F385488

General Info

Members Datasets Scaffolds Average Seq Length
283 116 566 402

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100006001|Ga0070712_1000060013
Length 418
Sequence MSIAGKTLLIISGGIEAADAARHAKAMGLKVVVSDRDPDAPGFQFADSSLIADVYSPAETAAAAERYHRKIGPIAGVLCVAADAPVTAAMVAERLKLPGIPVSVAELACDKLAMKKCFAAAGVAVPWFSEVKTAQELQRIAVERGPELVIKPVDSRGSRGVQRISKVADLASAFRLAQSHSPSQRVMVEQYLEGPQISTESAVVNGECFTPGFSDRNYEYLEKYAPFFIENGGDLPSRLPAEAQAKVRALVGRAAKAMGIANGTVKGDIVVHQGEPYVIELAARLSGGFFCTREIPLNTGVDFIGAAIKLALGEPVAAEDLRHKYLRPVIQRYAFPDAGTVVAVRGADQARAVPGIVDLVVTAKPGDVIPPAGDKRPSAAMVLASGETRQDALKAAETALALIDIETDMGAKAWRKSR

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
64 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
65 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
66 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
79 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
80 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
81 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
82 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
83 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
84 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
85 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
86 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
87 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
101 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
104 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
105 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
106 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
113 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
114 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
115 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
116 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.77
Nodule 0
Rhizoplane 0
Rhizosphere 96.11
Stem 0
Stem Tuber 0
Unclassified 4.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_100006001 3300006175 Bacteria 7516
2 JGI25153J46596_10001602 3300003215 Bacteria 13408
3 rootH2_10003154 3300003320 Bacteria 36753
4 Ga0070658_10006353 3300005327 Bacteria 9578
5 Ga0070666_10003718 3300005335 Bacteria 9244
6 Ga0070680_100001143 3300005336 Bacteria 19030
7 Ga0070680_100021023 3300005336 Bacteria 5182
8 Ga0070660_100001001 3300005339 Bacteria 18970
9 Ga0070691_10006950 3300005341 Bacteria 5182
10 Ga0070661_100002865 3300005344 Bacteria 11851
11 Ga0070661_100005427 3300005344 Bacteria 8789
12 Ga0070659_100006248 3300005366 Bacteria 8610
13 Ga0070659_100034056 3300005366 Bacteria 3961
14 Ga0070667_100174143 3300005367 Bacteria 1901
15 Ga0070681_10000002 3300005458 Bacteria 821814
16 Ga0070679_100003234 3300005530 Bacteria 14885
17 Ga0068853_100000169 3300005539 Bacteria 45200
18 Ga0070665_100030152 3300005548 Bacteria 5458
19 Ga0068855_100000069 3300005563 Bacteria 124154
20 Ga0068855_100021956 3300005563 Bacteria 7652
21 Ga0068855_100024217 3300005563 Bacteria 7266
22 Ga0068855_100045111 3300005563 Bacteria 5214
23 Ga0068855_100070743 3300005563 Bacteria 4058
24 Ga0068852_100001873 3300005616 Bacteria 14312
25 Ga0068852_100024705 3300005616 Bacteria 4860
26 Ga0068852_100047098 3300005616 Bacteria 3676
27 Ga0068864_100125714 3300005618 Bacteria 2298
28 Ga0068858_100073279 3300005842 Bacteria 3179
29 Ga0068858_100292352 3300005842 Bacteria 1553
30 Ga0068860_100063693 3300005843 Bacteria 3501
31 Ga0070712_100001575 3300006175 Bacteria 13962
32 Ga0075431_100046144 3300006847 Bacteria 4492
33 Ga0068865_100084645 3300006881 Bacteria 2285
34 Ga0105240_10000055 3300009093 Bacteria 225380
35 Ga0105240_10001622 3300009093 Bacteria 38172
36 Ga0105240_10032745 3300009093 Bacteria 6726
37 Ga0105240_10038730 3300009093 Bacteria 6112
38 Ga0105240_10066773 3300009093 Bacteria 4461
39 Ga0105245_10003160 3300009098 Bacteria 14722
40 Ga0105241_10025249 3300009174 Bacteria 4415
41 Ga0105241_10160604 3300009174 Bacteria 1847
42 Ga0105248_10000001 3300009177 Bacteria 1881304
43 Ga0105237_10035090 3300009545 Bacteria 5076
44 Ga0105238_10001302 3300009551 Bacteria 25101
45 Ga0105238_10043030 3300009551 Bacteria 4571
46 Ga0105239_10008712 3300010375 Bacteria 11482
47 Ga0105239_10019967 3300010375 Bacteria 7395
48 Ga0105239_10039737 3300010375 Bacteria 5154
49 Ga0105239_10112990 3300010375 Bacteria 3012
50 Ga0157373_10056494 3300013100 Bacteria 2787
51 Ga0157370_10100024 3300013104 Bacteria 2717
52 Ga0157372_10006121 3300013307 Bacteria 12785
53 Ga0157372_10034296 3300013307 Bacteria 5578
54 Ga0157379_10000547 3300014968 Bacteria 30383
55 Ga0157376_10061483 3300014969 Bacteria 3157
56 Ga0157376_10185753 3300014969 Unclassified 1903
57 Ga0213876_10000405 3300021384 Bacteria 36218
58 Ga0213876_10003096 3300021384 Bacteria 9623
59 Ga0209758_1000008 3300025297 Bacteria 1215263
60 Ga0207705_10000058 3300025909 Bacteria 155967
61 Ga0207654_10017915 3300025911 Unclassified 3711
62 Ga0207707_10000002 3300025912 Bacteria 1142054
63 Ga0207707_10000263 3300025912 Bacteria 56613
64 Ga0207695_10000012 3300025913 Bacteria 840961
65 Ga0207695_10005200 3300025913 Bacteria 17414
66 Ga0207695_10006498 3300025913 Bacteria 15143
67 Ga0207695_10012352 3300025913 Bacteria 10260
68 Ga0207695_10034643 3300025913 Bacteria 5487
69 Ga0207695_10043779 3300025913 Bacteria 4767
70 Ga0207695_10245126 3300025913 Bacteria 1692
71 Ga0207671_10073365 3300025914 Unclassified 2556
72 Ga0207693_10001808 3300025915 Bacteria 18752
73 Ga0207693_10014610 3300025915 Bacteria 6309
74 Ga0207660_10000358 3300025917 Bacteria 29719
75 Ga0207660_10000598 3300025917 Bacteria 24324
76 Ga0207660_10062172 3300025917 Bacteria 2689
77 Ga0207657_10000305 3300025919 Bacteria 51999
78 Ga0207649_10000026 3300025920 Bacteria 177395
79 Ga0207649_10009932 3300025920 Bacteria 5216
80 Ga0207652_10000505 3300025921 Bacteria 39729
81 Ga0207652_10000679 3300025921 Bacteria 33231
82 Ga0207652_10182270 3300025921 Bacteria 1887
83 Ga0207694_10000006 3300025924 Bacteria 631109
84 Ga0207694_10059826 3300025924 Unclassified 2963
85 Ga0207687_10015147 3300025927 Bacteria 5053
86 Ga0207690_10030680 3300025932 Bacteria 3432
87 Ga0207711_10000001 3300025941 Bacteria 1325674
88 Ga0207689_10206441 3300025942 Unclassified 1623
89 Ga0207667_10000026 3300025949 Bacteria 343713
90 Ga0207667_10052726 3300025949 Bacteria 4282
91 Ga0207658_10085716 3300025986 Bacteria 2427
92 Ga0207703_10059162 3300026035 Bacteria 3130
93 Ga0207639_10000177 3300026041 Bacteria 49899
94 Ga0207674_10103340 3300026116 Bacteria 2829
95 Ga0207698_10003225 3300026142 Bacteria 9797
96 Ga0207698_10257799 3300026142 Unclassified 1600
97 Ga0268266_10025825 3300028379 Bacteria 4997
98 Ga0268266_10114167 3300028379 Unclassified 2396
99 Ga0268264_10085085 3300028381 Bacteria 2713
100 Ga0265334_10002722 3300028573 Bacteria 8172
101 Ga0265318_10000457 3300028577 Bacteria 30611
102 Ga0265318_10001562 3300028577 Bacteria 13304
103 Ga0265338_10000011 3300028800 Bacteria 433370
104 Ga0265338_10012218 3300028800 Bacteria 9808
105 Ga0265338_10013228 3300028800 Bacteria 9339
106 Ga0265338_10028248 3300028800 Bacteria 5599
107 Ga0265338_10034696 3300028800 Bacteria 4870
108 Ga0265338_10159397 3300028800 Bacteria 1744
109 Ga0265330_10006393 3300031235 Bacteria 5821
110 Ga0265320_10001704 3300031240 Bacteria 15623
111 Ga0265325_10000002 3300031241 Bacteria 396758
112 Ga0265325_10000118 3300031241 Bacteria 54374
113 Ga0265325_10000163 3300031241 Bacteria 47195
114 Ga0265325_10005952 3300031241 Bacteria 7472
115 Ga0265325_10033608 3300031241 Bacteria 2734
116 Ga0265325_10036668 3300031241 Bacteria 2597
117 Ga0265325_10061276 3300031241 Bacteria 1909
118 Ga0265325_10101931 3300031241 Bacteria 1404
119 Ga0265329_10004207 3300031242 Bacteria 6058
120 Ga0265340_10000016 3300031247 Bacteria 94019
121 Ga0265340_10000602 3300031247 Bacteria 20076
122 Ga0265340_10002201 3300031247 Bacteria 11159
123 Ga0265340_10008447 3300031247 Bacteria 5560
124 Ga0265340_10032287 3300031247 Unclassified 2614
125 Ga0265339_10000709 3300031249 Bacteria 25841
126 Ga0265339_10001180 3300031249 Bacteria 19743
127 Ga0265339_10005549 3300031249 Bacteria 8386
128 Ga0265339_10018440 3300031249 Bacteria 4113
129 Ga0265339_10067500 3300031249 Bacteria 1912
130 Ga0265331_10000008 3300031250 Bacteria 324311
131 Ga0265331_10000009 3300031250 Bacteria 314950
132 Ga0265331_10001065 3300031250 Bacteria 21378
133 Ga0265331_10002786 3300031250 Bacteria 11591
134 Ga0265331_10040568 3300031250 Unclassified 2264
135 Ga0265327_10000036 3300031251 Bacteria 312827
136 Ga0265316_10004664 3300031344 Bacteria 13572
137 Ga0265316_10019577 3300031344 Bacteria 5782
138 Ga0265316_10047428 3300031344 Bacteria 3399
139 Ga0265316_10099185 3300031344 Bacteria 2216
140 Ga0265313_10000338 3300031595 Bacteria 50856
141 Ga0265313_10000599 3300031595 Bacteria 37436
142 Ga0265313_10001699 3300031595 Bacteria 20295
143 Ga0265313_10002422 3300031595 Bacteria 16124
144 Ga0265313_10002567 3300031595 Bacteria 15507
145 Ga0265313_10011346 3300031595 Bacteria 5549
146 Ga0265313_10012736 3300031595 Bacteria 5107
147 Ga0265314_10001645 3300031711 Bacteria 24453
148 Ga0265314_10003469 3300031711 Bacteria 15229
149 Ga0265314_10007289 3300031711 Bacteria 9608
150 Ga0265314_10007827 3300031711 Bacteria 9233
151 Ga0265314_10016015 3300031711 Bacteria 5936
152 Ga0265314_10027241 3300031711 Bacteria 4282
153 Ga0265314_10044560 3300031711 Bacteria 3144
154 Ga0265314_10069252 3300031711 Bacteria 2369
155 Ga0265314_10072770 3300031711 Bacteria 2294
156 Ga0265342_10004506 3300031712 Bacteria 10928
157 Ga0265342_10007691 3300031712 Bacteria 7848
158 Ga0265342_10014330 3300031712 Bacteria 5267
159 Ga0265342_10019463 3300031712 Bacteria 4374
160 Ga0265342_10047291 3300031712 Bacteria 2583
161 Ga0265342_10104237 3300031712 Bacteria 1612
162 Ga0373937_0185437 3300036401 Bacteria 1954
163 Ga0395900_0376360 3300037418 Bacteria 1389
164 Ga0436365_1513507 3300039437 Bacteria 68714
165 Ga0436365_1848959 3300039437 Bacteria 20440
166 Ga0436360_0140578 3300039438 Bacteria 1353
167 Ga0495664_0046045 3300046477 Unclassified 2588
168 Ga0495664_0101568 3300046477 Bacteria 1733
169 Ga0495652_0009823 3300046529 Bacteria 8675
170 Ga0495587_0021699 3300046536 Bacteria 3962
171 Ga0495645_0036607 3300046543 Bacteria 3577
172 Ga0495675_0063577 3300047444 Bacteria 2335
173 Ga0495602_0115665 3300048088 Bacteria 2169
174 Ga0496126_0002288 3300048929 Bacteria 26402
175 Ga0495682_0010077 3300049460 Bacteria 3670
176 Ga0501031_0002794 3300049568 Bacteria 11134
177 Ga0501031_0040466 3300049568 Bacteria 3043
178 Ga0501031_0114343 3300049568 Bacteria 1763
179 Ga0501032_0037478 3300049569 Bacteria 3306
180 Ga0501032_0062410 3300049569 Bacteria 2497
181 Ga0501032_0098342 3300049569 Bacteria 1939
182 Ga0501032_0114813 3300049569 Bacteria 1780
183 Ga0501033_0006770 3300049570 Bacteria 8952
184 Ga0501033_0013679 3300049570 Bacteria 6174
185 Ga0501033_0019912 3300049570 Bacteria 5071
186 Ga0501033_0023939 3300049570 Bacteria 4606
187 Ga0501033_0052455 3300049570 Bacteria 3022
188 Ga0501033_0106048 3300049570 Bacteria 2047
189 Ga0501033_0138902 3300049570 Bacteria 1757
190 Ga0501033_0141411 3300049570 Bacteria 1739
191 Ga0501033_0146486 3300049570 Bacteria 1705
192 Ga0501034_0012623 3300049571 Bacteria 8718
193 Ga0501034_0045856 3300049571 Bacteria 4416
194 Ga0501034_0121954 3300049571 Bacteria 2593
195 Ga0501034_0195643 3300049571 Bacteria 1982
196 Ga0501034_0314024 3300049571 Bacteria 1501
197 Ga0501036_0155335 3300049572 Bacteria 1930
198 Ga0501037_0007429 3300049573 Bacteria 8012
199 Ga0501037_0044615 3300049573 Bacteria 3256
200 Ga0501037_0075053 3300049573 Bacteria 2456
201 Ga0501038_0021730 3300049574 Bacteria 5757
202 Ga0501039_0004176 3300049575 Bacteria 10875
203 Ga0501042_0071772 3300049578 Bacteria 2477
204 Ga0501043_0010307 3300049579 Bacteria 7328
205 Ga0501043_0042085 3300049579 Bacteria 3589
206 Ga0501043_0082248 3300049579 Bacteria 2530
207 Ga0501043_0111013 3300049579 Unclassified 2153
208 Ga0501043_0134096 3300049579 Bacteria 1940
209 Ga0501046_0004058 3300049580 Bacteria 13359
210 Ga0501046_0005626 3300049580 Bacteria 11184
211 Ga0501046_0033928 3300049580 Bacteria 4122
212 Ga0501047_0001789 3300049581 Bacteria 20799
213 Ga0501047_0004036 3300049581 Bacteria 13807
214 Ga0501047_0014890 3300049581 Bacteria 7403
215 Ga0501047_0046046 3300049581 Bacteria 4217
216 Ga0501047_0063156 3300049581 Bacteria 3572
217 Ga0501047_0067600 3300049581 Bacteria 3443
218 Ga0501047_0099902 3300049581 Bacteria 2781
219 Ga0501047_0114290 3300049581 Bacteria 2582
220 Ga0501048_0016343 3300049582 Bacteria 5468
221 Ga0501048_0054746 3300049582 Bacteria 2834
222 Ga0501067_0000181 3300049583 Bacteria 35717
223 Ga0501067_0002170 3300049583 Bacteria 10818
224 Ga0501069_0003293 3300049585 Bacteria 8292
225 Ga0501069_0007006 3300049585 Bacteria 5900
226 Ga0501069_0065081 3300049585 Bacteria 2038
227 Ga0501070_0000017 3300049586 Bacteria 173127
228 Ga0501070_0005722 3300049586 Bacteria 10599
229 Ga0501070_0013842 3300049586 Bacteria 6794
230 Ga0501070_0017855 3300049586 Bacteria 5958
231 Ga0501070_0036890 3300049586 Bacteria 4082
232 Ga0501070_0047933 3300049586 Bacteria 3550
233 Ga0501070_0064332 3300049586 Bacteria 3038
234 Ga0501072_0008074 3300049588 Bacteria 7988
235 Ga0501073_0012264 3300049589 Bacteria 6253
236 Ga0501073_0021824 3300049589 Bacteria 4612
237 Ga0501073_0026027 3300049589 Bacteria 4193
238 Ga0501073_0028307 3300049589 Bacteria 4004
239 Ga0501073_0041323 3300049589 Bacteria 3258
240 Ga0501074_0012666 3300049590 Bacteria 6133
241 Ga0501074_0036270 3300049590 Bacteria 3572
242 Ga0501076_0082351 3300049592 Bacteria 2583
243 Ga0501076_0181624 3300049592 Bacteria 1715
244 Ga0501079_0002077 3300049741 Bacteria 14360
245 Ga0501080_0008474 3300049742 Bacteria 9317
246 Ga0501080_0018022 3300049742 Bacteria 6538
247 Ga0501080_0028174 3300049742 Bacteria 5223
248 Ga0501080_0049848 3300049742 Bacteria 3897
249 Ga0501080_0060851 3300049742 Bacteria 3515
250 Ga0501080_0063307 3300049742 Bacteria 3442
251 Ga0501080_0120396 3300049742 Bacteria 2433
252 Ga0501080_0193088 3300049742 Bacteria 1871
253 Ga0501080_0252235 3300049742 Bacteria 1609
254 Ga0501083_0011885 3300049744 Bacteria 6100
255 Ga0501083_0067697 3300049744 Bacteria 2377
256 Ga0501035_0002699 3300049822 Bacteria 17244
257 Ga0501035_0006022 3300049822 Bacteria 11418
258 Ga0501035_0013236 3300049822 Bacteria 7613
259 Ga0501035_0019831 3300049822 Bacteria 6177
260 Ga0501035_0022129 3300049822 Bacteria 5839
261 Ga0501035_0028142 3300049822 Bacteria 5132
262 Ga0501035_0132672 3300049822 Bacteria 2170
263 Ga0501044_0002656 3300049823 Bacteria 20336
264 Ga0501044_0003942 3300049823 Bacteria 16632
265 Ga0501044_0007218 3300049823 Bacteria 12222
266 Ga0501044_0010021 3300049823 Bacteria 10296
267 Ga0501044_0012749 3300049823 Bacteria 9102
268 Ga0501044_0023658 3300049823 Bacteria 6532
269 Ga0501044_0027516 3300049823 Bacteria 6008
270 Ga0501044_0049659 3300049823 Bacteria 4330
271 Ga0501044_0090052 3300049823 Unclassified 3096
272 Ga0501044_0122638 3300049823 Bacteria 2598
273 Ga0501044_0153351 3300049823 Bacteria 2285
274 Ga0501044_0257438 3300049823 Bacteria 1684
275 Ga0501044_0322315 3300049823 Bacteria 1469
276 Ga0500643_000027 3300053087 Bacteria 251062
277 Ga0500568_0024015 3300053139 Bacteria 2585
278 Ga0500619_015798 3300053154 Bacteria 2062
279 Ga0501084_0004285 3300054114 Bacteria 11616
280 Ga0501084_0017537 3300054114 Bacteria 5954
281 Ga0501084_0044882 3300054114 Bacteria 3700
282 Ga0501082_0005158 3300060353 Bacteria 11371
283 Ga0501082_0108988 3300060353 Bacteria 2397
284 Ga0070712_100006001
285 JGI25153J46596_10001602
286 rootH2_10003154
287 Ga0070658_10006353
288 Ga0070666_10003718
289 Ga0070680_100001143
290 Ga0070680_100021023
291 Ga0070660_100001001
292 Ga0070691_10006950
293 Ga0070661_100002865
294 Ga0070661_100005427
295 Ga0070659_100006248
296 Ga0070659_100034056
297 Ga0070667_100174143
298 Ga0070681_10000002
299 Ga0070679_100003234
300 Ga0068853_100000169
301 Ga0070665_100030152
302 Ga0068855_100000069
303 Ga0068855_100021956
304 Ga0068855_100024217
305 Ga0068855_100045111
306 Ga0068855_100070743
307 Ga0068852_100001873
308 Ga0068852_100024705
309 Ga0068852_100047098
310 Ga0068864_100125714
311 Ga0068858_100073279
312 Ga0068858_100292352
313 Ga0068860_100063693
314 Ga0070712_100001575
315 Ga0075431_100046144
316 Ga0068865_100084645
317 Ga0105240_10000055
318 Ga0105240_10001622
319 Ga0105240_10032745
320 Ga0105240_10038730
321 Ga0105240_10066773
322 Ga0105245_10003160
323 Ga0105241_10025249
324 Ga0105241_10160604
325 Ga0105248_10000001
326 Ga0105237_10035090
327 Ga0105238_10001302
328 Ga0105238_10043030
329 Ga0105239_10008712
330 Ga0105239_10019967
331 Ga0105239_10039737
332 Ga0105239_10112990
333 Ga0157373_10056494
334 Ga0157370_10100024
335 Ga0157372_10006121
336 Ga0157372_10034296
337 Ga0157379_10000547
338 Ga0157376_10061483
339 Ga0157376_10185753
340 Ga0213876_10000405
341 Ga0213876_10003096
342 Ga0209758_1000008
343 Ga0207705_10000058
344 Ga0207654_10017915
345 Ga0207707_10000002
346 Ga0207707_10000263
347 Ga0207695_10000012
348 Ga0207695_10005200
349 Ga0207695_10006498
350 Ga0207695_10012352
351 Ga0207695_10034643
352 Ga0207695_10043779
353 Ga0207695_10245126
354 Ga0207671_10073365
355 Ga0207693_10001808
356 Ga0207693_10014610
357 Ga0207660_10000358
358 Ga0207660_10000598
359 Ga0207660_10062172
360 Ga0207657_10000305
361 Ga0207649_10000026
362 Ga0207649_10009932
363 Ga0207652_10000505
364 Ga0207652_10000679
365 Ga0207652_10182270
366 Ga0207694_10000006
367 Ga0207694_10059826
368 Ga0207687_10015147
369 Ga0207690_10030680
370 Ga0207711_10000001
371 Ga0207689_10206441
372 Ga0207667_10000026
373 Ga0207667_10052726
374 Ga0207658_10085716
375 Ga0207703_10059162
376 Ga0207639_10000177
377 Ga0207674_10103340
378 Ga0207698_10003225
379 Ga0207698_10257799
380 Ga0268266_10025825
381 Ga0268266_10114167
382 Ga0268264_10085085
383 Ga0265334_10002722
384 Ga0265318_10000457
385 Ga0265318_10001562
386 Ga0265338_10000011
387 Ga0265338_10012218
388 Ga0265338_10013228
389 Ga0265338_10028248
390 Ga0265338_10034696
391 Ga0265338_10159397
392 Ga0265330_10006393
393 Ga0265320_10001704
394 Ga0265325_10000002
395 Ga0265325_10000118
396 Ga0265325_10000163
397 Ga0265325_10005952
398 Ga0265325_10033608
399 Ga0265325_10036668
400 Ga0265325_10061276
401 Ga0265325_10101931
402 Ga0265329_10004207
403 Ga0265340_10000016
404 Ga0265340_10000602
405 Ga0265340_10002201
406 Ga0265340_10008447
407 Ga0265340_10032287
408 Ga0265339_10000709
409 Ga0265339_10001180
410 Ga0265339_10005549
411 Ga0265339_10018440
412 Ga0265339_10067500
413 Ga0265331_10000008
414 Ga0265331_10000009
415 Ga0265331_10001065
416 Ga0265331_10002786
417 Ga0265331_10040568
418 Ga0265327_10000036
419 Ga0265316_10004664
420 Ga0265316_10019577
421 Ga0265316_10047428
422 Ga0265316_10099185
423 Ga0265313_10000338
424 Ga0265313_10000599
425 Ga0265313_10001699
426 Ga0265313_10002422
427 Ga0265313_10002567
428 Ga0265313_10011346
429 Ga0265313_10012736
430 Ga0265314_10001645
431 Ga0265314_10003469
432 Ga0265314_10007289
433 Ga0265314_10007827
434 Ga0265314_10016015
435 Ga0265314_10027241
436 Ga0265314_10044560
437 Ga0265314_10069252
438 Ga0265314_10072770
439 Ga0265342_10004506
440 Ga0265342_10007691
441 Ga0265342_10014330
442 Ga0265342_10019463
443 Ga0265342_10047291
444 Ga0265342_10104237
445 Ga0373937_0185437
446 Ga0395900_0376360
447 Ga0436365_1513507
448 Ga0436365_1848959
449 Ga0436360_0140578
450 Ga0495664_0046045
451 Ga0495664_0101568
452 Ga0495652_0009823
453 Ga0495587_0021699
454 Ga0495645_0036607
455 Ga0495675_0063577
456 Ga0495602_0115665
457 Ga0496126_0002288
458 Ga0495682_0010077
459 Ga0501031_0002794
460 Ga0501031_0040466
461 Ga0501031_0114343
462 Ga0501032_0037478
463 Ga0501032_0062410
464 Ga0501032_0098342
465 Ga0501032_0114813
466 Ga0501033_0006770
467 Ga0501033_0013679
468 Ga0501033_0019912
469 Ga0501033_0023939
470 Ga0501033_0052455
471 Ga0501033_0106048
472 Ga0501033_0138902
473 Ga0501033_0141411
474 Ga0501033_0146486
475 Ga0501034_0012623
476 Ga0501034_0045856
477 Ga0501034_0121954
478 Ga0501034_0195643
479 Ga0501034_0314024
480 Ga0501036_0155335
481 Ga0501037_0007429
482 Ga0501037_0044615
483 Ga0501037_0075053
484 Ga0501038_0021730
485 Ga0501039_0004176
486 Ga0501042_0071772
487 Ga0501043_0010307
488 Ga0501043_0042085
489 Ga0501043_0082248
490 Ga0501043_0111013
491 Ga0501043_0134096
492 Ga0501046_0004058
493 Ga0501046_0005626
494 Ga0501046_0033928
495 Ga0501047_0001789
496 Ga0501047_0004036
497 Ga0501047_0014890
498 Ga0501047_0046046
499 Ga0501047_0063156
500 Ga0501047_0067600
501 Ga0501047_0099902
502 Ga0501047_0114290
503 Ga0501048_0016343
504 Ga0501048_0054746
505 Ga0501067_0000181
506 Ga0501067_0002170
507 Ga0501069_0003293
508 Ga0501069_0007006
509 Ga0501069_0065081
510 Ga0501070_0000017
511 Ga0501070_0005722
512 Ga0501070_0013842
513 Ga0501070_0017855
514 Ga0501070_0036890
515 Ga0501070_0047933
516 Ga0501070_0064332
517 Ga0501072_0008074
518 Ga0501073_0012264
519 Ga0501073_0021824
520 Ga0501073_0026027
521 Ga0501073_0028307
522 Ga0501073_0041323
523 Ga0501074_0012666
524 Ga0501074_0036270
525 Ga0501076_0082351
526 Ga0501076_0181624
527 Ga0501079_0002077
528 Ga0501080_0008474
529 Ga0501080_0018022
530 Ga0501080_0028174
531 Ga0501080_0049848
532 Ga0501080_0060851
533 Ga0501080_0063307
534 Ga0501080_0120396
535 Ga0501080_0193088
536 Ga0501080_0252235
537 Ga0501083_0011885
538 Ga0501083_0067697
539 Ga0501035_0002699
540 Ga0501035_0006022
541 Ga0501035_0013236
542 Ga0501035_0019831
543 Ga0501035_0022129
544 Ga0501035_0028142
545 Ga0501035_0132672
546 Ga0501044_0002656
547 Ga0501044_0003942
548 Ga0501044_0007218
549 Ga0501044_0010021
550 Ga0501044_0012749
551 Ga0501044_0023658
552 Ga0501044_0027516
553 Ga0501044_0049659
554 Ga0501044_0090052
555 Ga0501044_0122638
556 Ga0501044_0153351
557 Ga0501044_0257438
558 Ga0501044_0322315
559 Ga0500643_000027
560 Ga0500568_0024015
561 Ga0500619_015798
562 Ga0501084_0004285
563 Ga0501084_0017537
564 Ga0501084_0044882
565 Ga0501082_0005158
566 Ga0501082_0108988

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18603

LAL_C2

L-amino acid ligase C-terminal domain 2

332

408

0.97

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

110

208

0.88

PF13535

ATP-grasp_4

ATP-grasp domain

145

293

0.85

PF07478

Dala_Dala_lig_C

D-ala D-ala ligase C-terminus

118

286

0.81

PF02655

ATP-grasp_3

ATP-grasp domain

108

288

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x6r-assembly2.cif.gz_B crystal structure of saccharomyces cerevisiae kmo in complex with ro 61-8048 0.915 3 36
6pvi-assembly1.cif.gz_A crystal structure of phqk in complex with paraherquamide l 0.893 3 34
3oc4-assembly1.cif.gz_B crystal structure of a pyridine nucleotide-disulfide family oxidoreductase from the enterococcus faecalis v583 0.8896 3 39
3vot-assembly2.cif.gz_B crystal structure of l-amino acid ligase from bacillus licheniformis 0.8729 2 405
8gsm-assembly1.cif.gz_G crystal structure of vibmo1 0.865 1 36
ID Description Score Start End Superfamily
af_P9WHH3_154_271_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9193 3 33 3.50.50.60
af_Q54GT1_13_197_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.917 3 36 3.50.50.60
af_D3ZBP5_4_394_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9168 3 36 3.50.50.60
af_Q54H02_2_246_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9098 1 34 3.50.50.60
2v3bA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9084 3 38 3.50.50.60
ID Description Score Start End GO Terms
AF-C6BXS9-F1-model_v4 Phosphoribosylglycinamide synthetase 0.9808 1 405 GO:0005524
GO:0046872
AF-C6BXS9-F1-model_v4 Phosphoribosylglycinamide synthetase 0.9784 1 405 GO:0005524
GO:0046872
AF-A0A2D7AA54-F1-model_v4 Phosphoribosylglycinamide synthetase 0.9725 1 405 GO:0005524
GO:0016874
GO:0046872
AF-A0A2H0DGK3-F1-model_v4 ATP-grasp domain-containing protein 0.9724 1 405 GO:0003824
GO:0005524
GO:0046872
AF-A0A2D7AA54-F1-model_v4 Phosphoribosylglycinamide synthetase 0.9701 1 405 GO:0005524
GO:0016874
GO:0046872

Map