F385649

General Info

Members Datasets Scaffolds Average Seq Length
283 209 566 281

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10045960|Ga0307515_100459603
Length 269
Sequence MAIRLRTLLGDHPGTAALKSSPTNKGFKPMVREAAFDVSELAIVTYLMAKSFDKPMVLLPNVLMARFQHGHALYNAKRGTLKPVDLNGKRVGIRSFTTTTGAWLRGILANDYGVDLNSIDWVKFEDAHVAEFKDTTKRAPAGKQIVQMLVDGELDAVLGEKSEHADLKPLFADVAAEEKAWAAKHSIVPINHMVVVSQRLCEKNPDAVREVHRLLVESAQASPAAPRFTTVEMRRSLELIVGYTAQQGLIPRAFSVDELFDDVTRALVL

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
95 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
96 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
97 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
98 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
126 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
132 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
133 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
134 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
139 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
143 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
180 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
181 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
182 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
183 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
184 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
185 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
186 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
187 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
188 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
189 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
190 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
191 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
192 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
195 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
196 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
197 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
198 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
199 2791355199
200 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
201 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
202 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
203 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
204 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
205 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
206 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
207 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
208 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
209 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.1
Metatranscriptomes 0
Isolates 3.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.9
Nodule 1.77
Rhizoplane 4.24
Rhizosphere 66.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10045960 3300028794 Bacteria 6689
2 JGI25153J46596_10016009 3300003215 Bacteria 3026
3 Ga0070680_100107577 3300005336 Bacteria 2319
4 Ga0070682_100338585 3300005337 Bacteria 1117
5 Ga0068868_100028693 3300005338 Bacteria 4257
6 Ga0068868_100572486 3300005338 Bacteria 998
7 Ga0070660_100118479 3300005339 Bacteria 2111
8 Ga0070689_100230732 3300005340 Bacteria 1522
9 Ga0070661_100125958 3300005344 Bacteria 1922
10 Ga0070668_100170379 3300005347 Bacteria 1772
11 Ga0070668_100420799 3300005347 Bacteria 1144
12 Ga0070668_100492015 3300005347 Bacteria 1060
13 Ga0070674_100187960 3300005356 Bacteria 1587
14 Ga0070667_100473929 3300005367 Bacteria 1146
15 Ga0070711_100020886 3300005439 Bacteria 4227
16 Ga0070663_100055656 3300005455 Bacteria 2832
17 Ga0070678_100117733 3300005456 Bacteria 2090
18 Ga0070678_100281883 3300005456 Bacteria 1406
19 Ga0070662_100408426 3300005457 Bacteria 1122
20 Ga0070681_10004544 3300005458 Bacteria 13233
21 Ga0070681_10103453 3300005458 Bacteria 2792
22 Ga0070685_10286444 3300005466 Bacteria 1105
23 Ga0070706_100303000 3300005467 Bacteria 1491
24 Ga0070679_100021572 3300005530 Bacteria 6289
25 Ga0070679_100301260 3300005530 Bacteria 1553
26 Ga0070684_100225994 3300005535 Bacteria 1708
27 Ga0068853_100647486 3300005539 Bacteria 1005
28 Ga0070665_100059576 3300005548 Bacteria 3827
29 Ga0070665_100065998 3300005548 Bacteria 3630
30 Ga0070665_100125579 3300005548 Bacteria 2568
31 Ga0070665_100435454 3300005548 Bacteria 1320
32 Ga0068856_100099117 3300005614 Bacteria 2904
33 Ga0070702_100339613 3300005615 Bacteria 1054
34 Ga0068864_100712992 3300005618 Bacteria 981
35 Ga0068851_10004272 3300005834 Bacteria 6435
36 Ga0068858_100293788 3300005842 Bacteria 1549
37 Ga0068860_100144236 3300005843 Bacteria 2290
38 Ga0068862_100329406 3300005844 Bacteria 1412
39 Ga0081538_10034813 3300005981 Bacteria 3321
40 Ga0081540_1002690 3300005983 Bacteria 14454
41 Ga0081540_1017195 3300005983 Bacteria 4485
42 Ga0081540_1044360 3300005983 Bacteria 2270
43 Ga0075365_10075088 3300006038 Bacteria 2281
44 Ga0075365_10149439 3300006038 Bacteria 1625
45 Ga0075365_10180139 3300006038 Bacteria 1477
46 Ga0075364_10122667 3300006051 Bacteria 1740
47 Ga0075362_10022802 3300006177 Bacteria 2641
48 Ga0075367_10000988 3300006178 Bacteria 11650
49 Ga0075369_10008785 3300006186 Bacteria 3903
50 Ga0075369_10024805 3300006186 Bacteria 2488
51 Ga0075370_10213127 3300006353 Bacteria 1140
52 Ga0068871_100376650 3300006358 Bacteria 1260
53 Ga0075428_100079146 3300006844 Bacteria 3587
54 Ga0097620_100171379 3300006931 Bacteria 2251
55 Ga0099795_10028929 3300007788 Bacteria 1890
56 Ga0105240_10540784 3300009093 Bacteria 1290
57 Ga0114129_10111337 3300009147 Bacteria 3777
58 Ga0105241_10032147 3300009174 Bacteria 3931
59 Ga0105248_10263800 3300009177 Bacteria 1939
60 Ga0105248_10340617 3300009177 Bacteria 1688
61 Ga0105237_10216485 3300009545 Bacteria 1915
62 Ga0105238_10596953 3300009551 Bacteria 1112
63 Ga0105238_10698344 3300009551 Bacteria 1026
64 Ga0105249_10578209 3300009553 Bacteria 1176
65 Ga0099796_10021898 3300010159 Bacteria 1976
66 Ga0105239_10231697 3300010375 Bacteria 2072
67 Ga0105239_10336744 3300010375 Bacteria 1702
68 Ga0105239_10340438 3300010375 Bacteria 1692
69 Ga0105246_10160772 3300011119 Bacteria 1711
70 Ga0105246_10351569 3300011119 Bacteria 1208
71 Ga0157369_10006547 3300013105 Bacteria 13481
72 Ga0157378_10205993 3300013297 Bacteria 1863
73 Ga0163162_10217372 3300013306 Bacteria 2041
74 Ga0163162_10437901 3300013306 Bacteria 1439
75 Ga0157372_10852397 3300013307 Bacteria 1058
76 Ga0157375_10300634 3300013308 Bacteria 1768
77 Ga0157380_10329795 3300014326 Bacteria 1419
78 Ga0157379_10383594 3300014968 Bacteria 1290
79 Ga0157376_10187855 3300014969 Bacteria 1893
80 Ga0163161_10207570 3300017792 Bacteria 1512
81 Ga0163161_10437643 3300017792 Bacteria 1055
82 Ga0209564_1011501 3300025295 Bacteria 3958
83 Ga0209758_1004785 3300025297 Bacteria 10950
84 Ga0207710_10164087 3300025900 Bacteria 1084
85 Ga0207699_10004016 3300025906 Bacteria 7041
86 Ga0207684_10318289 3300025910 Bacteria 1341
87 Ga0207654_10026739 3300025911 Bacteria 3128
88 Ga0207707_10000359 3300025912 Bacteria 47942
89 Ga0207707_10154833 3300025912 Bacteria 2004
90 Ga0207707_10277057 3300025912 Bacteria 1453
91 Ga0207693_10013028 3300025915 Bacteria 6710
92 Ga0207693_10022195 3300025915 Bacteria 5045
93 Ga0207660_10027186 3300025917 Bacteria 3902
94 Ga0207662_10243303 3300025918 Bacteria 1178
95 Ga0207657_10461258 3300025919 Bacteria 997
96 Ga0207652_10003470 3300025921 Bacteria 12999
97 Ga0207652_10281063 3300025921 Bacteria 1501
98 Ga0207709_10114811 3300025935 Bacteria 1807
99 Ga0207667_10162547 3300025949 Bacteria 2296
100 Ga0207668_10124223 3300025972 Bacteria 1959
101 Ga0207677_10031837 3300026023 Bacteria 3382
102 Ga0207703_10341013 3300026035 Bacteria 1377
103 Ga0207703_10450402 3300026035 Bacteria 1202
104 Ga0207678_10035639 3300026067 Bacteria 4332
105 Ga0207678_10212644 3300026067 Bacteria 1654
106 Ga0207648_10266565 3300026089 Bacteria 1529
107 Ga0207675_100266564 3300026118 Bacteria 1661
108 Ga0207683_10084701 3300026121 Bacteria 2818
109 Ga0207683_10115071 3300026121 Bacteria 2411
110 Ga0207683_10369881 3300026121 Bacteria 1317
111 Ga0207698_10350160 3300026142 Bacteria 1395
112 Ga0268266_10002394 3300028379 Bacteria 20226
113 Ga0268266_10003934 3300028379 Bacteria 14440
114 Ga0268266_10027683 3300028379 Bacteria 4819
115 Ga0268265_10181073 3300028380 Bacteria 1810
116 Ga0268264_10027494 3300028381 Bacteria 4648
117 Ga0307515_10212609 3300028794 Bacteria 1774
118 Ga0307513_10184797 3300031456 Bacteria 1943
119 Ga0307509_10180532 3300031507 Bacteria 1976
120 Ga0307408_100277295 3300031548 Bacteria 1395
121 Ga0307508_10156701 3300031616 Bacteria 1881
122 Ga0307406_10213629 3300031901 Bacteria 1429
123 Ga0307412_10082860 3300031911 Bacteria 2222
124 Ga0307416_100328820 3300032002 Bacteria 1535
125 Ga0307414_10168155 3300032004 Bacteria 1749
126 Ga0307510_10001061 3300033180 Bacteria 29217
127 Ga0316215_1004201 3300033544 Bacteria 1378
128 Ga0373926_0072562 3300035083 Bacteria 1266
129 Ga0373934_0014895 3300035086 Bacteria 2946
130 Ga0373923_0003551 3300035111 Bacteria 5018
131 Ga0373953_0007452 3300035117 Bacteria 3665
132 Ga0373943_0026933 3300035170 Bacteria 2697
133 Ga0373943_0097811 3300035170 Bacteria 1530
134 Ga0373924_0101645 3300035410 Bacteria 1237
135 Ga0373935_0129963 3300035692 Bacteria 1691
136 Ga0373935_0173522 3300035692 Bacteria 1476
137 Ga0373927_0016784 3300035695 Bacteria 4829
138 Ga0373927_0093885 3300035695 Bacteria 1950
139 Ga0373927_0147657 3300035695 Bacteria 1539
140 Ga0373933_0006955 3300035724 Bacteria 6165
141 Ga0373947_0025405 3300035725 Bacteria 3455
142 Ga0373947_0183578 3300035725 Bacteria 1363
143 Ga0373947_0198925 3300035725 Bacteria 1310
144 Ga0373925_0112208 3300037068 Bacteria 2107
145 Ga0451795_0309788 3300041456 Bacteria 941
146 Ga0466957_0155221 3300044842 Bacteria 1483
147 Ga0466959_0047117 3300045049 Bacteria 3171
148 Ga0495603_0004410 3300046455 Bacteria 8389
149 Ga0495603_0044718 3300046455 Bacteria 2642
150 Ga0495603_0104863 3300046455 Bacteria 1650
151 Ga0495629_0080943 3300046459 Bacteria 2267
152 Ga0495638_0000646 3300046460 Bacteria 38171
153 Ga0495638_0030281 3300046460 Bacteria 3485
154 Ga0495641_0022963 3300046461 Bacteria 3110
155 Ga0495650_0078082 3300046471 Bacteria 1283
156 Ga0495580_0006636 3300046472 Bacteria 9401
157 Ga0495662_0028790 3300046476 Bacteria 2682
158 Ga0495664_0090586 3300046477 Bacteria 1838
159 Ga0495585_0097809 3300046492 Bacteria 1573
160 Ga0495585_0105615 3300046492 Bacteria 1502
161 Ga0495585_0181340 3300046492 Bacteria 1082
162 Ga0495606_0064798 3300046507 Bacteria 2324
163 Ga0495616_0053672 3300046513 Bacteria 2002
164 Ga0495618_0028419 3300046514 Bacteria 3485
165 Ga0495620_0037103 3300046515 Bacteria 2174
166 Ga0495628_0087625 3300046516 Bacteria 2413
167 Ga0495630_0008895 3300046517 Bacteria 7209
168 Ga0495631_0018759 3300046518 Bacteria 3253
169 Ga0495631_0121508 3300046518 Bacteria 1123
170 Ga0495632_0062420 3300046519 Bacteria 1806
171 Ga0495643_0088896 3300046522 Bacteria 1596
172 Ga0495644_0054690 3300046523 Bacteria 1499
173 Ga0495654_0020090 3300046530 Bacteria 3485
174 Ga0495640_0142508 3300046533 Bacteria 1544
175 Ga0495598_0004011 3300046537 Bacteria 3162
176 Ga0495598_0037755 3300046537 Bacteria 1395
177 Ga0495621_0034827 3300046539 Bacteria 1741
178 Ga0495597_0118696 3300046542 Bacteria 1104
179 Ga0495656_0064812 3300046615 Bacteria 1605
180 Ga0495634_0138428 3300046642 Bacteria 1547
181 Ga0495625_0142375 3300046660 Bacteria 1617
182 Ga0495625_0448111 3300046660 Bacteria 798
183 Ga0495635_0055245 3300046663 Bacteria 2735
184 Ga0495659_0019059 3300046664 Bacteria 2293
185 Ga0495661_0056820 3300046665 Bacteria 2339
186 Ga0495661_0249728 3300046665 Bacteria 906
187 Ga0495588_0093296 3300046674 Bacteria 1578
188 Ga0495599_0124582 3300046678 Bacteria 1602
189 Ga0495646_0038325 3300046680 Bacteria 2960
190 Ga0495647_0005841 3300046681 Bacteria 4050
191 Ga0495658_0003337 3300046683 Bacteria 7963
192 Ga0495624_0098752 3300046690 Bacteria 1798
193 Ga0495624_0131199 3300046690 Bacteria 1536
194 Ga0495670_0004878 3300046691 Bacteria 6588
195 Ga0495670_0073154 3300046691 Bacteria 1737
196 Ga0495670_0077203 3300046691 Bacteria 1693
197 Ga0495660_0073830 3300046810 Bacteria 1803
198 Ga0495604_0054391 3300047317 Bacteria 3089
199 Ga0495674_0003465 3300047319 Bacteria 15330
200 Ga0495674_0291603 3300047319 Bacteria 1334
201 Ga0495676_0072253 3300047321 Bacteria 2650
202 Ga0495684_0061283 3300047471 Bacteria 2862
203 Ga0495593_0067345 3300047673 Bacteria 1864
204 Ga0496101_0090807 3300048904 Bacteria 2272
205 Ga0496102_0467703 3300048905 Bacteria 1182
206 Ga0496102_0475059 3300048905 Bacteria 1171
207 Ga0496104_0205595 3300048907 Bacteria 1881
208 Ga0496104_0213858 3300048907 Bacteria 1839
209 Ga0496105_0031745 3300048908 Bacteria 4331
210 Ga0496108_0050214 3300048911 Bacteria 3491
211 Ga0496108_0200664 3300048911 Bacteria 1731
212 Ga0496112_0235335 3300048915 Bacteria 1785
213 Ga0496115_0458962 3300048918 Bacteria 1028
214 Ga0496116_0006031 3300048919 Bacteria 11095
215 Ga0496117_0046908 3300048920 Bacteria 3104
216 Ga0496117_0058063 3300048920 Bacteria 2682
217 Ga0496118_0049440 3300048921 Bacteria 3238
218 Ga0496118_0063583 3300048921 Bacteria 2714
219 Ga0496119_0153610 3300048922 Bacteria 1231
220 Ga0496120_0065204 3300048923 Bacteria 2019
221 Ga0496121_0006633 3300048924 Bacteria 14254
222 Ga0496121_0017686 3300048924 Bacteria 7256
223 Ga0496122_0010744 3300048925 Bacteria 9391
224 Ga0496122_0152469 3300048925 Bacteria 1424
225 Ga0496122_0274871 3300048925 Bacteria 925
226 Ga0496123_0036404 3300048926 Bacteria 3491
227 Ga0496123_0158828 3300048926 Bacteria 1208
228 Ga0496124_0181898 3300048927 Bacteria 1617
229 Ga0496124_0300869 3300048927 Bacteria 1159
230 Ga0496125_0025922 3300048928 Bacteria 5356
231 Ga0496125_0065181 3300048928 Bacteria 2888
232 Ga0496125_0239608 3300048928 Bacteria 1153
233 Ga0496126_0139555 3300048929 Bacteria 2087
234 Ga0501067_0055938 3300049583 Bacteria 2186
235 nmdc:mga03n38_53870_c1 3300050490 Bacteria 1806
236 nmdc:mga00v17_233909_c1 3300050491 Bacteria 1191
237 nmdc:mga00v17_27373_c1 3300050491 Bacteria 3328
238 nmdc:mga00v17_299687_c1 3300050491 Bacteria 1044
239 nmdc:mga0yw44_21367_c1 3300050492 Bacteria 3609
240 nmdc:mga0yw44_27119_c1 3300050492 Bacteria 3278
241 nmdc:mga0yw44_56798_c1 3300050492 Bacteria 2386
242 nmdc:mga0yw44_6339_c1 3300050492 Bacteria 5709
243 nmdc:mga06z11_192512_c1 3300050494 Bacteria 1181
244 nmdc:mga06z11_30436_c1 3300050494 Bacteria 2612
245 nmdc:mga06z11_59313_c1 3300050494 Bacteria 1989
246 nmdc:mga07m45_118817_c1 3300050496 Bacteria 1526
247 nmdc:mga07m45_13999_c1 3300050496 Bacteria 4265
248 nmdc:mga07m45_73106_c1 3300050496 Bacteria 1952
249 nmdc:mga0sz30_3474_c2 3300050516 Bacteria 4650
250 Ga0495601_0051270 3300053077 Bacteria 2605
251 Ga0495601_0074759 3300053077 Bacteria 2168
252 Ga0495601_0102972 3300053077 Bacteria 1845
253 Ga0495595_0107943 3300053084 Bacteria 1348
254 Ga0500643_017749 3300053087 Bacteria 2376
255 Ga0500644_0043361 3300053088 Bacteria 1504
256 Ga0500581_064362 3300053089 Bacteria 1853
257 Ga0500583_0047342 3300053092 Bacteria 1981
258 Ga0500651_0046532 3300053093 Bacteria 2729
259 Ga0500650_0000157 3300053098 Bacteria 17929
260 Ga0500556_0000002 3300053104 Bacteria 773626
261 Ga0500569_022573 3300053109 Bacteria 1678
262 Ga0500592_003596 3300053116 Bacteria 2475
263 Ga0500594_0011276 3300053118 Bacteria 2086
264 Ga0500652_000564 3300053131 Bacteria 12958
265 Ga0500658_0006618 3300053134 Bacteria 4294
266 Ga0500559_0208071 3300053136 Bacteria 923
267 Ga0500568_0008323 3300053139 Bacteria 5011
268 Ga0500604_0000635 3300053151 Bacteria 9651
269 Ga0500622_0000518 3300053156 Bacteria 35866
270 Ga0500634_0192661 3300053161 Bacteria 904
271 Ga0500609_004529 3300053731 Bacteria 1919
272 2603856777 2602042107 Bacteria 6226103
273 2793079922
274 2857528255 2857524615 Bacteria 6615449
275 2874605539 2874604998 Bacteria 7834745
276 2876813029 2876808645 Bacteria 8824342
277 2879115853 2879110137 Bacteria 8907982
278 2889039414 2889033259 Bacteria 9099371
279 2919075679 2919073203 Bacteria 6531949
280 2922391298 2922386360 Bacteria 7017218
281 8006972442 8006964411 Bacteria 8966052
282 8006987901 8006984368 Bacteria 9651211
283 8056677694 8056673599 Bacteria 7871253
284 Ga0307515_10045960
285 JGI25153J46596_10016009
286 Ga0070680_100107577
287 Ga0070682_100338585
288 Ga0068868_100028693
289 Ga0068868_100572486
290 Ga0070660_100118479
291 Ga0070689_100230732
292 Ga0070661_100125958
293 Ga0070668_100170379
294 Ga0070668_100420799
295 Ga0070668_100492015
296 Ga0070674_100187960
297 Ga0070667_100473929
298 Ga0070711_100020886
299 Ga0070663_100055656
300 Ga0070678_100117733
301 Ga0070678_100281883
302 Ga0070662_100408426
303 Ga0070681_10004544
304 Ga0070681_10103453
305 Ga0070685_10286444
306 Ga0070706_100303000
307 Ga0070679_100021572
308 Ga0070679_100301260
309 Ga0070684_100225994
310 Ga0068853_100647486
311 Ga0070665_100059576
312 Ga0070665_100065998
313 Ga0070665_100125579
314 Ga0070665_100435454
315 Ga0068856_100099117
316 Ga0070702_100339613
317 Ga0068864_100712992
318 Ga0068851_10004272
319 Ga0068858_100293788
320 Ga0068860_100144236
321 Ga0068862_100329406
322 Ga0081538_10034813
323 Ga0081540_1002690
324 Ga0081540_1017195
325 Ga0081540_1044360
326 Ga0075365_10075088
327 Ga0075365_10149439
328 Ga0075365_10180139
329 Ga0075364_10122667
330 Ga0075362_10022802
331 Ga0075367_10000988
332 Ga0075369_10008785
333 Ga0075369_10024805
334 Ga0075370_10213127
335 Ga0068871_100376650
336 Ga0075428_100079146
337 Ga0097620_100171379
338 Ga0099795_10028929
339 Ga0105240_10540784
340 Ga0114129_10111337
341 Ga0105241_10032147
342 Ga0105248_10263800
343 Ga0105248_10340617
344 Ga0105237_10216485
345 Ga0105238_10596953
346 Ga0105238_10698344
347 Ga0105249_10578209
348 Ga0099796_10021898
349 Ga0105239_10231697
350 Ga0105239_10336744
351 Ga0105239_10340438
352 Ga0105246_10160772
353 Ga0105246_10351569
354 Ga0157369_10006547
355 Ga0157378_10205993
356 Ga0163162_10217372
357 Ga0163162_10437901
358 Ga0157372_10852397
359 Ga0157375_10300634
360 Ga0157380_10329795
361 Ga0157379_10383594
362 Ga0157376_10187855
363 Ga0163161_10207570
364 Ga0163161_10437643
365 Ga0209564_1011501
366 Ga0209758_1004785
367 Ga0207710_10164087
368 Ga0207699_10004016
369 Ga0207684_10318289
370 Ga0207654_10026739
371 Ga0207707_10000359
372 Ga0207707_10154833
373 Ga0207707_10277057
374 Ga0207693_10013028
375 Ga0207693_10022195
376 Ga0207660_10027186
377 Ga0207662_10243303
378 Ga0207657_10461258
379 Ga0207652_10003470
380 Ga0207652_10281063
381 Ga0207709_10114811
382 Ga0207667_10162547
383 Ga0207668_10124223
384 Ga0207677_10031837
385 Ga0207703_10341013
386 Ga0207703_10450402
387 Ga0207678_10035639
388 Ga0207678_10212644
389 Ga0207648_10266565
390 Ga0207675_100266564
391 Ga0207683_10084701
392 Ga0207683_10115071
393 Ga0207683_10369881
394 Ga0207698_10350160
395 Ga0268266_10002394
396 Ga0268266_10003934
397 Ga0268266_10027683
398 Ga0268265_10181073
399 Ga0268264_10027494
400 Ga0307515_10212609
401 Ga0307513_10184797
402 Ga0307509_10180532
403 Ga0307408_100277295
404 Ga0307508_10156701
405 Ga0307406_10213629
406 Ga0307412_10082860
407 Ga0307416_100328820
408 Ga0307414_10168155
409 Ga0307510_10001061
410 Ga0316215_1004201
411 Ga0373926_0072562
412 Ga0373934_0014895
413 Ga0373923_0003551
414 Ga0373953_0007452
415 Ga0373943_0026933
416 Ga0373943_0097811
417 Ga0373924_0101645
418 Ga0373935_0129963
419 Ga0373935_0173522
420 Ga0373927_0016784
421 Ga0373927_0093885
422 Ga0373927_0147657
423 Ga0373933_0006955
424 Ga0373947_0025405
425 Ga0373947_0183578
426 Ga0373947_0198925
427 Ga0373925_0112208
428 Ga0451795_0309788
429 Ga0466957_0155221
430 Ga0466959_0047117
431 Ga0495603_0004410
432 Ga0495603_0044718
433 Ga0495603_0104863
434 Ga0495629_0080943
435 Ga0495638_0000646
436 Ga0495638_0030281
437 Ga0495641_0022963
438 Ga0495650_0078082
439 Ga0495580_0006636
440 Ga0495662_0028790
441 Ga0495664_0090586
442 Ga0495585_0097809
443 Ga0495585_0105615
444 Ga0495585_0181340
445 Ga0495606_0064798
446 Ga0495616_0053672
447 Ga0495618_0028419
448 Ga0495620_0037103
449 Ga0495628_0087625
450 Ga0495630_0008895
451 Ga0495631_0018759
452 Ga0495631_0121508
453 Ga0495632_0062420
454 Ga0495643_0088896
455 Ga0495644_0054690
456 Ga0495654_0020090
457 Ga0495640_0142508
458 Ga0495598_0004011
459 Ga0495598_0037755
460 Ga0495621_0034827
461 Ga0495597_0118696
462 Ga0495656_0064812
463 Ga0495634_0138428
464 Ga0495625_0142375
465 Ga0495625_0448111
466 Ga0495635_0055245
467 Ga0495659_0019059
468 Ga0495661_0056820
469 Ga0495661_0249728
470 Ga0495588_0093296
471 Ga0495599_0124582
472 Ga0495646_0038325
473 Ga0495647_0005841
474 Ga0495658_0003337
475 Ga0495624_0098752
476 Ga0495624_0131199
477 Ga0495670_0004878
478 Ga0495670_0073154
479 Ga0495670_0077203
480 Ga0495660_0073830
481 Ga0495604_0054391
482 Ga0495674_0003465
483 Ga0495674_0291603
484 Ga0495676_0072253
485 Ga0495684_0061283
486 Ga0495593_0067345
487 Ga0496101_0090807
488 Ga0496102_0467703
489 Ga0496102_0475059
490 Ga0496104_0205595
491 Ga0496104_0213858
492 Ga0496105_0031745
493 Ga0496108_0050214
494 Ga0496108_0200664
495 Ga0496112_0235335
496 Ga0496115_0458962
497 Ga0496116_0006031
498 Ga0496117_0046908
499 Ga0496117_0058063
500 Ga0496118_0049440
501 Ga0496118_0063583
502 Ga0496119_0153610
503 Ga0496120_0065204
504 Ga0496121_0006633
505 Ga0496121_0017686
506 Ga0496122_0010744
507 Ga0496122_0152469
508 Ga0496122_0274871
509 Ga0496123_0036404
510 Ga0496123_0158828
511 Ga0496124_0181898
512 Ga0496124_0300869
513 Ga0496125_0025922
514 Ga0496125_0065181
515 Ga0496125_0239608
516 Ga0496126_0139555
517 Ga0501067_0055938
518 nmdc:mga03n38_53870_c1
519 nmdc:mga00v17_233909_c1
520 nmdc:mga00v17_27373_c1
521 nmdc:mga00v17_299687_c1
522 nmdc:mga0yw44_21367_c1
523 nmdc:mga0yw44_27119_c1
524 nmdc:mga0yw44_56798_c1
525 nmdc:mga0yw44_6339_c1
526 nmdc:mga06z11_192512_c1
527 nmdc:mga06z11_30436_c1
528 nmdc:mga06z11_59313_c1
529 nmdc:mga07m45_118817_c1
530 nmdc:mga07m45_13999_c1
531 nmdc:mga07m45_73106_c1
532 nmdc:mga0sz30_3474_c2
533 Ga0495601_0051270
534 Ga0495601_0074759
535 Ga0495601_0102972
536 Ga0495595_0107943
537 Ga0500643_017749
538 Ga0500644_0043361
539 Ga0500581_064362
540 Ga0500583_0047342
541 Ga0500651_0046532
542 Ga0500650_0000157
543 Ga0500556_0000002
544 Ga0500569_022573
545 Ga0500592_003596
546 Ga0500594_0011276
547 Ga0500652_000564
548 Ga0500658_0006618
549 Ga0500559_0208071
550 Ga0500568_0008323
551 Ga0500604_0000635
552 Ga0500622_0000518
553 Ga0500634_0192661
554 Ga0500609_004529
555 2603856777
556 2793079922
557 2857528255
558 2874605539
559 2876813029
560 2879115853
561 2889039414
562 2919075679
563 2922391298
564 8006972442
565 8006987901
566 8056677694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7an6-assembly1.cif.gz_B enzyme of biosynthetic pathway 0.607 1 272
7an5-assembly1.cif.gz_A enzyme of biosynthetic pathway 0.6049 1 272
7an7-assembly1.cif.gz_A enzyme of biosynthetic pathway 0.6041 1 272
7an8-assembly1.cif.gz_B enzyme of biosynthetic pathway 0.6014 1 272
7ahr-assembly1.cif.gz_A enzyme of biosynthetic pathway 0.5995 1 272
ID Description Score Start End Superfamily
2v25B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7163 82 186 3.40.190.10
2x7qA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7105 1 75 3.40.190.10
3uifA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.6793 83 184 3.40.190.10
af_O33182_88_189_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.6729 83 171 3.40.190.10
1zbmA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.6676 82 197 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A0R3LRR7-F1-model_v4 SsuA/THI5-like domain-containing protein 0.9344 1 281
AF-A0A537Q7F1-F1-model_v4 SsuA/THI5-like domain-containing protein 0.9329 1 280
AF-A0A537Q7F1-F1-model_v4 SsuA/THI5-like domain-containing protein 0.9266 1 280
AF-A0A7X0FDV8-F1-model_v4 4,5-dihydroxyphthalate decarboxylase (EC 4.1.1.55) 0.9224 2 277 GO:0018796
AF-A0A3D9RB72-F1-model_v4 deleted 0.9148 1 277

Map