F385449

General Info

Members Datasets Scaffolds Average Seq Length
283 199 566 232

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100146626|Ga0070664_1001466262
Length 269
Sequence MTGRGRELQLPLNNAMDKVELHQPWSKSRRGDMNFPRKLAAEALGTALLLTVVIGSGIMAQRLSGGNVAIALLANTLATVGGLYILIEVFGPISGAHFNPAVSAAMAWRDEFPKAALVPYIAAQLLGAMLGAWLAHAMFDLPIVQWSTKVRDGTGQWIAEAVATAGLLLVILRAPAGRAAVMVASYIGAAYWFTASTSFANPAAVFGRMFSDSFAGIAPSSAPAFVLAQLVGAAIGLVLHNAFEPQVQPAGAAQCDRTSSDATASGVNR

Samples

Sample ID Description Type Environment
1 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
50 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
89 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
90 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
93 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
94 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
95 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
102 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
112 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
113 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
114 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
115 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
116 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
117 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
118 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
119 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
120 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
121 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
122 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
123 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
124 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
125 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
126 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
127 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
128 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
129 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
130 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
131 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
146 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
152 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
153 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
161 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
162 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
163 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
164 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
165 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
168 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
175 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
176 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
177 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
178 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
179 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
180 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
181 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
182 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
183 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
184 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
185 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
186 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
187 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
188 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
189 2738541337 Pelomonas sp. BT06 Isolate Unclassified
190 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
191 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
192 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
193 2831864461 Roseateles noduli HZ7 Isolate Nodule
194 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
195 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
196 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
197 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
198 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
199 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.7
Metatranscriptomes 0
Isolates 5.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.37
Nodule 1.41
Rhizoplane 2.12
Rhizosphere 65.02
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070664_100146626 3300005564 Bacteria 2081
2 rootH2_10037925 3300003320 Bacteria 1589
3 rootH1_10004508 3300003323 Bacteria 3940
4 Ga0055525_1000161 3300003759 Bacteria 87478
5 Ga0070658_10078663 3300005327 Bacteria 2707
6 Ga0070658_10738006 3300005327 Bacteria 855
7 Ga0070670_100017285 3300005331 Bacteria 6186
8 Ga0070670_100046827 3300005331 Bacteria 3720
9 Ga0070670_100309802 3300005331 Bacteria 1382
10 Ga0070677_10227036 3300005333 Bacteria 915
11 Ga0068869_100214867 3300005334 Bacteria 1522
12 Ga0070682_100059112 3300005337 Bacteria 2420
13 Ga0068868_100066983 3300005338 Bacteria 2857
14 Ga0068868_100069178 3300005338 Bacteria 2813
15 Ga0070661_100057729 3300005344 Bacteria 2844
16 Ga0070668_100611020 3300005347 Bacteria 955
17 Ga0070675_100472359 3300005354 Bacteria 1127
18 Ga0070671_100038707 3300005355 Bacteria 3957
19 Ga0070671_100080623 3300005355 Bacteria 2721
20 Ga0070671_100115656 3300005355 Bacteria 2255
21 Ga0070671_100399103 3300005355 Bacteria 1176
22 Ga0070671_100659463 3300005355 Bacteria 906
23 Ga0070673_100371181 3300005364 Bacteria 1274
24 Ga0070708_100130222 3300005445 Bacteria 2328
25 Ga0070663_100105648 3300005455 Bacteria 2108
26 Ga0070662_100003855 3300005457 Bacteria 9401
27 Ga0068867_100012527 3300005459 Bacteria 6000
28 Ga0068867_100502091 3300005459 Bacteria 1043
29 Ga0070672_100026653 3300005543 Bacteria 4305
30 Ga0070672_100057411 3300005543 Bacteria 3055
31 Ga0070672_100387191 3300005543 Bacteria 1197
32 Ga0068855_100087897 3300005563 Bacteria 3591
33 Ga0070664_100069377 3300005564 Bacteria 3016
34 Ga0070664_100277959 3300005564 Bacteria 1509
35 Ga0068857_100553529 3300005577 Bacteria 1084
36 Ga0068854_100053331 3300005578 Bacteria 2904
37 Ga0068854_100068853 3300005578 Bacteria 2582
38 Ga0068854_100155020 3300005578 Bacteria 1769
39 Ga0068856_100046464 3300005614 Bacteria 4276
40 Ga0068859_100169966 3300005617 Bacteria 2261
41 Ga0068864_100075837 3300005618 Bacteria 2937
42 Ga0068864_100090514 3300005618 Bacteria 2697
43 Ga0068864_100323374 3300005618 Bacteria 1449
44 Ga0068863_100134197 3300005841 Bacteria 2364
45 Ga0068863_100149504 3300005841 Bacteria 2234
46 Ga0075365_10032923 3300006038 Bacteria 3335
47 Ga0075363_100029215 3300006048 Bacteria 2844
48 Ga0075362_10002378 3300006177 Bacteria 6300
49 Ga0075362_10082374 3300006177 Bacteria 1484
50 Ga0075367_10188031 3300006178 Bacteria 1288
51 Ga0075366_10015248 3300006195 Bacteria 4400
52 Ga0075366_10103237 3300006195 Bacteria 1712
53 Ga0097621_100135302 3300006237 Bacteria 2101
54 Ga0075370_10011190 3300006353 Bacteria 4711
55 Ga0075370_10020292 3300006353 Bacteria 3630
56 Ga0075370_10050314 3300006353 Bacteria 2363
57 Ga0097620_100169971 3300006931 Bacteria 2261
58 Ga0105245_10008074 3300009098 Bacteria 9202
59 Ga0105243_10070502 3300009148 Bacteria 2823
60 Ga0105248_10060338 3300009177 Bacteria 4257
61 Ga0105248_10092715 3300009177 Bacteria 3402
62 Ga0105248_10672469 3300009177 Bacteria 1168
63 Ga0105237_10007106 3300009545 Bacteria 12303
64 Ga0157378_10108127 3300013297 Bacteria 2546
65 Ga0163162_10178697 3300013306 Bacteria 2248
66 Ga0163162_10453578 3300013306 Bacteria 1414
67 Ga0157375_10015775 3300013308 Bacteria 6770
68 Ga0157375_10317460 3300013308 Bacteria 1722
69 Ga0157380_10068481 3300014326 Bacteria 2861
70 Ga0157379_10124400 3300014968 Bacteria 2320
71 Ga0157379_10356748 3300014968 Bacteria 1339
72 Ga0157379_10390653 3300014968 Bacteria 1278
73 Ga0157376_10037102 3300014969 Bacteria 3953
74 Ga0157376_10048949 3300014969 Bacteria 3499
75 Ga0157376_10584366 3300014969 Bacteria 1110
76 Ga0213872_10023668 3300021361 Bacteria 2826
77 Ga0209563_100014 3300025230 Bacteria 940582
78 Ga0209563_100088 3300025230 Bacteria 175375
79 Ga0209677_100966 3300025253 Bacteria 13973
80 Ga0209759_1000621 3300025256 Bacteria 33854
81 Ga0209673_1011712 3300025273 Bacteria 3593
82 Ga0209051_1005833 3300025303 Bacteria 7088
83 Ga0209051_1014026 3300025303 Bacteria 3767
84 Ga0209257_1000170 3300025304 Bacteria 169384
85 Ga0209257_1038031 3300025304 Bacteria 1462
86 Ga0207656_10064287 3300025321 Bacteria 1617
87 Ga0207682_10263320 3300025893 Bacteria 804
88 Ga0207642_10266018 3300025899 Bacteria 980
89 Ga0207645_10034292 3300025907 Bacteria 3261
90 Ga0207705_10165846 3300025909 Bacteria 1661
91 Ga0207695_10061390 3300025913 Bacteria 3885
92 Ga0207671_10021738 3300025914 Bacteria 4862
93 Ga0207657_10022968 3300025919 Bacteria 5819
94 Ga0207649_10005414 3300025920 Bacteria 6911
95 Ga0207681_10207803 3300025923 Bacteria 1507
96 Ga0207694_10353328 3300025924 Bacteria 1217
97 Ga0207650_10169146 3300025925 Bacteria 1736
98 Ga0207659_10160125 3300025926 Bacteria 1766
99 Ga0207687_10141939 3300025927 Bacteria 1823
100 Ga0207644_10087983 3300025931 Bacteria 2310
101 Ga0207690_10004906 3300025932 Bacteria 7893
102 Ga0207706_10005105 3300025933 Bacteria 12257
103 Ga0207709_10119071 3300025935 Bacteria 1779
104 Ga0207691_10026022 3300025940 Bacteria 5492
105 Ga0207691_10026470 3300025940 Bacteria 5440
106 Ga0207691_10147401 3300025940 Bacteria 2071
107 Ga0207691_10175369 3300025940 Bacteria 1875
108 Ga0207711_10040601 3300025941 Bacteria 3959
109 Ga0207689_10091923 3300025942 Bacteria 2493
110 Ga0207689_10782202 3300025942 Bacteria 806
111 Ga0207679_10001398 3300025945 Bacteria 15215
112 Ga0207679_10307379 3300025945 Bacteria 1369
113 Ga0207667_10052746 3300025949 Bacteria 4281
114 Ga0207651_10399490 3300025960 Bacteria 1169
115 Ga0207668_10070933 3300025972 Bacteria 2487
116 Ga0207640_10200184 3300025981 Bacteria 1513
117 Ga0207677_10309787 3300026023 Bacteria 1308
118 Ga0207678_10109621 3300026067 Bacteria 2355
119 Ga0207678_10156803 3300026067 Bacteria 1944
120 Ga0207702_10072737 3300026078 Bacteria 2964
121 Ga0207641_10012570 3300026088 Bacteria 6939
122 Ga0207641_10142197 3300026088 Bacteria 2166
123 Ga0207648_10020467 3300026089 Bacteria 5958
124 Ga0207648_10327050 3300026089 Bacteria 1378
125 Ga0207676_10128295 3300026095 Bacteria 2152
126 Ga0207676_10399883 3300026095 Bacteria 1283
127 Ga0207674_10030811 3300026116 Bacteria 5638
128 Ga0207683_10138189 3300026121 Bacteria 2194
129 Ga0207683_10446700 3300026121 Bacteria 1192
130 Ga0207698_10190054 3300026142 Bacteria 1828
131 Ga0265334_10033931 3300028573 Bacteria 2028
132 Ga0265336_10000010 3300028666 Bacteria 277947
133 Ga0307517_10000590 3300028786 Bacteria 61880
134 Ga0307517_10045602 3300028786 Bacteria 4599
135 Ga0307517_10090670 3300028786 Bacteria 2505
136 Ga0307517_10135674 3300028786 Bacteria 1751
137 Ga0307515_10034722 3300028794 Bacteria 8238
138 Ga0307515_10038264 3300028794 Bacteria 7681
139 Ga0307515_10039529 3300028794 Bacteria 7496
140 Ga0307515_10285488 3300028794 Bacteria 1352
141 Ga0265324_10001297 3300029957 Bacteria 14681
142 Ga0307511_10014052 3300030521 Bacteria 7796
143 Ga0307512_10166294 3300030522 Bacteria 1277
144 Ga0316181_1250493 3300030744 Bacteria 1228
145 Ga0265327_10027221 3300031251 Bacteria 3296
146 Ga0265316_10007313 3300031344 Bacteria 10416
147 Ga0307513_10016444 3300031456 Bacteria 8920
148 Ga0307513_10054767 3300031456 Bacteria 4274
149 Ga0307509_10037088 3300031507 Bacteria 5330
150 Ga0307408_100101013 3300031548 Bacteria 2198
151 Ga0307408_100411845 3300031548 Bacteria 1163
152 Ga0307508_10003427 3300031616 Bacteria 16040
153 Ga0307514_10052531 3300031649 Bacteria 3150
154 Ga0307514_10082434 3300031649 Bacteria 2374
155 Ga0307516_10000774 3300031730 Bacteria 43669
156 Ga0307516_10001150 3300031730 Bacteria 36999
157 Ga0307516_10088491 3300031730 Bacteria 2929
158 Ga0307516_10158244 3300031730 Bacteria 2018
159 Ga0307516_10222017 3300031730 Bacteria 1598
160 Ga0307516_10330162 3300031730 Bacteria 1194
161 Ga0307406_10390480 3300031901 Bacteria 1100
162 Ga0307416_100067100 3300032002 Bacteria 2957
163 Ga0307507_10017213 3300033179 Bacteria 8326
164 Ga0395900_0047528 3300037418 Bacteria 4419
165 Ga0395898_0158333 3300037466 Bacteria 2166
166 Ga0395905_0019996 3300037471 Bacteria 6344
167 Ga0395905_0038604 3300037471 Bacteria 4480
168 Ga0395901_0051388 3300038443 Bacteria 4286
169 Ga0395901_0053186 3300038443 Bacteria 4208
170 Ga0395901_0563454 3300038443 Bacteria 1153
171 Ga0436361_0578582 3300039447 Bacteria 2883
172 Ga0436361_0890364 3300039447 Bacteria 5395
173 Ga0439436_0115854 3300041404 Bacteria 749
174 Ga0439447_023335 3300041407 Bacteria 1613
175 Ga0439465_0061262 3300041413 Bacteria 1247
176 Ga0451797_1010639 3300041453 Bacteria 1463
177 Ga0451802_1935786 3300041460 Bacteria 2773
178 Ga0451807_1617251 3300041486 Bacteria 1034
179 Ga0451837_0693531 3300041494 Bacteria 4281
180 Ga0451843_1483157 3300041509 Bacteria 2386
181 Ga0439432_009863 3300042006 Bacteria 3322
182 Ga0439449_0012468 3300042007 Bacteria 3195
183 Ga0439449_0017496 3300042007 Bacteria 2692
184 Ga0439455_0043892 3300042012 Bacteria 1152
185 Ga0439457_002415 3300042014 Bacteria 5342
186 Ga0450921_004372 3300042123 Bacteria 1029
187 Ga0450923_003658 3300042125 Bacteria 2347
188 Ga0450898_004738 3300042134 Bacteria 2025
189 Ga0450909_005789 3300042185 Bacteria 1780
190 Ga0439459_0000369 3300042438 Bacteria 5589
191 Ga0450893_0037432 3300042532 Bacteria 880
192 Ga0466969_0000031 3300044656 Bacteria 86708
193 Ga0453683_0005828 3300044673 Bacteria 8530
194 Ga0466966_0008455 3300044684 Bacteria 6813
195 Ga0466966_0159528 3300044684 Bacteria 1373
196 Ga0466961_0001650 3300044693 Bacteria 13863
197 Ga0466961_0215455 3300044693 Bacteria 1184
198 Ga0466964_0003954 3300044706 Bacteria 5448
199 Ga0466970_0017396 3300044765 Bacteria 3715
200 Ga0466957_0565308 3300044842 Bacteria 793
201 Ga0466959_0000156 3300045049 Bacteria 44750
202 Ga0451576_0004194 3300045051 Bacteria 18960
203 Ga0466958_0020136 3300045836 Bacteria 3889
204 Ga0466967_0034824 3300045976 Bacteria 4279
205 Ga0466967_0112000 3300045976 Bacteria 2508
206 Ga0495592_0000247 3300046454 Bacteria 46240
207 Ga0495638_0078407 3300046460 Bacteria 2010
208 Ga0495580_0268631 3300046472 Bacteria 1165
209 Ga0495639_0025442 3300046475 Bacteria 2611
210 Ga0495632_0003193 3300046519 Bacteria 11806
211 Ga0495663_0004016 3300046525 Bacteria 4178
212 Ga0495625_0024940 3300046660 Bacteria 4542
213 Ga0495625_0163776 3300046660 Bacteria 1488
214 Ga0495647_0048136 3300046681 Bacteria 1648
215 Ga0495658_0219204 3300046683 Bacteria 1191
216 Ga0495613_0602433 3300046689 Bacteria 731
217 Ga0495671_0013226 3300046692 Bacteria 4479
218 Ga0495649_0001293 3300046694 Bacteria 19127
219 Ga0495660_0013930 3300046810 Bacteria 4661
220 Ga0495687_000153 3300047443 Bacteria 105215
221 Ga0495687_016220 3300047443 Bacteria 3751
222 Ga0495687_016221 3300047443 Bacteria 3751
223 Ga0496102_0234169 3300048905 Bacteria 1731
224 Ga0496108_0248867 3300048911 Bacteria 1546
225 Ga0496110_0219194 3300048913 Bacteria 1730
226 Ga0501300_004943 3300049523 Bacteria 1969
227 Ga0501034_0000124 3300049571 Bacteria 142890
228 Ga0501202_017128 3300049652 Bacteria 1413
229 Ga0501223_021782 3300049663 Bacteria 1253
230 Ga0501255_001543 3300049684 Bacteria 1881
231 Ga0501221_001790 3300049704 Bacteria 3586
232 Ga0501229_001878 3300049706 Bacteria 2459
233 Ga0501267_000591 3300049764 Bacteria 2868
234 Ga0501035_0092805 3300049822 Bacteria 2656
235 Ga0501226_009647 3300049853 Bacteria 1074
236 nmdc:mga03683_2403_c1 3300050489 Bacteria 5809
237 nmdc:mga03683_8494_c1 3300050489 Bacteria 3614
238 nmdc:mga00v17_15871_c1 3300050491 Bacteria 4237
239 nmdc:mga0yw44_210420_c1 3300050492 Bacteria 1286
240 nmdc:mga0yw44_92658_c1 3300050492 Bacteria 1912
241 nmdc:mga0k408_16072_c1 3300050493 Bacteria 4146
242 nmdc:mga0k408_29128_c1 3300050493 Bacteria 3142
243 nmdc:mga0k408_3441_c1 3300050493 Bacteria 8383
244 nmdc:mga0k408_429876_c1 3300050493 Bacteria 785
245 nmdc:mga0k408_65487_c1 3300050493 Bacteria 2115
246 nmdc:mga06z11_19097_c1 3300050494 Bacteria 3144
247 nmdc:mga06z11_343854_c1 3300050494 Bacteria 892
248 nmdc:mga07m45_112263_c1 3300050496 Bacteria 1571
249 nmdc:mga07m45_207237_c1 3300050496 Bacteria 1141
250 nmdc:mga07m45_22242_c1 3300050496 Bacteria 3460
251 nmdc:mga07m45_28990_c1 3300050496 Bacteria 3058
252 nmdc:mga07m45_337597_c1 3300050496 Bacteria 876
253 nmdc:mga07m45_7738_c1 3300050496 Bacteria 5498
254 nmdc:mga07m45_86846_c1 3300050496 Bacteria 1789
255 nmdc:mga0sz30_55158_c1 3300050516 Bacteria 1691
256 Ga0500635_0015025 3300053080 Bacteria 2279
257 Ga0500583_0040298 3300053092 Bacteria 2115
258 Ga0500583_0288039 3300053092 Bacteria 805
259 Ga0500651_0092565 3300053093 Bacteria 1860
260 Ga0500650_0024893 3300053098 Bacteria 2673
261 Ga0500594_0068553 3300053118 Bacteria 1038
262 Ga0500655_001209 3300053133 Bacteria 4914
263 Ga0500658_0008365 3300053134 Bacteria 3824
264 Ga0500559_0000135 3300053136 Bacteria 56960
265 Ga0500559_0037646 3300053136 Bacteria 2098
266 Ga0500559_0142350 3300053136 Bacteria 1123
267 Ga0500568_0017987 3300053139 Bacteria 3106
268 Ga0500604_0001946 3300053151 Bacteria 5742
269 2513566597 2513237083 Bacteria 8410967
270 2516019805 2515154189 Bacteria 9629850
271 2644219416 2643221639 Bacteria 6649903
272 2644243101 2643221644 Bacteria 6865017
273 2739054308 2738541337 Bacteria 6183410
274 2746086317 2744054900 Bacteria 8399525
275 2746093317 2744054901 Bacteria 8397047
276 2792838933 2791355137 Bacteria 9654227
277 2831867003 2831864461 Bacteria 6502356
278 2885197200 2885192300 Bacteria 5882526
279 2900642776 2900634093 Bacteria 10263517
280 2904622818 2904615490 Bacteria 10047340
281 2954768204 2954767861 Bacteria 5535784
282 8003962902 8003955200 Bacteria 8601927
283 8055307641 8055301274 Bacteria 8587385
284 Ga0070664_100146626
285 rootH2_10037925
286 rootH1_10004508
287 Ga0055525_1000161
288 Ga0070658_10078663
289 Ga0070658_10738006
290 Ga0070670_100017285
291 Ga0070670_100046827
292 Ga0070670_100309802
293 Ga0070677_10227036
294 Ga0068869_100214867
295 Ga0070682_100059112
296 Ga0068868_100066983
297 Ga0068868_100069178
298 Ga0070661_100057729
299 Ga0070668_100611020
300 Ga0070675_100472359
301 Ga0070671_100038707
302 Ga0070671_100080623
303 Ga0070671_100115656
304 Ga0070671_100399103
305 Ga0070671_100659463
306 Ga0070673_100371181
307 Ga0070708_100130222
308 Ga0070663_100105648
309 Ga0070662_100003855
310 Ga0068867_100012527
311 Ga0068867_100502091
312 Ga0070672_100026653
313 Ga0070672_100057411
314 Ga0070672_100387191
315 Ga0068855_100087897
316 Ga0070664_100069377
317 Ga0070664_100277959
318 Ga0068857_100553529
319 Ga0068854_100053331
320 Ga0068854_100068853
321 Ga0068854_100155020
322 Ga0068856_100046464
323 Ga0068859_100169966
324 Ga0068864_100075837
325 Ga0068864_100090514
326 Ga0068864_100323374
327 Ga0068863_100134197
328 Ga0068863_100149504
329 Ga0075365_10032923
330 Ga0075363_100029215
331 Ga0075362_10002378
332 Ga0075362_10082374
333 Ga0075367_10188031
334 Ga0075366_10015248
335 Ga0075366_10103237
336 Ga0097621_100135302
337 Ga0075370_10011190
338 Ga0075370_10020292
339 Ga0075370_10050314
340 Ga0097620_100169971
341 Ga0105245_10008074
342 Ga0105243_10070502
343 Ga0105248_10060338
344 Ga0105248_10092715
345 Ga0105248_10672469
346 Ga0105237_10007106
347 Ga0157378_10108127
348 Ga0163162_10178697
349 Ga0163162_10453578
350 Ga0157375_10015775
351 Ga0157375_10317460
352 Ga0157380_10068481
353 Ga0157379_10124400
354 Ga0157379_10356748
355 Ga0157379_10390653
356 Ga0157376_10037102
357 Ga0157376_10048949
358 Ga0157376_10584366
359 Ga0213872_10023668
360 Ga0209563_100014
361 Ga0209563_100088
362 Ga0209677_100966
363 Ga0209759_1000621
364 Ga0209673_1011712
365 Ga0209051_1005833
366 Ga0209051_1014026
367 Ga0209257_1000170
368 Ga0209257_1038031
369 Ga0207656_10064287
370 Ga0207682_10263320
371 Ga0207642_10266018
372 Ga0207645_10034292
373 Ga0207705_10165846
374 Ga0207695_10061390
375 Ga0207671_10021738
376 Ga0207657_10022968
377 Ga0207649_10005414
378 Ga0207681_10207803
379 Ga0207694_10353328
380 Ga0207650_10169146
381 Ga0207659_10160125
382 Ga0207687_10141939
383 Ga0207644_10087983
384 Ga0207690_10004906
385 Ga0207706_10005105
386 Ga0207709_10119071
387 Ga0207691_10026022
388 Ga0207691_10026470
389 Ga0207691_10147401
390 Ga0207691_10175369
391 Ga0207711_10040601
392 Ga0207689_10091923
393 Ga0207689_10782202
394 Ga0207679_10001398
395 Ga0207679_10307379
396 Ga0207667_10052746
397 Ga0207651_10399490
398 Ga0207668_10070933
399 Ga0207640_10200184
400 Ga0207677_10309787
401 Ga0207678_10109621
402 Ga0207678_10156803
403 Ga0207702_10072737
404 Ga0207641_10012570
405 Ga0207641_10142197
406 Ga0207648_10020467
407 Ga0207648_10327050
408 Ga0207676_10128295
409 Ga0207676_10399883
410 Ga0207674_10030811
411 Ga0207683_10138189
412 Ga0207683_10446700
413 Ga0207698_10190054
414 Ga0265334_10033931
415 Ga0265336_10000010
416 Ga0307517_10000590
417 Ga0307517_10045602
418 Ga0307517_10090670
419 Ga0307517_10135674
420 Ga0307515_10034722
421 Ga0307515_10038264
422 Ga0307515_10039529
423 Ga0307515_10285488
424 Ga0265324_10001297
425 Ga0307511_10014052
426 Ga0307512_10166294
427 Ga0316181_1250493
428 Ga0265327_10027221
429 Ga0265316_10007313
430 Ga0307513_10016444
431 Ga0307513_10054767
432 Ga0307509_10037088
433 Ga0307408_100101013
434 Ga0307408_100411845
435 Ga0307508_10003427
436 Ga0307514_10052531
437 Ga0307514_10082434
438 Ga0307516_10000774
439 Ga0307516_10001150
440 Ga0307516_10088491
441 Ga0307516_10158244
442 Ga0307516_10222017
443 Ga0307516_10330162
444 Ga0307406_10390480
445 Ga0307416_100067100
446 Ga0307507_10017213
447 Ga0395900_0047528
448 Ga0395898_0158333
449 Ga0395905_0019996
450 Ga0395905_0038604
451 Ga0395901_0051388
452 Ga0395901_0053186
453 Ga0395901_0563454
454 Ga0436361_0578582
455 Ga0436361_0890364
456 Ga0439436_0115854
457 Ga0439447_023335
458 Ga0439465_0061262
459 Ga0451797_1010639
460 Ga0451802_1935786
461 Ga0451807_1617251
462 Ga0451837_0693531
463 Ga0451843_1483157
464 Ga0439432_009863
465 Ga0439449_0012468
466 Ga0439449_0017496
467 Ga0439455_0043892
468 Ga0439457_002415
469 Ga0450921_004372
470 Ga0450923_003658
471 Ga0450898_004738
472 Ga0450909_005789
473 Ga0439459_0000369
474 Ga0450893_0037432
475 Ga0466969_0000031
476 Ga0453683_0005828
477 Ga0466966_0008455
478 Ga0466966_0159528
479 Ga0466961_0001650
480 Ga0466961_0215455
481 Ga0466964_0003954
482 Ga0466970_0017396
483 Ga0466957_0565308
484 Ga0466959_0000156
485 Ga0451576_0004194
486 Ga0466958_0020136
487 Ga0466967_0034824
488 Ga0466967_0112000
489 Ga0495592_0000247
490 Ga0495638_0078407
491 Ga0495580_0268631
492 Ga0495639_0025442
493 Ga0495632_0003193
494 Ga0495663_0004016
495 Ga0495625_0024940
496 Ga0495625_0163776
497 Ga0495647_0048136
498 Ga0495658_0219204
499 Ga0495613_0602433
500 Ga0495671_0013226
501 Ga0495649_0001293
502 Ga0495660_0013930
503 Ga0495687_000153
504 Ga0495687_016220
505 Ga0495687_016221
506 Ga0496102_0234169
507 Ga0496108_0248867
508 Ga0496110_0219194
509 Ga0501300_004943
510 Ga0501034_0000124
511 Ga0501202_017128
512 Ga0501223_021782
513 Ga0501255_001543
514 Ga0501221_001790
515 Ga0501229_001878
516 Ga0501267_000591
517 Ga0501035_0092805
518 Ga0501226_009647
519 nmdc:mga03683_2403_c1
520 nmdc:mga03683_8494_c1
521 nmdc:mga00v17_15871_c1
522 nmdc:mga0yw44_210420_c1
523 nmdc:mga0yw44_92658_c1
524 nmdc:mga0k408_16072_c1
525 nmdc:mga0k408_29128_c1
526 nmdc:mga0k408_3441_c1
527 nmdc:mga0k408_429876_c1
528 nmdc:mga0k408_65487_c1
529 nmdc:mga06z11_19097_c1
530 nmdc:mga06z11_343854_c1
531 nmdc:mga07m45_112263_c1
532 nmdc:mga07m45_207237_c1
533 nmdc:mga07m45_22242_c1
534 nmdc:mga07m45_28990_c1
535 nmdc:mga07m45_337597_c1
536 nmdc:mga07m45_7738_c1
537 nmdc:mga07m45_86846_c1
538 nmdc:mga0sz30_55158_c1
539 Ga0500635_0015025
540 Ga0500583_0040298
541 Ga0500583_0288039
542 Ga0500651_0092565
543 Ga0500650_0024893
544 Ga0500594_0068553
545 Ga0500655_001209
546 Ga0500658_0008365
547 Ga0500559_0000135
548 Ga0500559_0037646
549 Ga0500559_0142350
550 Ga0500568_0017987
551 Ga0500604_0001946
552 2513566597
553 2516019805
554 2644219416
555 2644243101
556 2739054308
557 2746086317
558 2746093317
559 2792838933
560 2831867003
561 2885197200
562 2900642776
563 2904622818
564 2954768204
565 8003962902
566 8055307641

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00230

MIP

Major intrinsic protein

30

195

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3llq-assembly1.cif.gz_B aquaporin structure from plant pathogen agrobacterium tumerfaciens 0.8487 6 213
5i32-assembly1.cif.gz_A ammonia permeable aquaporin attip2;1 0.8476 1 209
3ne2-assembly1.cif.gz_D archaeoglobus fulgidus aquaporin 0.8465 6 214
2abm-assembly1.cif.gz_A crystal structure of aquaporin z tetramer reveals both open and closed water-conducting channels 0.8426 5 213
4jc6-assembly1.cif.gz_A mercury activation of the plant aquaporin sopip2;1 - structural and functional characterization 0.8419 1 212
ID Description Score Start End Superfamily
af_Q7Z138_18_164_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9365 4 109 1.20.1080.10
af_A0A1D6PLK2_10_163_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9341 3 108 1.20.1080.10
af_A0A0P0WDK9_2_139_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9338 1 104 1.20.1080.10
af_I1NH56_66_171_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9324 4 106 1.20.1080.10
af_I1NH56_66_171_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.8741 4 106 1.20.1080.10
ID Description Score Start End GO Terms
AF-A0A525I976-F1-model_v4 Aquaporin family protein 0.9869 4 161 GO:0015267
GO:0016020
AF-A0A519G0K1-F1-model_v4 deleted 0.9864 4 216
AF-A0A0S2FHZ5-F1-model_v4 Major intrinsic family protein 0.9856 4 217 GO:0015267
GO:0016020
AF-A0A1C6MFR8-F1-model_v4 Glycerol uptake facilitator (Major Intrinsic Protein Family) 0.9855 4 213 GO:0015250
GO:0016020
AF-A0A7W5U768-F1-model_v4 deleted 0.9853 4 213

Map