075366_10374861 3300006195 Bacteria 875
25 Ga0075370_10737565 3300006353 Bacteria 599
26 Ga0105240_10839671 3300009093 Bacteria 992
27 Ga0105245_12008960 3300009098 Bacteria 632
28 Ga0105247_10716503 3300009101 Bacteria 755
29 Ga0105241_10422048 3300009174 Bacteria 1174
30 Ga0105241_10672245 3300009174 Bacteria 943
31 Ga0105237_10049481 3300009545 Bacteria 4224
32 Ga0105237_10169438 3300009545 Bacteria 2183
33 Ga0105238_10000581 3300009551 Bacteria 38310
34 Ga0105238_10454581 3300009551 Bacteria 1278
35 Ga0105238_10540030 3300009551 Bacteria 1170
36 Ga0105238_11170615 3300009551 Bacteria 793
37 Ga0105239_10261620 3300010375 Bacteria 1944
38 Ga0105239_10708251 3300010375 Bacteria 1151
39 Ga0105239_10911377 3300010375 Bacteria 1009
40 Ga0105239_11113900 3300010375 Bacteria 909
41 Ga0105239_11700873 3300010375 Bacteria 730
42 Ga0157373_10594391 3300013100 Bacteria 805
43 Ga0157370_10476292 3300013104 Bacteria 1147
44 Ga0157369_10933282 3300013105 Bacteria 890
45 Ga0157374_10229772 3300013296 Bacteria 1822
46 Ga0157378_10554445 3300013297 Bacteria 1155
47 Ga0182008_10057497 3300014497 Bacteria 1920
48 Ga0182006_1037506 3300015261 Bacteria 1920
49 Ga0163161_10896677 3300017792 Bacteria 751
50 Ga0207427_109593 3300025231 Bacteria 1035
51 Ga0209437_100376 3300025233 Bacteria 45400
52 Ga0209646_1012385 3300025246 Bacteria 1310
53 Ga0209026_1000013 3300025250 Bacteria 415633
54 Ga0209148_1000032 3300025254 Bacteria 557660
55 Ga0209759_1000058 3300025256 Bacteria 203580
56 Ga0209233_1000034 3300025261 Bacteria 578898
57 Ga0209233_1000458 3300025261 Bacteria 26629
58 Ga0209455_1000098 3300025272 Bacteria 213890
59 Ga0207647_10257222 3300025904 Bacteria 1000
60 Ga0207645_10645585 3300025907 Bacteria 719
61 Ga0207654_10452855 3300025911 Bacteria 900
62 Ga0207695_10068079 3300025913 Bacteria 3648
63 Ga0207695_10552046 3300025913 Bacteria 1033
64 Ga0207671_10039970 3300025914 Bacteria 3473
65 Ga0207694_10017975 3300025924 Bacteria 5344
66 Ga0207694_10290968 3300025924 Bacteria 1343
67 Ga0207669_10989583 3300025937 Bacteria 706
68 Ga0207704_10159085 3300025938 Bacteria 1605
69 Ga0207667_10406249 3300025949 Bacteria 1386
70 Ga0207639_10002694 3300026041 Bacteria 11920
71 Ga0207639_10176823 3300026041 Bacteria 1812
72 Ga0207639_11402643 3300026041 Bacteria 656
73 Ga0207678_10238108 3300026067 Bacteria 1559
74 Ga0207648_10126977 3300026089 Bacteria 2244
75 Ga0207648_10397257 3300026089 Bacteria 1249
76 Ga0207683_10980903 3300026121 Bacteria 784
77 Ga0207698_10146380 3300026142 Bacteria 2044
78 Ga0209813_10036017 3300027866 Bacteria 1484
79 Ga0268266_10046736 3300028379 Bacteria 3706
80 Ga0268266_10081202 3300028379 Bacteria 2826
81 Ga0268266_11032502 3300028379 Bacteria 795
82 Ga0268264_10818801 3300028381 Bacteria 931
83 Ga0395900_0937527 3300037418 Bacteria 788
84 Ga0395905_0168115 3300037471 Bacteria 2060
85 Ga0395905_0269436 3300037471 Bacteria 1589
86 Ga0395901_0133158 3300038443 Bacteria 2612
87 Ga0439465_0075927 3300041413 Bacteria 1133
88 Ga0439465_0214156 3300041413 Bacteria 705
89 Ga0495620_0053512 3300046515 Bacteria 1709
90 Ga0495597_0123886 3300046542 Bacteria 1076
91 Ga0495622_0395281 3300046557 Bacteria 596
92 Ga0495668_0282828 3300046616 Bacteria 909
93 Ga0495625_0024951 3300046660 Bacteria 4541
94 Ga0495625_0578761 3300046660 Bacteria 677
95 Ga0495681_0111856 3300047470 Bacteria 1182
96 Ga0495686_0128288 3300047472 Bacteria 1506
97 Ga0496102_0070224 3300048905 Bacteria 3216
98 Ga0496103_0095650 3300048906 Bacteria 1877
99 Ga0496108_0291015 3300048911 Bacteria 1422
100 Ga0496112_0004728 3300048915 Bacteria 11603
101 Ga0496113_0629306 3300048916 Bacteria 859
102 Ga0496118_0161979 3300048921 Bacteria 1382
103 Ga0496119_0014810 3300048922 Bacteria 6068
104 Ga0496119_0049919 3300048922 Bacteria 2583
105 Ga0496120_0003643 3300048923 Bacteria 13813
106 Ga0496120_0039275 3300048923 Bacteria 2794
107 Ga0496126_0071797 3300048929 Bacteria 3081
108 Ga0501032_0037185 3300049569 Bacteria 3320
109 Ga0501033_0061364 3300049570 Bacteria 2771
110 Ga0501034_0313553 3300049571 Bacteria 1502
111 Ga0501036_0736259 3300049572 Bacteria 814
112 Ga0501038_0156789 3300049574 Bacteria 1853
113 Ga0501047_0004196 3300049581 Bacteria 13568
114 Ga0501069_0004228 3300049585 Bacteria 7419
115 Ga0501070_0001237 3300049586 Bacteria 22880
116 Ga0501070_0360932 3300049586 Bacteria 1178
117 Ga0501074_0396581 3300049590 Bacteria 979
118 Ga0501035_0043854 3300049822 Bacteria 4029
119 Ga0501035_0523500 3300049822 Bacteria 974
120 Ga0501044_0025212 3300049823 Bacteria 6305
121 Ga0501044_0043175 3300049823 Bacteria 4685
122 nmdc:mga03683_173617_c1 3300050489 Bacteria 980
123 nmdc:mga03n38_376432_c1 3300050490 Bacteria 777
124 nmdc:mga00v17_172441_c1 3300050491 Bacteria 1395
125 nmdc:mga0yw44_219078_c1 3300050492 Bacteria 1261
126 nmdc:mga0yw44_273115_c1 3300050492 Bacteria 1129
127 nmdc:mga0k408_259632_c1 3300050493 Bacteria 1037
128 nmdc:mga0k408_443485_c1 3300050493 Bacteria 771
129 nmdc:mga06z11_201549_c1 3300050494 Bacteria 1156
130 nmdc:mga04h51_52965_c1 3300050495 Bacteria 1368
131 nmdc:mga07m45_180263_c2 3300050496 Bacteria 513
132 nmdc:mga0sz30_222585_c1 3300050516 Bacteria 839
133 nmdc:mga0sz30_961_c1 3300050516 Bacteria 9267
134 Ga0500610_0243584 3300053079 Bacteria 834
135 Ga0495655_0017038 3300053083 Bacteria 1576
136 Ga0500658_0121164 3300053134 Bacteria 1159
137 Ga0500604_0015381 3300053151 Bacteria 2095
138 Ga0500604_0161858 3300053151 Bacteria 763
139 Ga0500616_0010246 3300053153 Bacteria 5621
140 Ga0500620_006786 3300053155 Bacteria 2777
141 Ga0500627_0035316 3300053158 Bacteria 2123
142 Ga0500611_034103 3300053727 Bacteria 1075
143 Ga0500611_157872 3300053727 Bacteria 626
144 Ga0501082_0369528 3300060353 Bacteria 1251
145 Ga0530510_1001064 3300061734 Bacteria 640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2597489875 2597810089 156
2 iso_pu_bacteria 2738543024 2739308402 156
3 iso_pu_bacteria 2856342000 2856345388 156
4 iso_pu_bacteria 2871474448 2871475802 156
5 iso_pu_bacteria 2958071322 2958076355 156
6 iso_pu_bacteria 2970524798 2970525467 156
7 iso_pu_bacteria 2509276022 2509392931 157
8 iso_pu_bacteria 2844009547 2844010039 157
9 iso_pu_bacteria 2856320880 2856327917 157
10 iso_pu_bacteria 2869278585 2869279867 157
11 iso_pu_bacteria 2874139085 2874145641 157
12 iso_pu_bacteria 2878738818 2878740291 157
13 iso_pu_bacteria 2888337043 2888342652 157
14 iso_pu_bacteria 2924718760 2924722361 157
15 iso_pu_bacteria 2924776078 2924777891 157
16 iso_pu_bacteria 2937877337 2937884453 157
17 iso_pu_bacteria 2937972304 2937980476 157
18 iso_pu_bacteria 2958034702 2958035734 157
19 iso_pu_bacteria 2958041894 2958044765 157
20 iso_pu_bacteria 2958064165 2958066680 157
21 iso_pu_bacteria 2958084443 2958091764 157
22 iso_pu_bacteria 2958144490 2958150862 157
23 iso_pu_bacteria 2968016561 2968021577 157
24 iso_pu_bacteria 2968138860 2968142608 157
25 iso_pu_bacteria 2970469710 2970476744 157
26 iso_pu_bacteria 2970593180 2970594466 157
27 iso_pu_bacteria 2970619444 2970621204 157
28 iso_pu_bacteria 2996348954 2996356168 157
29 iso_pu_bacteria 3004275668 3004282482 157
30 iso_pu_bacteria 3004289098 3004293816 157
31 3300005539 Ga0068853_100165934 Ga0068853_1001659342 158
32 3300005548 Ga0070665_100190395 Ga0070665_1001903952 158
33 3300005563 Ga0068855_100375949 Ga0068855_1003759492 158
34 3300005616 Ga0068852_100488965 Ga0068852_1004889652 158
35 3300006038 Ga0075365_10000182 Ga0075365_100001829 158
36 3300006048 Ga0075363_100097091 Ga0075363_1000970912 158
37 3300009098 Ga0105245_12008960 Ga0105245_120089601 158
38 3300009174 Ga0105241_10672245 Ga0105241_106722452 158
39 3300009545 Ga0105237_10049481 Ga0105237_100494815 158
40 3300009551 Ga0105238_10454581 Ga0105238_104545812 158
41 3300009551 Ga0105238_11170615 Ga0105238_111706152 158
42 3300010375 Ga0105239_10708251 Ga0105239_107082512 158
43 3300010375 Ga0105239_10911377 Ga0105239_109113772 158
44 3300010375 Ga0105239_11113900 Ga0105239_111139002 158
45 3300010375 Ga0105239_11700873 Ga0105239_117008732 158
46 3300013100 Ga0157373_10594391 Ga0157373_105943912 158
47 3300013104 Ga0157370_10476292 Ga0157370_104762922 158
48 3300025911 Ga0207654_10452855 Ga0207654_104528552 158
49 3300025924 Ga0207694_10290968 Ga0207694_102909682 158
50 3300026041 Ga0207639_10176823 Ga0207639_101768232 158
51 3300026041 Ga0207639_11402643 Ga0207639_114026432 158
52 3300026067 Ga0207678_10238108 Ga0207678_102381083 158
53 3300026121 Ga0207683_10980903 Ga0207683_109809032 158
54 3300026142 Ga0207698_10146380 Ga0207698_101463802 158
55 3300046557 Ga0495622_0395281 Ga0495622_0395281_62_538 158
56 3300048921 Ga0496118_0161979 Ga0496118_0161979_211_687 158
57 3300048922 Ga0496119_0014810 Ga0496119_0014810_2893_3369 158
58 3300048923 Ga0496120_0039275 Ga0496120_0039275_421_897 158
59 3300050494 nmdc:mga06z11_201549_c1 nmdc:mga06z11_201549_c1_176_652 158
60 3300050496 nmdc:mga07m45_180263_c2 nmdc:mga07m45_180263_c2_14_490 158
61 iso_pu_bacteria 2509276018 2509370631 158
62 iso_pu_bacteria 2513237090 2513613484 158
63 iso_pu_bacteria 2513237351 2514586170 158
64 iso_pu_bacteria 2599185301 2599935801 158
65 iso_pu_bacteria 2643221595 2643984962 158
66 iso_pu_bacteria 2643221627 2644154108 158
67 iso_pu_bacteria 2687453392 2688595317 158
68 iso_pu_bacteria 2756170246 2756674609 158
69 iso_pu_bacteria 2791355123 2792746514 158
70 iso_pu_bacteria 2844002411 2844004170 158
71 iso_pu_bacteria 2856328259 2856332090 158
72 iso_pu_bacteria 2856334872 2856341373 158
73 iso_pu_bacteria 2857367948 2857374491 158
74 iso_pu_bacteria 2869162929 2869165802 158
75 iso_pu_bacteria 2869242130 2869247425 158
76 iso_pu_bacteria 2869249662 2869252998 158
77 iso_pu_bacteria 2869264136 2869268745 158
78 iso_pu_bacteria 2869271264 2869276957 158
79 iso_pu_bacteria 2871451962 2871458673 158
80 iso_pu_bacteria 2871466892 2871470562 158
81 iso_pu_bacteria 2871481445 2871483237 158
82 iso_pu_bacteria 2874109183 2874113243 158
83 iso_pu_bacteria 2874162495 2874162616 158
84 iso_pu_bacteria 2874168670 2874171709 158
85 iso_pu_bacteria 2876386047 2876392218 158
86 iso_pu_bacteria 2876392853 2876392976 158
87 iso_pu_bacteria 2876399893 2876404264 158
88 iso_pu_bacteria 2876406927 2876411442 158
89 iso_pu_bacteria 2878774303 2878775059 158
90 iso_pu_bacteria 2878781027 2878786891 158
91 iso_pu_bacteria 2881147464 2881147563 158
92 iso_pu_bacteria 2881161766 2881164343 158
93 iso_pu_bacteria 2881853255 2881854851 158
94 iso_pu_bacteria 2885305155 2885306203 158
95 iso_pu_bacteria 2885334103 2885334898 158
96 iso_pu_bacteria 2885342637 2885346885 158
97 iso_pu_bacteria 2889010040 2889014211 158
98 iso_pu_bacteria 2889016732 2889021086 158
99 iso_pu_bacteria 2904659560 2904659682 158
100 iso_pu_bacteria 2906354277 2906361292 158
101 iso_pu_bacteria 2906363423 2906369412 158
102 iso_pu_bacteria 2906370794 2906374829 158
103 iso_pu_bacteria 2906378014 2906381312 158
104 iso_pu_bacteria 2906393657 2906398965 158
105 iso_pu_bacteria 2906401398 2906402905 158
106 iso_pu_bacteria 2906408224 2906411578 158
107 iso_pu_bacteria 2906427513 2906433553 158
108 iso_pu_bacteria 2922130491 2922137430 158
109 iso_pu_bacteria 2922151315 2922155172 158
110 iso_pu_bacteria 2924710171 2924711460 158
111 iso_pu_bacteria 2924741084 2924743783 158
112 iso_pu_bacteria 2924748358 2924754353 158
113 iso_pu_bacteria 2924762789 2924767647 158
114 iso_pu_bacteria 2937822353 2937825963 158
115 iso_pu_bacteria 2937861824 2937864714 158
116 iso_pu_bacteria 2937868953 2937869316 158
117 iso_pu_bacteria 2958100919 2958104113 158
118 iso_pu_bacteria 2958108152 2958111332 158
119 iso_pu_bacteria 2958122699 2958123627 158
120 iso_pu_bacteria 2958158011 2958159622 158
121 iso_pu_bacteria 2958172287 2958174611 158
122 iso_pu_bacteria 2961114664 2961115006 158
123 iso_pu_bacteria 2961127735 2961128743 158
124 iso_pu_bacteria 2961183825 2961190090 158
125 iso_pu_bacteria 2965025482 2965028898 158
126 iso_pu_bacteria 2965032056 2965038146 158
127 iso_pu_bacteria 2965047637 2965047695 158
128 iso_pu_bacteria 2965089291 2965093947 158
129 iso_pu_bacteria 2965102966 2965109440 158
130 iso_pu_bacteria 2965110997 2965117086 158
131 iso_pu_bacteria 2965119406 2965123744 158
132 iso_pu_bacteria 2968110612 2968110734 158
133 iso_pu_bacteria 2968117919 2968121538 158
134 iso_pu_bacteria 2970489779 2970494203 158
135 iso_pu_bacteria 2970510686 2970514212 158
136 iso_pu_bacteria 2970547951 2970553741 158
137 iso_pu_bacteria 2970627176 2970633151 158
138 iso_pu_bacteria 2977851361 2977855023 158
139 iso_pu_bacteria 2977864932 2977868364 158
140 iso_pu_bacteria 2977872689 2977873721 158
141 iso_pu_bacteria 2977898635 2977903819 158
142 iso_pu_bacteria 2977915119 2977918133 158
143 iso_pu_bacteria 2977942078 2977943698 158
144 iso_pu_bacteria 2977950692 2977953039 158
145 iso_pu_bacteria 2977971508 2977976329 158
146 iso_pu_bacteria 2979710463 2979717263 158
147 iso_pu_bacteria 2979742915 2979743425 158
148 iso_pu_bacteria 2979772303 2979775758 158
149 iso_pu_bacteria 2979793036 2979799953 158
150 iso_pu_bacteria 2987636660 2987642304 158
151 iso_pu_bacteria 2987652177 2987654301 158
152 iso_pu_bacteria 2987666974 2987668118 158
153 iso_pu_bacteria 2987673487 2987674428 158
154 iso_pu_bacteria 2996386984 2996393664 158
155 iso_pu_bacteria 3000135777 3000135886 158
156 iso_pu_bacteria 3004167301 3004172491 158
157 iso_pu_bacteria 3004195979 3004201868 158
158 iso_pu_bacteria 3004232784 3004234033 158
159 iso_pu_bacteria 3004239961 3004246218 158
160 iso_pu_bacteria 3004268573 3004269567 158
161 iso_pu_bacteria 3004334049 3004338114 158
162 iso_pu_bacteria 649633066 649869878 158
163 iso_pu_bacteria 8004300914 8004305845 158
164 iso_pu_bacteria 8004361976 8004367176 158
165 iso_pu_bacteria 8004695233 8004702749 158
166 iso_pu_bacteria 8004727605 8004730993 158
167 3300003214 JGI25165J46597_1001962 JGI25165J46597_10019626 159
168 3300025231 Ga0207427_109593 Ga0207427_1095932 159
169 3300025233 Ga0209437_100376 Ga0209437_10037620 159
170 3300025261 Ga0209233_1000458 Ga0209233_100045827 159
171 iso_pu_bacteria 2996310559 2996315788 159
172 3300005548 Ga0070665_101128716 Ga0070665_1011287162 161
173 3300025261 Ga0209233_1000034 Ga0209233_1000034441 161
174 3300028379 Ga0268266_11032502 Ga0268266_110325022 161
175 3300002741 JGI25157J39369_1000916 JGI25157J39369_100091611 162
176 3300003763 Ga0055529_1002345 Ga0055529_10023452 162
177 3300005563 Ga0068855_100240958 Ga0068855_1002409583 162
178 3300005564 Ga0070664_100790260 Ga0070664_1007902602 162
179 3300005719 Ga0068861_101422336 Ga0068861_1014223362 162
180 3300005843 Ga0068860_101164516 Ga0068860_1011645162 162
181 3300006038 Ga0075365_10009067 Ga0075365_100090673 162
182 3300006038 Ga0075365_10027756 Ga0075365_100277562 162
183 3300006042 Ga0075368_10009151 Ga0075368_100091512 162
184 3300006048 Ga0075363_100097787 Ga0075363_1000977872 162
185 3300006177 Ga0075362_10022875 Ga0075362_100228753 162
186 3300006177 Ga0075362_10082556 Ga0075362_100825562 162
187 3300006178 Ga0075367_10032280 Ga0075367_100322802 162
188 3300006186 Ga0075369_10015767 Ga0075369_100157672 162
189 3300006195 Ga0075366_10107595 Ga0075366_101075952 162
190 3300006195 Ga0075366_10374861 Ga0075366_103748612 162
191 3300006353 Ga0075370_10737565 Ga0075370_107375651 162
192 3300009093 Ga0105240_10839671 Ga0105240_108396712 162
193 3300009101 Ga0105247_10716503 Ga0105247_107165032 162
194 3300009174 Ga0105241_10422048 Ga0105241_104220482 162
195 3300009545 Ga0105237_10169438 Ga0105237_101694382 162
196 3300009551 Ga0105238_10000581 Ga0105238_1000058130 162
197 3300009551 Ga0105238_10540030 Ga0105238_105400302 162
198 3300010375 Ga0105239_10261620 Ga0105239_102616203 162
199 3300013105 Ga0157369_10933282 Ga0157369_109332822 162
200 3300013296 Ga0157374_10229772 Ga0157374_102297722 162
201 3300013297 Ga0157378_10554445 Ga0157378_105544452 162
202 3300014497 Ga0182008_10057497 Ga0182008_100574972 162
203 3300015261 Ga0182006_1037506 Ga0182006_10375062 162
204 3300017792 Ga0163161_10896677 Ga0163161_108966772 162
205 3300025246 Ga0209646_1012385 Ga0209646_10123852 162
206 3300025250 Ga0209026_1000013 Ga0209026_1000013137 162
207 3300025254 Ga0209148_1000032 Ga0209148_10000324 162
208 3300025256 Ga0209759_1000058 Ga0209759_1000058179 162
209 3300025272 Ga0209455_1000098 Ga0209455_100009895 162
210 3300025904 Ga0207647_10257222 Ga0207647_102572222 162
211 3300025907 Ga0207645_10645585 Ga0207645_106455852 162
212 3300025913 Ga0207695_10068079 Ga0207695_100680794 162
213 3300025913 Ga0207695_10552046 Ga0207695_105520462 162
214 3300025914 Ga0207671_10039970 Ga0207671_100399704 162
215 3300025924 Ga0207694_10017975 Ga0207694_100179755 162
216 3300025937 Ga0207669_10989583 Ga0207669_109895831 162
217 3300025938 Ga0207704_10159085 Ga0207704_101590852 162
218 3300025949 Ga0207667_10406249 Ga0207667_104062491 162
219 3300026041 Ga0207639_10002694 Ga0207639_100026943 162
220 3300026089 Ga0207648_10126977 Ga0207648_101269772 162
221 3300026089 Ga0207648_10397257 Ga0207648_103972572 162
222 3300027866 Ga0209813_10036017 Ga0209813_100360172 162
223 3300028379 Ga0268266_10046736 Ga0268266_100467363 162
224 3300028379 Ga0268266_10081202 Ga0268266_100812023 162
225 3300028381 Ga0268264_10818801 Ga0268264_108188012 162
226 3300037418 Ga0395900_0937527 Ga0395900_0937527_255_743 162
227 3300037471 Ga0395905_0168115 Ga0395905_0168115_545_1033 162
228 3300037471 Ga0395905_0269436 Ga0395905_0269436_39_527 162
229 3300038443 Ga0395901_0133158 Ga0395901_0133158_466_954 162
230 3300041413 Ga0439465_0075927 Ga0439465_0075927_165_656 162
231 3300041413 Ga0439465_0214156 Ga0439465_0214156_145_636 162
232 3300046515 Ga0495620_0053512 Ga0495620_0053512_712_1200 162
233 3300046542 Ga0495597_0123886 Ga0495597_0123886_453_941 162
234 3300046616 Ga0495668_0282828 Ga0495668_0282828_39_527 162
235 3300046660 Ga0495625_0024951 Ga0495625_0024951_2912_3400 162
236 3300046660 Ga0495625_0578761 Ga0495625_0578761_162_650 162
237 3300047470 Ga0495681_0111856 Ga0495681_0111856_363_851 162
238 3300047472 Ga0495686_0128288 Ga0495686_0128288_177_668 162
239 3300048905 Ga0496102_0070224 Ga0496102_0070224_1182_1670 162
240 3300048906 Ga0496103_0095650 Ga0496103_0095650_355_843 162
241 3300048911 Ga0496108_0291015 Ga0496108_0291015_333_821 162
242 3300048915 Ga0496112_0004728 Ga0496112_0004728_4302_4790 162
243 3300048916 Ga0496113_0629306 Ga0496113_0629306_348_836 162
244 3300048922 Ga0496119_0049919 Ga0496119_0049919_288_776 162
245 3300048923 Ga0496120_0003643 Ga0496120_0003643_9422_9910 162
246 3300048929 Ga0496126_0071797 Ga0496126_0071797_2094_2582 162
247 3300049569 Ga0501032_0037185 Ga0501032_0037185_1327_1836 162
248 3300049570 Ga0501033_0061364 Ga0501033_0061364_1979_2491 162
249 3300049571 Ga0501034_0313553 Ga0501034_0313553_281_799 162
250 3300049572 Ga0501036_0736259 Ga0501036_0736259_246_755 162
251 3300049574 Ga0501038_0156789 Ga0501038_0156789_579_1088 162
252 3300049581 Ga0501047_0004196 Ga0501047_0004196_2013_2522 162
253 3300049585 Ga0501069_0004228 Ga0501069_0004228_3415_3924 162
254 3300049586 Ga0501070_0001237 Ga0501070_0001237_5391_5900 162
255 3300049586 Ga0501070_0360932 Ga0501070_0360932_438_947 162
256 3300049590 Ga0501074_0396581 Ga0501074_0396581_19_528 162
257 3300049822 Ga0501035_0043854 Ga0501035_0043854_2036_2545 162
258 3300049822 Ga0501035_0523500 Ga0501035_0523500_119_628 162
259 3300049823 Ga0501044_0025212 Ga0501044_0025212_2739_3248 162
260 3300049823 Ga0501044_0043175 Ga0501044_0043175_3552_4079 162
261 3300050489 nmdc:mga03683_173617_c1 nmdc:mga03683_173617_c1_258_746 162
262 3300050490 nmdc:mga03n38_376432_c1 nmdc:mga03n38_376432_c1_228_716 162
263 3300050491 nmdc:mga00v17_172441_c1 nmdc:mga00v17_172441_c1_650_1138 162
264 3300050492 nmdc:mga0yw44_219078_c1 nmdc:mga0yw44_219078_c1_756_1244 162
265 3300050492 nmdc:mga0yw44_273115_c1 nmdc:mga0yw44_273115_c1_597_1085 162
266 3300050493 nmdc:mga0k408_259632_c1 nmdc:mga0k408_259632_c1_344_832 162
267 3300050493 nmdc:mga0k408_443485_c1 nmdc:mga0k408_443485_c1_104_592 162
268 3300050495 nmdc:mga04h51_52965_c1 nmdc:mga04h51_52965_c1_258_746 162
269 3300050516 nmdc:mga0sz30_222585_c1 nmdc:mga0sz30_222585_c1_165_653 162
270 3300050516 nmdc:mga0sz30_961_c1 nmdc:mga0sz30_961_c1_743_1231 162
271 3300053079 Ga0500610_0243584 Ga0500610_0243584_139_627 162
272 3300053083 Ga0495655_0017038 Ga0495655_0017038_273_761 162
273 3300053134 Ga0500658_0121164 Ga0500658_0121164_138_626 162
274 3300053151 Ga0500604_0015381 Ga0500604_0015381_1029_1517 162
275 3300053151 Ga0500604_0161858 Ga0500604_0161858_29_520 162
276 3300053153 Ga0500616_0010246 Ga0500616_0010246_2481_2972 162
277 3300053155 Ga0500620_006786 Ga0500620_006786_341_829 162
278 3300053158 Ga0500627_0035316 Ga0500627_0035316_751_1239 162
279 3300053727 Ga0500611_034103 Ga0500611_034103_467_955 162
280 3300053727 Ga0500611_157872 Ga0500611_157872_60_548 162
281 3300060353 Ga0501082_0369528 Ga0501082_0369528_157_666 162
282 3300061734 Ga0530510_1001064 Ga0530510_1001064_92_580 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

15

134

0.84

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

38

151

0.78

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

52

136

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pp9-assembly2.cif.gz_C 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.9375 58 162
3pp9-assembly1.cif.gz_A-2 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.9308 58 161
3pp9-assembly2.cif.gz_B 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.9249 58 162
7ypu-assembly1.cif.gz_A orfe-coa-glycylthricin complex 0.9178 57 161
7ypu-assembly4.cif.gz_G orfe-coa-glycylthricin complex 0.916 58 161
ID Description Score Start End Superfamily
af_A0A286YBP0_57_178_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9357 60 147 3.40.630.30
3pp9C00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9106 58 162 3.40.630.30
af_Q8WUY8_92_189_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9092 62 142 3.40.630.30
3v8hC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9043 117 161 3.30.572.10
af_Q555H5_1389_1473_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8913 64 113 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7L5BST2-F1-model_v4 GNAT family N-acetyltransferase 0.9769 6 162 GO:0016747
AF-A3VFI8-F1-model_v4 Acetyltransferase, GNAT family protein 0.973 18 161 GO:0016747
AF-A0A1H7ZFI6-F1-model_v4 Uncharacterized conserved protein 0.9672 9 162 GO:0016747
GO:0016846
GO:0046872
AF-B6B8I1-F1-model_v4 Acetyltransferase, gnat family 0.9521 2 162 GO:0016747
AF-A0A7C6ZVP3-F1-model_v4 GNAT family N-acetyltransferase 0.9453 6 162 GO:0016747

Feature Viewer

pLDDT pTM Quality
93.79 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map