F385665

General Info

Members Datasets Scaffolds Average Seq Length
283 66 566 159

Family's Representative Sequence

Representative Sequence 3300031691|Ga0316579_10107867|Ga0316579_101078672
Length 182
Sequence MTTEIATFEPVIIGFTCNWCSYRAADLAGTARVKYPPNIRLIRLMCSGRLDPTFVLKAFAEGADAVMISGCHPGECHYIEQNIKALRRFELLRRTIQQMGIEPERLQLVWASAAEGTRLANEIARVTEEVRALGPLNWPAGRNGNLDSAGLEAAWEATGGEPGGPPETPGGENPEHAAEAKR

Samples

Sample ID Description Type Environment
1 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
7 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
8 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
9 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
10 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
11 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
12 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
13 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
14 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
15 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
16 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
17 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
18 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
19 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
20 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
21 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
28 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
29 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
30 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
31 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
32 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
33 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
34 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
35 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
36 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
37 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
38 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
39 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
40 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
41 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
42 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
43 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
44 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
45 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
46 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
47 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
48 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
49 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
50 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
51 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
52 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
53 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
54 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
55 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
56 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
57 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
58 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
59 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
60 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
61 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
62 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
63 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
64 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
65 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
66 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.57
Metatranscriptomes 19.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.23
Stem 0
Stem Tuber 0
Unclassified 27.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316579_10107867 3300031691 Bacteria 1336
2 SwRhRL3b_contig_398890 2162886006 Eukaryota 1544
3 SwRhRL2b_contig_1448716 2162886007 Bacteria 7311
4 Ga0065704_10000385 3300005289 Bacteria 41151
5 Ga0065707_10000437 3300005295 Bacteria 81012
6 Ga0075434_100980743 3300006871 Unclassified 859
7 Ga0075429_100066060 3300006880 Bacteria 3148
8 Ga0114129_10008767 3300009147 Bacteria 14423
9 Ga0105246_10027892 3300011119 Bacteria 3706
10 Ga0265318_10099461 3300028577 Bacteria 1070
11 Ga0316575_10005938 3300031665 Bacteria 4371
12 Ga0316575_10009775 3300031665 Bacteria 3516
13 Ga0316575_10023736 3300031665 Bacteria 2372
14 Ga0316575_10064267 3300031665 Unclassified 1469
15 Ga0316579_10000322 3300031691 Bacteria 14904
16 Ga0316579_10001798 3300031691 Bacteria 7903
17 Ga0316579_10008385 3300031691 Bacteria 4305
18 Ga0316579_10021646 3300031691 Bacteria 2867
19 Ga0316579_10034437 3300031691 Unclassified 2330
20 Ga0316579_10044243 3300031691 Bacteria 2073
21 Ga0316579_10078617 3300031691 Unclassified 1569
22 Ga0316579_10081996 3300031691 Unclassified 1536
23 Ga0316579_10098902 3300031691 Bacteria 1396
24 Ga0316579_10118435 3300031691 Unclassified 1272
25 Ga0316579_10492025 3300031691 Unclassified 593
26 Ga0316576_10000179 3300031727 Bacteria 26247
27 Ga0316576_10000303 3300031727 Bacteria 21791
28 Ga0316576_10002981 3300031727 Bacteria 9816
29 Ga0316576_10004168 3300031727 Bacteria 8627
30 Ga0316576_10008062 3300031727 Bacteria 6683
31 Ga0316576_10013941 3300031727 Bacteria 5360
32 Ga0316576_10049342 3300031727 Bacteria 3057
33 Ga0316576_10077165 3300031727 Unclassified 2467
34 Ga0316576_10095400 3300031727 Unclassified 2219
35 Ga0316576_10131088 3300031727 Bacteria 1886
36 Ga0316576_10209566 3300031727 Bacteria 1467
37 Ga0316576_10214581 3300031727 Unclassified 1448
38 Ga0316576_10347571 3300031727 Bacteria 1104
39 Ga0316576_10394649 3300031727 Bacteria 1026
40 Ga0316576_10637565 3300031727 Unclassified 776
41 Ga0316578_10000664 3300031728 Bacteria 12230
42 Ga0316578_10002941 3300031728 Bacteria 7651
43 Ga0316578_10003239 3300031728 Bacteria 7390
44 Ga0316578_10006255 3300031728 Bacteria 5860
45 Ga0316578_10006916 3300031728 Bacteria 5642
46 Ga0316578_10016906 3300031728 Bacteria 3958
47 Ga0316578_10024708 3300031728 Bacteria 3372
48 Ga0316578_10046707 3300031728 Unclassified 2524
49 Ga0316578_10130540 3300031728 Bacteria 1512
50 Ga0316578_10140852 3300031728 Bacteria 1453
51 Ga0316578_10141027 3300031728 Unclassified 1452
52 Ga0316578_10350674 3300031728 Bacteria 878
53 Ga0316578_10356479 3300031728 Unclassified 870
54 Ga0316578_10378269 3300031728 Bacteria 841
55 Ga0316578_10499781 3300031728 Bacteria 717
56 Ga0316578_10556921 3300031728 Unclassified 673
57 Ga0316577_10000497 3300031733 Bacteria 15594
58 Ga0316577_10000590 3300031733 Bacteria 14916
59 Ga0316577_10001555 3300031733 Bacteria 10914
60 Ga0316577_10007273 3300031733 Bacteria 5904
61 Ga0316577_10017261 3300031733 Unclassified 3983
62 Ga0316577_10022711 3300031733 Bacteria 3483
63 Ga0316577_10087502 3300031733 Bacteria 1743
64 Ga0316577_10102056 3300031733 Unclassified 1608
65 Ga0316577_10116857 3300031733 Bacteria 1498
66 Ga0316577_10130454 3300031733 Bacteria 1414
67 Ga0316577_10132761 3300031733 Unclassified 1401
68 Ga0316577_10208955 3300031733 Bacteria 1103
69 Ga0316577_10231533 3300031733 Unclassified 1045
70 Ga0316577_10601435 3300031733 Unclassified 625
71 Ga0307413_11155531 3300031824 Unclassified 671
72 Ga0307407_11458927 3300031903 Unclassified 540
73 Ga0307416_101291326 3300032002 Unclassified 836
74 Ga0316583_10000134 3300032133 Bacteria 17327
75 Ga0316583_10034109 3300032133 Bacteria 1805
76 Ga0316583_10153576 3300032133 Unclassified 801
77 Ga0316585_10000007 3300032137 Bacteria 31913
78 Ga0316585_10004097 3300032137 Bacteria 4044
79 Ga0316585_10090596 3300032137 Unclassified 999
80 Ga0316585_10106656 3300032137 Bacteria 920
81 Ga0316580_10000256 3300032139 Bacteria 11378
82 Ga0316580_10005632 3300032139 Bacteria 3666
83 Ga0316580_10020454 3300032139 Unclassified 2039
84 Ga0316593_10000492 3300032168 Bacteria 7329
85 Ga0316593_10000708 3300032168 Bacteria 6522
86 Ga0316593_10001059 3300032168 Bacteria 5748
87 Ga0316593_10001563 3300032168 Bacteria 5097
88 Ga0316593_10002686 3300032168 Bacteria 4278
89 Ga0316593_10025602 3300032168 Bacteria 1880
90 Ga0316593_10058139 3300032168 Bacteria 1318
91 Ga0316593_10097887 3300032168 Bacteria 1038
92 Ga0316593_10141370 3300032168 Unclassified 872
93 Ga0316592_1000104 3300033524 Bacteria 8625
94 Ga0316592_1000141 3300033524 Bacteria 7961
95 Ga0316592_1001039 3300033524 Bacteria 4320
96 Ga0316592_1006648 3300033524 Bacteria 2234
97 Ga0316592_1058669 3300033524 Unclassified 863
98 Ga0316592_1072821 3300033524 Unclassified 778
99 Ga0316586_1000042 3300033527 Bacteria 8762
100 Ga0316586_1000074 3300033527 Bacteria 7262
101 Ga0316586_1000315 3300033527 Bacteria 4441
102 Ga0316586_1000324 3300033527 Bacteria 4408
103 Ga0316586_1000374 3300033527 Unclassified 4222
104 Ga0316586_1000428 3300033527 Bacteria 4053
105 Ga0316586_1000654 3300033527 Bacteria 3472
106 Ga0316586_1000682 3300033527 Bacteria 3427
107 Ga0316586_1001222 3300033527 Bacteria 2859
108 Ga0316586_1011820 3300033527 Bacteria 1344
109 Ga0316586_1027697 3300033527 Bacteria 960
110 Ga0316586_1072897 3300033527 Bacteria 634
111 Ga0316586_1103527 3300033527 Unclassified 546
112 Ga0316588_1000081 3300033528 Bacteria 8504
113 Ga0316588_1000109 3300033528 Bacteria 8001
114 Ga0316588_1000184 3300033528 Bacteria 7089
115 Ga0316588_1000918 3300033528 Bacteria 4523
116 Ga0316588_1001001 3300033528 Bacteria 4401
117 Ga0316588_1001321 3300033528 Bacteria 4005
118 Ga0316588_1004575 3300033528 Unclassified 2633
119 Ga0316588_1011431 3300033528 Unclassified 1894
120 Ga0316588_1016308 3300033528 Bacteria 1645
121 Ga0316588_1027183 3300033528 Unclassified 1328
122 Ga0316588_1052211 3300033528 Bacteria 992
123 Ga0316588_1062477 3300033528 Unclassified 909
124 Ga0316588_1143339 3300033528 Unclassified 611
125 Ga0316587_1000149 3300033529 Bacteria 5664
126 Ga0316587_1004484 3300033529 Bacteria 2034
127 Ga0316587_1008275 3300033529 Bacteria 1631
128 Ga0316587_1011205 3300033529 Unclassified 1444
129 Ga0316587_1044358 3300033529 Unclassified 807
130 Ga0316587_1073530 3300033529 Bacteria 642
131 Ga0316596_1000088 3300033541 Bacteria 11233
132 Ga0316596_1000930 3300033541 Bacteria 5564
133 Ga0316596_1001695 3300033541 Bacteria 4553
134 Ga0316596_1002735 3300033541 Bacteria 3794
135 Ga0316596_1002755 3300033541 Bacteria 3787
136 Ga0316596_1028404 3300033541 Bacteria 1446
137 Ga0316596_1039305 3300033541 Bacteria 1241
138 Ga0316596_1055066 3300033541 Bacteria 1056
139 Ga0316574_0000797 3300035398 Bacteria 13671
140 Ga0316574_0004280 3300035398 Bacteria 7456
141 Ga0316574_0014976 3300035398 Bacteria 4492
142 Ga0316574_0017328 3300035398 Unclassified 4216
143 Ga0316574_0030976 3300035398 Bacteria 3243
144 Ga0316574_0053675 3300035398 Bacteria 2516
145 Ga0316574_0116509 3300035398 Bacteria 1714
146 Ga0316574_0184392 3300035398 Unclassified 1342
147 Ga0316574_0188351 3300035398 Bacteria 1327
148 Ga0316574_0229352 3300035398 Bacteria 1189
149 Ga0316574_0255569 3300035398 Unclassified 1119
150 Ga0316574_0429229 3300035398 Bacteria 830
151 Ga0316574_0739365 3300035398 Unclassified 601
152 Ga0316582_0014399 3300036647 Unclassified 4487
153 Ga0316582_0017177 3300036647 Bacteria 4179
154 Ga0316582_0023160 3300036647 Unclassified 3698
155 Ga0316582_0028817 3300036647 Bacteria 3367
156 Ga0316582_0030591 3300036647 Unclassified 3281
157 Ga0316582_0036149 3300036647 Unclassified 3055
158 Ga0316582_0039553 3300036647 Bacteria 2937
159 Ga0316582_0044112 3300036647 Bacteria 2801
160 Ga0316582_0054965 3300036647 Bacteria 2537
161 Ga0316582_0060378 3300036647 Bacteria 2430
162 Ga0316582_0093426 3300036647 Bacteria 1983
163 Ga0316582_0105793 3300036647 Bacteria 1868
164 Ga0316582_0128991 3300036647 Unclassified 1697
165 Ga0316582_0168631 3300036647 Unclassified 1485
166 Ga0316582_0474895 3300036647 Bacteria 862
167 Ga0316582_0509039 3300036647 Unclassified 830
168 Ga0316582_1033948 3300036647 Unclassified 560
169 Ga0316584_0001088 3300036712 Bacteria 15887
170 Ga0316584_0004941 3300036712 Bacteria 8873
171 Ga0316584_0009958 3300036712 Bacteria 6621
172 Ga0316584_0051982 3300036712 Bacteria 3065
173 Ga0316584_0053538 3300036712 Bacteria 3020
174 Ga0316584_0060136 3300036712 Bacteria 2845
175 Ga0316584_0077630 3300036712 Unclassified 2488
176 Ga0316584_0111860 3300036712 Bacteria 2043
177 Ga0316584_0130242 3300036712 Unclassified 1879
178 Ga0316584_0223621 3300036712 Bacteria 1382
179 Ga0316584_0296692 3300036712 Bacteria 1171
180 Ga0316584_0482159 3300036712 Bacteria 873
181 Ga0316584_0536831 3300036712 Unclassified 818
182 Ga0316581_0007325 3300037588 Unclassified 2956
183 Ga0316581_0023461 3300037588 Unclassified 1825
184 Ga0316581_0033003 3300037588 Bacteria 1563
185 Ga0316581_0045923 3300037588 Unclassified 1335
186 Ga0400484_06661 3300038725 Bacteria 16539
187 Ga0400484_33134 3300038725 Bacteria 1254
188 Ga0400490_19113 3300038726 Bacteria 10534
189 Ga0400483_144676 3300039062 Bacteria 1100
190 Ga0400489_25125 3300039093 Bacteria 1910
191 Ga0451577_0067910 3300042876 Bacteria 3180
192 Ga0451577_0105605 3300042876 Bacteria 2517
193 Ga0451577_0594088 3300042876 Unclassified 1005
194 Ga0451577_0719253 3300042876 Bacteria 904
195 Ga0451577_1299425 3300042876 Bacteria 647
196 Ga0453683_0006138 3300044673 Bacteria 8274
197 Ga0453683_0010055 3300044673 Bacteria 6290
198 Ga0453683_0219446 3300044673 Bacteria 1209
199 Ga0453683_0811859 3300044673 Bacteria 616
200 Ga0453684_0000003 3300044712 Bacteria 1481694
201 Ga0453684_0000640 3300044712 Bacteria 126342
202 Ga0453684_0002633 3300044712 Bacteria 42891
203 Ga0453684_0003052 3300044712 Bacteria 38873
204 Ga0453684_0003091 3300044712 Bacteria 38407
205 Ga0453684_0007761 3300044712 Bacteria 19573
206 Ga0453684_0013594 3300044712 Bacteria 13197
207 Ga0453684_0019366 3300044712 Bacteria 10364
208 Ga0453684_0032194 3300044712 Bacteria 7347
209 Ga0453684_0042211 3300044712 Bacteria 6152
210 Ga0453684_0044399 3300044712 Bacteria 5948
211 Ga0453684_0044637 3300044712 Bacteria 5925
212 Ga0453684_0112964 3300044712 Unclassified 3296
213 Ga0453684_0129411 3300044712 Unclassified 3031
214 Ga0453684_0254691 3300044712 Unclassified 2014
215 Ga0453684_0360364 3300044712 Bacteria 1637
216 Ga0453684_0360527 3300044712 Bacteria 1637
217 Ga0453684_0368649 3300044712 Unclassified 1615
218 Ga0453684_0408145 3300044712 Unclassified 1520
219 Ga0453684_0423828 3300044712 Bacteria 1486
220 Ga0453684_0599185 3300044712 Bacteria 1208
221 Ga0453684_0646401 3300044712 Bacteria 1155
222 Ga0453684_0761311 3300044712 Bacteria 1047
223 Ga0453684_0822877 3300044712 Bacteria 1000
224 Ga0453684_0899555 3300044712 Bacteria 948
225 Ga0453684_1033937 3300044712 Bacteria 872
226 Ga0453684_1049254 3300044712 Unclassified 864
227 Ga0453684_1060123 3300044712 Bacteria 859
228 Ga0453684_1117868 3300044712 Unclassified 831
229 Ga0453684_1994684 3300044712 Unclassified 585
230 Ga0453684_2078281 3300044712 Bacteria 570
231 Ga0451576_0018536 3300045051 Bacteria 7626
232 Ga0451576_0020476 3300045051 Bacteria 7202
233 Ga0451576_0040702 3300045051 Bacteria 4916
234 Ga0451576_0097442 3300045051 Bacteria 3058
235 Ga0451576_0568776 3300045051 Bacteria 1191
236 Ga0501292_067231 3300049515 Bacteria 660
237 Ga0501031_0008874 3300049568 Bacteria 6535
238 Ga0501036_0036074 3300049572 Bacteria 4183
239 Ga0501037_0208936 3300049573 Unclassified 1377
240 Ga0501038_0006809 3300049574 Bacteria 10558
241 Ga0501039_0022549 3300049575 Bacteria 4833
242 Ga0501040_0215799 3300049576 Bacteria 1364
243 Ga0501040_0491917 3300049576 Bacteria 884
244 Ga0501040_0891101 3300049576 Unclassified 644
245 Ga0501041_0000862 3300049577 Bacteria 16353
246 Ga0501041_0302006 3300049577 Unclassified 1009
247 Ga0501041_0632135 3300049577 Bacteria 684
248 Ga0501042_0390898 3300049578 Bacteria 1007
249 Ga0501046_0009166 3300049580 Bacteria 8573
250 Ga0501046_0288071 3300049580 Unclassified 1202
251 Ga0501048_0006016 3300049582 Bacteria 9239
252 Ga0501070_0010987 3300049586 Bacteria 7644
253 Ga0501071_0727884 3300049587 Unclassified 764
254 Ga0501072_0004279 3300049588 Bacteria 10832
255 Ga0501074_0197715 3300049590 Unclassified 1433
256 Ga0501075_0040036 3300049591 Bacteria 3508
257 Ga0501075_0068152 3300049591 Bacteria 2688
258 Ga0501075_0471331 3300049591 Unclassified 958
259 Ga0501075_1039717 3300049591 Bacteria 622
260 Ga0501076_0005038 3300049592 Bacteria 9456
261 Ga0501076_0286445 3300049592 Unclassified 1350
262 Ga0501076_1064516 3300049592 Bacteria 666
263 Ga0501077_0094613 3300049593 Bacteria 1894
264 Ga0501077_0507583 3300049593 Unclassified 773
265 Ga0501236_013520 3300049670 Bacteria 1118
266 Ga0501079_0008295 3300049741 Bacteria 7873
267 Ga0501079_0436071 3300049741 Bacteria 1029
268 Ga0501079_1095894 3300049741 Unclassified 627
269 Ga0501080_0022801 3300049742 Bacteria 5801
270 Ga0501080_0425778 3300049742 Bacteria 1192
271 Ga0501080_1092543 3300049742 Bacteria 689
272 Ga0501081_0014533 3300049743 Bacteria 5193
273 Ga0501081_0698747 3300049743 Unclassified 761
274 Ga0501035_0141431 3300049822 Bacteria 2092
275 Ga0501045_0009318 3300049824 Bacteria 6866
276 nmdc:mga05p37_9614_c1 3300050507 Bacteria 11452
277 Ga0501084_0038484 3300054114 Bacteria 3998
278 Ga0501084_0221987 3300054114 Bacteria 1595
279 Ga0501084_0270418 3300054114 Unclassified 1435
280 Ga0501084_0497361 3300054114 Bacteria 1030
281 Ga0501082_0196313 3300060353 Unclassified 1756
282 Ga0530510_0016284 3300061734 Bacteria 5258
283 Ga0530510_0949821 3300061734 Bacteria 657
284 Ga0316579_10107867
285 SwRhRL3b_contig_398890
286 SwRhRL2b_contig_1448716
287 Ga0065704_10000385
288 Ga0065707_10000437
289 Ga0075434_100980743
290 Ga0075429_100066060
291 Ga0114129_10008767
292 Ga0105246_10027892
293 Ga0265318_10099461
294 Ga0316575_10005938
295 Ga0316575_10009775
296 Ga0316575_10023736
297 Ga0316575_10064267
298 Ga0316579_10000322
299 Ga0316579_10001798
300 Ga0316579_10008385
301 Ga0316579_10021646
302 Ga0316579_10034437
303 Ga0316579_10044243
304 Ga0316579_10078617
305 Ga0316579_10081996
306 Ga0316579_10098902
307 Ga0316579_10118435
308 Ga0316579_10492025
309 Ga0316576_10000179
310 Ga0316576_10000303
311 Ga0316576_10002981
312 Ga0316576_10004168
313 Ga0316576_10008062
314 Ga0316576_10013941
315 Ga0316576_10049342
316 Ga0316576_10077165
317 Ga0316576_10095400
318 Ga0316576_10131088
319 Ga0316576_10209566
320 Ga0316576_10214581
321 Ga0316576_10347571
322 Ga0316576_10394649
323 Ga0316576_10637565
324 Ga0316578_10000664
325 Ga0316578_10002941
326 Ga0316578_10003239
327 Ga0316578_10006255
328 Ga0316578_10006916
329 Ga0316578_10016906
330 Ga0316578_10024708
331 Ga0316578_10046707
332 Ga0316578_10130540
333 Ga0316578_10140852
334 Ga0316578_10141027
335 Ga0316578_10350674
336 Ga0316578_10356479
337 Ga0316578_10378269
338 Ga0316578_10499781
339 Ga0316578_10556921
340 Ga0316577_10000497
341 Ga0316577_10000590
342 Ga0316577_10001555
343 Ga0316577_10007273
344 Ga0316577_10017261
345 Ga0316577_10022711
346 Ga0316577_10087502
347 Ga0316577_10102056
348 Ga0316577_10116857
349 Ga0316577_10130454
350 Ga0316577_10132761
351 Ga0316577_10208955
352 Ga0316577_10231533
353 Ga0316577_10601435
354 Ga0307413_11155531
355 Ga0307407_11458927
356 Ga0307416_101291326
357 Ga0316583_10000134
358 Ga0316583_10034109
359 Ga0316583_10153576
360 Ga0316585_10000007
361 Ga0316585_10004097
362 Ga0316585_10090596
363 Ga0316585_10106656
364 Ga0316580_10000256
365 Ga0316580_10005632
366 Ga0316580_10020454
367 Ga0316593_10000492
368 Ga0316593_10000708
369 Ga0316593_10001059
370 Ga0316593_10001563
371 Ga0316593_10002686
372 Ga0316593_10025602
373 Ga0316593_10058139
374 Ga0316593_10097887
375 Ga0316593_10141370
376 Ga0316592_1000104
377 Ga0316592_1000141
378 Ga0316592_1001039
379 Ga0316592_1006648
380 Ga0316592_1058669
381 Ga0316592_1072821
382 Ga0316586_1000042
383 Ga0316586_1000074
384 Ga0316586_1000315
385 Ga0316586_1000324
386 Ga0316586_1000374
387 Ga0316586_1000428
388 Ga0316586_1000654
389 Ga0316586_1000682
390 Ga0316586_1001222
391 Ga0316586_1011820
392 Ga0316586_1027697
393 Ga0316586_1072897
394 Ga0316586_1103527
395 Ga0316588_1000081
396 Ga0316588_1000109
397 Ga0316588_1000184
398 Ga0316588_1000918
399 Ga0316588_1001001
400 Ga0316588_1001321
401 Ga0316588_1004575
402 Ga0316588_1011431
403 Ga0316588_1016308
404 Ga0316588_1027183
405 Ga0316588_1052211
406 Ga0316588_1062477
407 Ga0316588_1143339
408 Ga0316587_1000149
409 Ga0316587_1004484
410 Ga0316587_1008275
411 Ga0316587_1011205
412 Ga0316587_1044358
413 Ga0316587_1073530
414 Ga0316596_1000088
415 Ga0316596_1000930
416 Ga0316596_1001695
417 Ga0316596_1002735
418 Ga0316596_1002755
419 Ga0316596_1028404
420 Ga0316596_1039305
421 Ga0316596_1055066
422 Ga0316574_0000797
423 Ga0316574_0004280
424 Ga0316574_0014976
425 Ga0316574_0017328
426 Ga0316574_0030976
427 Ga0316574_0053675
428 Ga0316574_0116509
429 Ga0316574_0184392
430 Ga0316574_0188351
431 Ga0316574_0229352
432 Ga0316574_0255569
433 Ga0316574_0429229
434 Ga0316574_0739365
435 Ga0316582_0014399
436 Ga0316582_0017177
437 Ga0316582_0023160
438 Ga0316582_0028817
439 Ga0316582_0030591
440 Ga0316582_0036149
441 Ga0316582_0039553
442 Ga0316582_0044112
443 Ga0316582_0054965
444 Ga0316582_0060378
445 Ga0316582_0093426
446 Ga0316582_0105793
447 Ga0316582_0128991
448 Ga0316582_0168631
449 Ga0316582_0474895
450 Ga0316582_0509039
451 Ga0316582_1033948
452 Ga0316584_0001088
453 Ga0316584_0004941
454 Ga0316584_0009958
455 Ga0316584_0051982
456 Ga0316584_0053538
457 Ga0316584_0060136
458 Ga0316584_0077630
459 Ga0316584_0111860
460 Ga0316584_0130242
461 Ga0316584_0223621
462 Ga0316584_0296692
463 Ga0316584_0482159
464 Ga0316584_0536831
465 Ga0316581_0007325
466 Ga0316581_0023461
467 Ga0316581_0033003
468 Ga0316581_0045923
469 Ga0400484_06661
470 Ga0400484_33134
471 Ga0400490_19113
472 Ga0400483_144676
473 Ga0400489_25125
474 Ga0451577_0067910
475 Ga0451577_0105605
476 Ga0451577_0594088
477 Ga0451577_0719253
478 Ga0451577_1299425
479 Ga0453683_0006138
480 Ga0453683_0010055
481 Ga0453683_0219446
482 Ga0453683_0811859
483 Ga0453684_0000003
484 Ga0453684_0000640
485 Ga0453684_0002633
486 Ga0453684_0003052
487 Ga0453684_0003091
488 Ga0453684_0007761
489 Ga0453684_0013594
490 Ga0453684_0019366
491 Ga0453684_0032194
492 Ga0453684_0042211
493 Ga0453684_0044399
494 Ga0453684_0044637
495 Ga0453684_0112964
496 Ga0453684_0129411
497 Ga0453684_0254691
498 Ga0453684_0360364
499 Ga0453684_0360527
500 Ga0453684_0368649
501 Ga0453684_0408145
502 Ga0453684_0423828
503 Ga0453684_0599185
504 Ga0453684_0646401
505 Ga0453684_0761311
506 Ga0453684_0822877
507 Ga0453684_0899555
508 Ga0453684_1033937
509 Ga0453684_1049254
510 Ga0453684_1060123
511 Ga0453684_1117868
512 Ga0453684_1994684
513 Ga0453684_2078281
514 Ga0451576_0018536
515 Ga0451576_0020476
516 Ga0451576_0040702
517 Ga0451576_0097442
518 Ga0451576_0568776
519 Ga0501292_067231
520 Ga0501031_0008874
521 Ga0501036_0036074
522 Ga0501037_0208936
523 Ga0501038_0006809
524 Ga0501039_0022549
525 Ga0501040_0215799
526 Ga0501040_0491917
527 Ga0501040_0891101
528 Ga0501041_0000862
529 Ga0501041_0302006
530 Ga0501041_0632135
531 Ga0501042_0390898
532 Ga0501046_0009166
533 Ga0501046_0288071
534 Ga0501048_0006016
535 Ga0501070_0010987
536 Ga0501071_0727884
537 Ga0501072_0004279
538 Ga0501074_0197715
539 Ga0501075_0040036
540 Ga0501075_0068152
541 Ga0501075_0471331
542 Ga0501075_1039717
543 Ga0501076_0005038
544 Ga0501076_0286445
545 Ga0501076_1064516
546 Ga0501077_0094613
547 Ga0501077_0507583
548 Ga0501236_013520
549 Ga0501079_0008295
550 Ga0501079_0436071
551 Ga0501079_1095894
552 Ga0501080_0022801
553 Ga0501080_0425778
554 Ga0501080_1092543
555 Ga0501081_0014533
556 Ga0501081_0698747
557 Ga0501035_0141431
558 Ga0501045_0009318
559 nmdc:mga05p37_9614_c1
560 Ga0501084_0038484
561 Ga0501084_0221987
562 Ga0501084_0270418
563 Ga0501084_0497361
564 Ga0501082_0196313
565 Ga0530510_0016284
566 Ga0530510_0949821

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02662

FlpD

Methyl-viologen-reducing hydrogenase, delta subunit

12

134

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
5odq-assembly1.cif.gz_D heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.9658 5 140
7bkb-assembly1.cif.gz_F formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.9623 4 132
5odq-assembly1.cif.gz_D heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. 0.9521 5 140
7bkb-assembly1.cif.gz_F formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.9012 4 132
6cb1-assembly1.cif.gz_I yeast nucleolar pre-60s ribosomal subunit (state 3) 0.617 1 69
ID Description Score Start End Superfamily
af_Q58806_1_244_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.6044 8 114 3.40.605.10
af_G5EE34_24_218_3.40.630.20 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Peptidase C15, pyroglutamyl peptidase I-like 0.6039 6 69 3.40.630.20
3pqaB01 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.5947 6 114 3.40.605.10
4kq6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.5938 7 131 3.40.50.960
af_A0A1T5HUM0_1_367_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.5923 5 106 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1Q9MZL4-F1-model_v4 Methyl-viologen-reducing hydrogenase delta subunit 0.9868 5 133 GO:0016491
GO:0051536
AF-A0A842MMY6-F1-model_v4 Hydrogenase iron-sulfur subunit 0.9852 4 132 GO:0016491
GO:0051536
AF-A0A522UYX0-F1-model_v4 Hydrogenase iron-sulfur subunit 0.9847 7 133 GO:0016491
GO:0051536
AF-A0A7J2TGW3-F1-model_v4 Hydrogenase iron-sulfur subunit 0.9846 8 133 GO:0016491
GO:0051536
AF-A0A7J2IS27-F1-model_v4 Hydrogenase iron-sulfur subunit 0.9841 6 133 GO:0016491
GO:0051536

Map