F385191

General Info

Members Datasets Scaffolds Average Seq Length
282 216 564 195

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0008279|Ga0496122_0008279_9280_9897
Length 205
Sequence MSNEIYQEVHMRVSRAQAEENRETVINVAGRLFRENGFDGIGLKDLMKGAGLTQGGFYKQFASKDDLIALASRRALESATRRWSDAAADSSDPLEAVLAFYLSPDHRGEKAEGCPLVALGSDAARLSAEVRRPFEDGINAHFQLLDALTDNTKGTAPSSKAMVILSLMVGAVTLSRIMEDKTLSQSVLDAATDEVRRIAHSDNVA

Samples

Sample ID Description Type Environment
1 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
38 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
42 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
44 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
47 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
50 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
61 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
66 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
67 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
68 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
69 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
70 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
71 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
72 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
73 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
74 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
75 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
76 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
77 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
78 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
79 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
80 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
81 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
82 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
83 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
84 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
85 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
86 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
87 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
88 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
89 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
90 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
91 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
92 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
93 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
94 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
95 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
96 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
97 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
98 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
99 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
100 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
101 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
102 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
103 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
104 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
105 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
106 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
107 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
108 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
109 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
110 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
111 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
112 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
113 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
114 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
115 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
116 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
117 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
118 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
119 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
120 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
121 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
122 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
123 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
124 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
125 2643221558 Rhizobium sp. Root149 Isolate Unclassified
126 2643221610 Ensifer sp. Root74 Isolate Unclassified
127 2643221618 Ensifer sp. Root231 Isolate Unclassified
128 2643221626 Ensifer sp. Root31 Isolate Unclassified
129 2643221655 Ensifer sp. Root1252 Isolate Unclassified
130 2643221675 Ensifer sp. Root1298 Isolate Unclassified
131 2643221680 Ensifer sp. Root1312 Isolate Unclassified
132 2643221698 Ensifer sp. Root142 Isolate Unclassified
133 2643221712 Ensifer sp. Root258 Isolate Unclassified
134 2643221726 Ensifer sp. Root954 Isolate Unclassified
135 2718217882 Rhizobium sp. N741 Isolate Nodule
136 2718217927 Rhizobium sp. N324 Isolate Nodule
137 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
138 2718218009 Rhizobium sp. N561 Isolate Nodule
139 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
140 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
141 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
142 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
143 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
144 2718218363 Rhizobium sp. N113 Isolate Nodule
145 2718218366 Rhizobium sp. N621 Isolate Nodule
146 2718218423 Rhizobium sp. N941 Isolate Nodule
147 2721755514 Rhizobium sp. N6212 Isolate Nodule
148 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
149 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
150 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
151 2721755809 Rhizobium sp. N541 Isolate Nodule
152 2721755810 Rhizobium sp. N871 Isolate Nodule
153 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
154 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
155 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
156 2728369365 Rhizobium sp. N1341 Isolate Nodule
157 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
158 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
159 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
160 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
161 2791355261 Rhizobium sp. J15 Isolate Nodule
162 2791355263 Rhizobium chutanense C5 Isolate Nodule
163 2791355264 Rhizobium sp. S9 Isolate Nodule
164 2791355267 Rhizobium sp. L18 Isolate Nodule
165 2802429633 Rhizobium anhuiense J3 Isolate Nodule
166 2802429637 Rhizobium anhuiense C15 Isolate Nodule
167 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
168 2838048938 Rhizobium pisi 27/80 Isolate Nodule
169 2838061910 Rhizobium phaseoli L15 Isolate Nodule
170 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
171 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
172 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
173 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
174 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
175 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
176 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
177 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
178 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
179 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
180 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
181 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
182 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
183 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
184 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
185 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
186 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
187 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
188 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
189 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
190 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
191 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
192 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
193 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
194 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
195 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
196 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
197 2933599457 Rhizobium phaseoli M3 Isolate Nodule
198 2936381700 Rhizobium chutanense C16 Isolate Unclassified
199 2996887358 Rhizobium sp. R711 Isolate Nodule
200 2996893221 Rhizobium sp. R635 Isolate Nodule
201 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
202 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
203 8005275841 Rhizobium sp. N4311 Isolate Nodule
204 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
205 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
206 8005321885 Rhizobium sp. R72 Isolate Nodule
207 8005382845 Rhizobium sp. R634 Isolate Nodule
208 8005395548 Rhizobium sp. R339 Isolate Nodule
209 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
210 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
211 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
212 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
213 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
214 8018176218 Rhizobium sp. N122 Isolate Nodule
215 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
216 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 62.77
Metatranscriptomes 0
Isolates 37.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.21
Nodule 27.66
Rhizoplane 5.67
Rhizosphere 23.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496122_0008279 3300048925 Bacteria 11277
2 JGI24739J22299_10027383 3300001989 Bacteria 1993
3 JGI24739J22299_10099793 3300001989 Bacteria 877
4 JGI24735J21928_10040030 3300002067 Bacteria 1369
5 JGI25159J45721_1000267 3300002987 Bacteria 24368
6 JGI25153J46596_10064244 3300003215 Bacteria 980
7 JGI25160J50197_1000060 3300003354 Bacteria 116870
8 JGI25161J50226_1000482 3300003374 Bacteria 18047
9 JGI25161J50226_1013799 3300003374 Bacteria 925
10 Ga0055528_1002487 3300003790 Bacteria 9842
11 Ga0055540_1001824 3300003792 Bacteria 12063
12 Ga0055543_1000478 3300004625 Bacteria 23469
13 Ga0055543_1000836 3300004625 Bacteria 14967
14 Ga0065165_1000160 3300005262 Bacteria 116908
15 Ga0065165_1004863 3300005262 Bacteria 7978
16 Ga0068869_100995566 3300005334 Bacteria 730
17 Ga0070660_100500215 3300005339 Bacteria 1011
18 Ga0070674_100736571 3300005356 Bacteria 846
19 Ga0070678_101346201 3300005456 Bacteria 665
20 Ga0068853_101137637 3300005539 Bacteria 753
21 Ga0070665_100097381 3300005548 Bacteria 2947
22 Ga0068855_100113571 3300005563 Bacteria 3107
23 Ga0068856_100320511 3300005614 Bacteria 1567
24 Ga0068851_10050430 3300005834 Bacteria 2113
25 Ga0081540_1000453 3300005983 Bacteria 40674
26 Ga0081540_1022953 3300005983 Bacteria 3667
27 Ga0075365_10006651 3300006038 Bacteria 6385
28 Ga0075365_10193957 3300006038 Bacteria 1422
29 Ga0075365_10378156 3300006038 Bacteria 999
30 Ga0075368_10000056 3300006042 Bacteria 27572
31 Ga0075368_10050923 3300006042 Bacteria 1646
32 Ga0075368_10177450 3300006042 Bacteria 897
33 Ga0075368_10316715 3300006042 Bacteria 675
34 Ga0075363_100003732 3300006048 Bacteria 6552
35 Ga0075363_100142140 3300006048 Bacteria 1352
36 Ga0075364_10007555 3300006051 Bacteria 6462
37 Ga0075364_10299154 3300006051 Bacteria 1095
38 Ga0075364_10637354 3300006051 Bacteria 728
39 Ga0075362_10001180 3300006177 Bacteria 8185
40 Ga0075367_10000032 3300006178 Bacteria 30839
41 Ga0075367_10001676 3300006178 Bacteria 9669
42 Ga0075367_10037718 3300006178 Bacteria 2810
43 Ga0075367_10270738 3300006178 Bacteria 1067
44 Ga0075367_10465343 3300006178 Bacteria 802
45 Ga0075369_10003588 3300006186 Bacteria 5658
46 Ga0075369_10192174 3300006186 Bacteria 941
47 Ga0075366_10001932 3300006195 Bacteria 10471
48 Ga0075366_10015692 3300006195 Bacteria 4347
49 Ga0075366_10243587 3300006195 Bacteria 1096
50 Ga0075370_10018148 3300006353 Bacteria 3813
51 Ga0075370_10222022 3300006353 Bacteria 1117
52 Ga0075370_10232012 3300006353 Bacteria 1092
53 Ga0075370_10429430 3300006353 Bacteria 794
54 Ga0099826_10000119 3300006948 Bacteria 36192
55 Ga0105240_10002091 3300009093 Bacteria 32664
56 Ga0105245_10071509 3300009098 Bacteria 3150
57 Ga0105245_10091850 3300009098 Bacteria 2794
58 Ga0105245_10931538 3300009098 Bacteria 911
59 Ga0105247_10167189 3300009101 Bacteria 1460
60 Ga0105241_10038548 3300009174 Bacteria 3602
61 Ga0105241_10367962 3300009174 Bacteria 1253
62 Ga0105237_10001252 3300009545 Bacteria 33910
63 Ga0105237_10791788 3300009545 Bacteria 955
64 Ga0123341_1013684 3300009765 Bacteria 7299
65 Ga0123342_1024480 3300009766 Bacteria 3775
66 Ga0123342_1026316 3300009766 Bacteria 3393
67 Ga0105239_10116622 3300010375 Bacteria 2963
68 Ga0157378_10216929 3300013297 Bacteria 1817
69 Ga0209436_100545 3300025208 Bacteria 16287
70 Ga0209673_1002519 3300025273 Bacteria 12566
71 Ga0209673_1002967 3300025273 Bacteria 10604
72 Ga0209130_1000136 3300025284 Bacteria 116996
73 Ga0209676_1040019 3300025292 Bacteria 1324
74 Ga0209564_1002417 3300025295 Bacteria 14822
75 Ga0209758_1005840 3300025297 Bacteria 9191
76 Ga0209758_1006565 3300025297 Bacteria 8282
77 Ga0209758_1046303 3300025297 Bacteria 1570
78 Ga0209050_1010947 3300025298 Bacteria 4383
79 Ga0209256_1003873 3300025299 Bacteria 9933
80 Ga0207426_1000210 3300025302 Bacteria 138932
81 Ga0207426_1000253 3300025302 Bacteria 116996
82 Ga0209051_1000783 3300025303 Bacteria 33598
83 Ga0209051_1013901 3300025303 Bacteria 3795
84 Ga0209257_1012626 3300025304 Bacteria 3875
85 Ga0207647_10005351 3300025904 Bacteria 9430
86 Ga0207647_10136027 3300025904 Bacteria 1442
87 Ga0207695_10000015 3300025913 Bacteria 803205
88 Ga0207671_10005048 3300025914 Bacteria 12327
89 Ga0207671_10352710 3300025914 Bacteria 1167
90 Ga0207687_10143592 3300025927 Bacteria 1814
91 Ga0207687_10455434 3300025927 Bacteria 1062
92 Ga0207669_10083329 3300025937 Bacteria 2056
93 Ga0207640_11113353 3300025981 Bacteria 699
94 Ga0207683_11289707 3300026121 Bacteria 676
95 Ga0207698_10057365 3300026142 Bacteria 3012
96 Ga0209282_1000193 3300027666 Bacteria 32692
97 Ga0209813_10000229 3300027866 Bacteria 17165
98 Ga0209813_10011158 3300027866 Bacteria 2342
99 Ga0209813_10043179 3300027866 Bacteria 1380
100 Ga0268266_10163297 3300028379 Bacteria 2016
101 Ga0307513_10062358 3300031456 Bacteria 3941
102 Ga0307408_100954493 3300031548 Bacteria 788
103 Ga0307516_10144962 3300031730 Bacteria 2141
104 Ga0439465_0064232 3300041413 Bacteria 1221
105 Ga0451851_0560625 3300041507 Bacteria 4428
106 Ga0495638_0030116 3300046460 Bacteria 3496
107 Ga0495607_0170820 3300046501 Bacteria 1098
108 Ga0495606_0039029 3300046507 Bacteria 3206
109 Ga0495616_0325968 3300046513 Bacteria 644
110 Ga0495632_0173048 3300046519 Bacteria 991
111 Ga0495632_0195153 3300046519 Bacteria 924
112 Ga0495643_0001039 3300046522 Bacteria 28149
113 Ga0495643_0088750 3300046522 Bacteria 1598
114 Ga0495648_0025228 3300046524 Bacteria 4029
115 Ga0495648_0076316 3300046524 Bacteria 1925
116 Ga0495609_0061410 3300046538 Bacteria 1660
117 Ga0495597_0062743 3300046542 Bacteria 1616
118 Ga0495668_0386602 3300046616 Bacteria 769
119 Ga0495668_0450255 3300046616 Bacteria 708
120 Ga0495649_0175669 3300046694 Bacteria 1119
121 Ga0495687_003583 3300047443 Bacteria 11138
122 Ga0495673_0086667 3300047469 Bacteria 1287
123 Ga0495681_0069273 3300047470 Bacteria 1603
124 Ga0495686_0204033 3300047472 Bacteria 1133
125 Ga0496102_0656707 3300048905 Bacteria 972
126 Ga0496104_0048794 3300048907 Bacteria 3992
127 Ga0496104_0665773 3300048907 Bacteria 950
128 Ga0496105_0015893 3300048908 Bacteria 6003
129 Ga0496105_0088883 3300048908 Bacteria 2552
130 Ga0496108_0010234 3300048911 Bacteria 7615
131 Ga0496110_0109884 3300048913 Bacteria 2476
132 Ga0496111_0140636 3300048914 Bacteria 1788
133 Ga0496112_0194280 3300048915 Bacteria 1990
134 Ga0496113_0013172 3300048916 Bacteria 5589
135 Ga0496115_0054157 3300048918 Bacteria 3221
136 Ga0496115_0287757 3300048918 Bacteria 1348
137 Ga0496116_0193135 3300048919 Bacteria 1075
138 Ga0496118_0029261 3300048921 Bacteria 4623
139 Ga0496118_0181870 3300048921 Bacteria 1269
140 Ga0496123_0030352 3300048926 Bacteria 3958
141 Ga0496124_0117644 3300048927 Bacteria 2129
142 Ga0496125_0010839 3300048928 Bacteria 9178
143 Ga0496125_0033337 3300048928 Bacteria 4558
144 Ga0496126_0006281 3300048929 Bacteria 13266
145 Ga0495682_0009633 3300049460 Bacteria 3766
146 nmdc:mga03683_118524_c1 3300050489 Bacteria 1175
147 nmdc:mga03683_138991_c1 3300050489 Bacteria 1091
148 nmdc:mga03683_25464_c1 3300050489 Bacteria 2325
149 nmdc:mga03n38_301718_c1 3300050490 Bacteria 860
150 nmdc:mga03n38_3351_c1 3300050490 Bacteria 5129
151 nmdc:mga00v17_105450_c1 3300050491 Bacteria 1783
152 nmdc:mga00v17_48000_c1 3300050491 Bacteria 2587
153 nmdc:mga00v17_484_c1 3300050491 Bacteria 22261
154 nmdc:mga0yw44_12981_c1 3300050492 Bacteria 4366
155 nmdc:mga0yw44_196489_c1 3300050492 Bacteria 1331
156 nmdc:mga0yw44_211119_c1 3300050492 Bacteria 1284
157 nmdc:mga0k408_3072_c1 3300050493 Bacteria 8845
158 nmdc:mga0k408_34891_c1 3300050493 Bacteria 2882
159 nmdc:mga0k408_84322_c1 3300050493 Bacteria 1864
160 nmdc:mga06z11_25757_c1 3300050494 Bacteria 2792
161 nmdc:mga06z11_34806_c1 3300050494 Bacteria 2474
162 nmdc:mga06z11_4734_c1 3300050494 Bacteria 5381
163 nmdc:mga06z11_519738_c1 3300050494 Bacteria 722
164 nmdc:mga06z11_561771_c1 3300050494 Bacteria 693
165 nmdc:mga04h51_140510_c1 3300050495 Bacteria 915
166 nmdc:mga04h51_39968_c1 3300050495 Bacteria 1526
167 nmdc:mga04h51_54472_c1 3300050495 Bacteria 1352
168 nmdc:mga04h51_87_c1 3300050495 Bacteria 28177
169 nmdc:mga07m45_23882_c1 3300050496 Bacteria 3344
170 nmdc:mga07m45_409507_c1 3300050496 Bacteria 787
171 nmdc:mga0sz30_10354_c1 3300050516 Bacteria 2950
172 nmdc:mga0sz30_71071_c1 3300050516 Bacteria 1498
173 Ga0495655_0110450 3300053083 Bacteria 825
174 Ga0500578_0098736 3300053086 Bacteria 1849
175 Ga0500621_233000 3300053126 Bacteria 630
176 Ga0500634_0005564 3300053161 Bacteria 5997
177 Ga0500636_0001147 3300053177 Bacteria 14205
178 2509444199 2509276033 Bacteria 7180565
179 2510306080 2510065057 Bacteria 6649661
180 2512033888 2511231221 Bacteria 6846400
181 2513592853 2513237087 Bacteria 5817514
182 2513610287 2513237090 Bacteria 7096802
183 2530644274 2529292951 Bacteria 6916614
184 2585539538 2585427528 Bacteria 6842387
185 2585837495 2585427593 Bacteria 7141551
186 2599335883 2599185156 Bacteria 5403036
187 2599940880 2599185301 Bacteria 6161860
188 2601611389 2600255279 Bacteria 5605316
189 2601748190 2600255308 Bacteria 5611129
190 2643811066 2643221558 Bacteria 5460675
191 2644067902 2643221610 Bacteria 7480339
192 2644106697 2643221618 Bacteria 7717186
193 2644148048 2643221626 Bacteria 8069654
194 2644310001 2643221655 Bacteria 7722067
195 2644417814 2643221675 Bacteria 7473456
196 2644451242 2643221680 Bacteria 7473610
197 2644545592 2643221698 Bacteria 7756764
198 2644616219 2643221712 Bacteria 7729434
199 2644687368 2643221726 Bacteria 7455827
200 2719179348 2718217882 Bacteria 6556348
201 2719388631 2718217927 Bacteria 6972593
202 2719668197 2718217997 Bacteria 6740740
203 2719730018 2718218009 Bacteria 6478651
204 2720494960 2718218199 Bacteria 6740745
205 2720611283 2718218232 Bacteria 6720332
206 2720616451 2718218233 Bacteria 6662049
207 2720629536 2718218235 Bacteria 6630699
208 2720772109 2718218269 Bacteria 6906114
209 2721145441 2718218363 Bacteria 6524337
210 2721162336 2718218366 Bacteria 6425255
211 2721403256 2718218423 Bacteria 6438183
212 2722838506 2721755514 Bacteria 6424414
213 2723029534 2721755556 Bacteria 6745503
214 2723563140 2721755684 Bacteria 6859907
215 2723571134 2721755685 Bacteria 6704835
216 2724035613 2721755809 Bacteria 6438790
217 2724042774 2721755810 Bacteria 6479005
218 2724086929 2721755819 Bacteria 6906405
219 2724107085 2721755822 Bacteria 6726041
220 2730105848 2728369352 Bacteria 6745171
221 2730162585 2728369365 Bacteria 6555560
222 2739036768 2738541333 Bacteria 7106503
223 2739350553 2738543031 Bacteria 5769731
224 2753460619 2751185821 Bacteria 6189929
225 2793318009 2791355259 Bacteria 7254731
226 2793325795 2791355261 Bacteria 6661293
227 2793344203 2791355263 Bacteria 6872478
228 2793348350 2791355264 Bacteria 6429314
229 2793370793 2791355267 Bacteria 7222458
230 2806048468 2802429633 Bacteria 7341974
231 2806073524 2802429637 Bacteria 7067217
232 2838045385 2838042994 Bacteria 6046894
233 2838054487 2838048938 Bacteria 6044578
234 2838062990 2838061910 Bacteria 6794874
235 2838071942 2838068647 Bacteria 6208656
236 2840764729 2840764183 Bacteria 6358399
237 2841869262 2841864319 Bacteria 6742987
238 2842269423 2842264693 Bacteria 6472963
239 2842288007 2842285085 Bacteria 6011953
240 2842312041 2842311132 Bacteria 6616990
241 2842344197 2842341865 Bacteria 7003929
242 2842368101 2842363717 Bacteria 6844742
243 2842396554 2842395702 Bacteria 6780583
244 2842405273 2842402390 Bacteria 6681310
245 2842411970 2842409023 Bacteria 6687331
246 2842418503 2842415677 Bacteria 6596907
247 2842425575 2842422224 Bacteria 6239196
248 2842432620 2842428310 Bacteria 6767288
249 2842438933 2842434925 Bacteria 6502746
250 2842445562 2842441272 Bacteria 6769273
251 2842450015 2842447887 Bacteria 6754142
252 2842467807 2842462802 Bacteria 6588055
253 2842473547 2842469257 Bacteria 6752936
254 2842926965 2842922631 Bacteria 5824079
255 2848996789 2848992105 Bacteria 6810864
256 2855875287 2855872281 Bacteria 6964271
257 2857537299 2857531043 Bacteria 6754041
258 2881153375 2881147464 Bacteria 7779814
259 2906634363 2906626472 Bacteria 8826946
260 2913296519 2913295892 Bacteria 6333755
261 2917700046 2917699015 Bacteria 7043791
262 2933602736 2933599457 Bacteria 5858799
263 2936387219 2936381700 Bacteria 7006523
264 2996890624 2996887358 Bacteria 5795980
265 2996895579 2996893221 Bacteria 5823108
266 2996896822 2996893221 Bacteria 5823108
267 3000021214 3000017691 Bacteria 3772574
268 643822729 643692032 Bacteria 6891900
269 8005277349 8005275841 Bacteria 6929066
270 8005286390 8005282627 Bacteria 6675747
271 8005291287 8005289223 Bacteria 6634003
272 8005325151 8005321885 Bacteria 5795980
273 8005388704 8005382845 Bacteria 6732062
274 8005397936 8005395548 Bacteria 6806915
275 8005503213 8005497431 Bacteria 6477605
276 8005625356 8005619151 Bacteria 7030230
277 8005630753 8005626139 Bacteria 6534237
278 8005675131 8005668836 Bacteria 6953162
279 8005701739 8005695170 Bacteria 6912330
280 8018182427 8018176218 Bacteria 6896178
281 8056375467 8056375014 Bacteria 7006639
282 8057533196 8057529695 Bacteria 6306553
283 Ga0496122_0008279
284 JGI24739J22299_10027383
285 JGI24739J22299_10099793
286 JGI24735J21928_10040030
287 JGI25159J45721_1000267
288 JGI25153J46596_10064244
289 JGI25160J50197_1000060
290 JGI25161J50226_1000482
291 JGI25161J50226_1013799
292 Ga0055528_1002487
293 Ga0055540_1001824
294 Ga0055543_1000478
295 Ga0055543_1000836
296 Ga0065165_1000160
297 Ga0065165_1004863
298 Ga0068869_100995566
299 Ga0070660_100500215
300 Ga0070674_100736571
301 Ga0070678_101346201
302 Ga0068853_101137637
303 Ga0070665_100097381
304 Ga0068855_100113571
305 Ga0068856_100320511
306 Ga0068851_10050430
307 Ga0081540_1000453
308 Ga0081540_1022953
309 Ga0075365_10006651
310 Ga0075365_10193957
311 Ga0075365_10378156
312 Ga0075368_10000056
313 Ga0075368_10050923
314 Ga0075368_10177450
315 Ga0075368_10316715
316 Ga0075363_100003732
317 Ga0075363_100142140
318 Ga0075364_10007555
319 Ga0075364_10299154
320 Ga0075364_10637354
321 Ga0075362_10001180
322 Ga0075367_10000032
323 Ga0075367_10001676
324 Ga0075367_10037718
325 Ga0075367_10270738
326 Ga0075367_10465343
327 Ga0075369_10003588
328 Ga0075369_10192174
329 Ga0075366_10001932
330 Ga0075366_10015692
331 Ga0075366_10243587
332 Ga0075370_10018148
333 Ga0075370_10222022
334 Ga0075370_10232012
335 Ga0075370_10429430
336 Ga0099826_10000119
337 Ga0105240_10002091
338 Ga0105245_10071509
339 Ga0105245_10091850
340 Ga0105245_10931538
341 Ga0105247_10167189
342 Ga0105241_10038548
343 Ga0105241_10367962
344 Ga0105237_10001252
345 Ga0105237_10791788
346 Ga0123341_1013684
347 Ga0123342_1024480
348 Ga0123342_1026316
349 Ga0105239_10116622
350 Ga0157378_10216929
351 Ga0209436_100545
352 Ga0209673_1002519
353 Ga0209673_1002967
354 Ga0209130_1000136
355 Ga0209676_1040019
356 Ga0209564_1002417
357 Ga0209758_1005840
358 Ga0209758_1006565
359 Ga0209758_1046303
360 Ga0209050_1010947
361 Ga0209256_1003873
362 Ga0207426_1000210
363 Ga0207426_1000253
364 Ga0209051_1000783
365 Ga0209051_1013901
366 Ga0209257_1012626
367 Ga0207647_10005351
368 Ga0207647_10136027
369 Ga0207695_10000015
370 Ga0207671_10005048
371 Ga0207671_10352710
372 Ga0207687_10143592
373 Ga0207687_10455434
374 Ga0207669_10083329
375 Ga0207640_11113353
376 Ga0207683_11289707
377 Ga0207698_10057365
378 Ga0209282_1000193
379 Ga0209813_10000229
380 Ga0209813_10011158
381 Ga0209813_10043179
382 Ga0268266_10163297
383 Ga0307513_10062358
384 Ga0307408_100954493
385 Ga0307516_10144962
386 Ga0439465_0064232
387 Ga0451851_0560625
388 Ga0495638_0030116
389 Ga0495607_0170820
390 Ga0495606_0039029
391 Ga0495616_0325968
392 Ga0495632_0173048
393 Ga0495632_0195153
394 Ga0495643_0001039
395 Ga0495643_0088750
396 Ga0495648_0025228
397 Ga0495648_0076316
398 Ga0495609_0061410
399 Ga0495597_0062743
400 Ga0495668_0386602
401 Ga0495668_0450255
402 Ga0495649_0175669
403 Ga0495687_003583
404 Ga0495673_0086667
405 Ga0495681_0069273
406 Ga0495686_0204033
407 Ga0496102_0656707
408 Ga0496104_0048794
409 Ga0496104_0665773
410 Ga0496105_0015893
411 Ga0496105_0088883
412 Ga0496108_0010234
413 Ga0496110_0109884
414 Ga0496111_0140636
415 Ga0496112_0194280
416 Ga0496113_0013172
417 Ga0496115_0054157
418 Ga0496115_0287757
419 Ga0496116_0193135
420 Ga0496118_0029261
421 Ga0496118_0181870
422 Ga0496123_0030352
423 Ga0496124_0117644
424 Ga0496125_0010839
425 Ga0496125_0033337
426 Ga0496126_0006281
427 Ga0495682_0009633
428 nmdc:mga03683_118524_c1
429 nmdc:mga03683_138991_c1
430 nmdc:mga03683_25464_c1
431 nmdc:mga03n38_301718_c1
432 nmdc:mga03n38_3351_c1
433 nmdc:mga00v17_105450_c1
434 nmdc:mga00v17_48000_c1
435 nmdc:mga00v17_484_c1
436 nmdc:mga0yw44_12981_c1
437 nmdc:mga0yw44_196489_c1
438 nmdc:mga0yw44_211119_c1
439 nmdc:mga0k408_3072_c1
440 nmdc:mga0k408_34891_c1
441 nmdc:mga0k408_84322_c1
442 nmdc:mga06z11_25757_c1
443 nmdc:mga06z11_34806_c1
444 nmdc:mga06z11_4734_c1
445 nmdc:mga06z11_519738_c1
446 nmdc:mga06z11_561771_c1
447 nmdc:mga04h51_140510_c1
448 nmdc:mga04h51_39968_c1
449 nmdc:mga04h51_54472_c1
450 nmdc:mga04h51_87_c1
451 nmdc:mga07m45_23882_c1
452 nmdc:mga07m45_409507_c1
453 nmdc:mga0sz30_10354_c1
454 nmdc:mga0sz30_71071_c1
455 Ga0495655_0110450
456 Ga0500578_0098736
457 Ga0500621_233000
458 Ga0500634_0005564
459 Ga0500636_0001147
460 2509444199
461 2510306080
462 2512033888
463 2513592853
464 2513610287
465 2530644274
466 2585539538
467 2585837495
468 2599335883
469 2599940880
470 2601611389
471 2601748190
472 2643811066
473 2644067902
474 2644106697
475 2644148048
476 2644310001
477 2644417814
478 2644451242
479 2644545592
480 2644616219
481 2644687368
482 2719179348
483 2719388631
484 2719668197
485 2719730018
486 2720494960
487 2720611283
488 2720616451
489 2720629536
490 2720772109
491 2721145441
492 2721162336
493 2721403256
494 2722838506
495 2723029534
496 2723563140
497 2723571134
498 2724035613
499 2724042774
500 2724086929
501 2724107085
502 2730105848
503 2730162585
504 2739036768
505 2739350553
506 2753460619
507 2793318009
508 2793325795
509 2793344203
510 2793348350
511 2793370793
512 2806048468
513 2806073524
514 2838045385
515 2838054487
516 2838062990
517 2838071942
518 2840764729
519 2841869262
520 2842269423
521 2842288007
522 2842312041
523 2842344197
524 2842368101
525 2842396554
526 2842405273
527 2842411970
528 2842418503
529 2842425575
530 2842432620
531 2842438933
532 2842445562
533 2842450015
534 2842467807
535 2842473547
536 2842926965
537 2848996789
538 2855875287
539 2857537299
540 2881153375
541 2906634363
542 2913296519
543 2917700046
544 2933602736
545 2936387219
546 2996890624
547 2996895579
548 2996896822
549 3000021214
550 643822729
551 8005277349
552 8005286390
553 8005291287
554 8005325151
555 8005388704
556 8005397936
557 8005503213
558 8005625356
559 8005630753
560 8005675131
561 8005701739
562 8018182427
563 8056375467
564 8057533196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

25

71

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zui-assembly1.cif.gz_A crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid 0.8436 11 92
4l62-assembly1.cif.gz_C crystal structure of pseudomonas aeruginosa transcriptional regulator pa2196 bound to its operator dna 0.8307 9 187
4yze-assembly2.cif.gz_D crystal structure of e.coli nemr reduced form 0.8275 10 187
4yze-assembly1.cif.gz_A crystal structure of e.coli nemr reduced form 0.8265 10 186
4yze-assembly1.cif.gz_C crystal structure of e.coli nemr reduced form 0.8184 11 187
ID Description Score Start End Superfamily
5k7fA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9222 12 51 1.10.10.60
3mvpA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8963 7 51 1.10.10.60
3btjA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8961 11 57 1.10.10.60
1jupD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8958 13 57 1.10.10.60
1jt6A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.895 11 57 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A537SE70-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9628 1 197 GO:0003677
GO:0006355
AF-A0A537SE70-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9487 1 197 GO:0003677
GO:0006355
AF-A0A2E2SX77-F1-model_v4 TetR family transcriptional regulator 0.9473 1 187 GO:0003677
GO:0006355
AF-A0A7W4JFA3-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9425 1 192 GO:0003677
GO:0006355
GO:0016020
AF-A0A7V8NUN3-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9362 1 188 GO:0003677
GO:0006355

Map